F412807

General Info

Members Datasets Scaffolds Average Seq Length
336 217 336 131

Family's Representative Sequence

Representative Sequence 3300046683|Ga0495658_0001961|Ga0495658_0001961_2305_2766
Length 153
Sequence LSFRSLSEQRLNHTLAITRLPGMSEQGQIARRSIGIVFSDGGLLALTSELPRGGAGIDDEQVTAVLCDPDGAPLTFEETLLSTEYGEDGVQRRATLELWPSVEEMRPLRGAGSLISSVRVRREGLDSQIAFFRWAVEGREGLGTYEVARTVDD

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
113 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
114 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
115 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
116 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
117 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
118 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
121 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
122 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
123 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
124 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
125 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
130 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
131 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
132 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
133 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
134 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
135 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
136 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
137 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
138 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
139 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
140 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
141 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
142 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
143 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
144 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
145 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
148 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
149 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
150 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
153 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
154 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
155 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
156 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
175 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
176 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
177 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
178 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
179 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
180 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
181 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
182 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
183 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
192 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
193 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
194 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
195 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
196 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
197 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
198 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
201 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
204 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
205 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
206 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
207 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
208 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
209 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
210 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
211 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
212 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
213 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
214 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
215 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
216 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
217 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.08
Nodule 0
Rhizoplane 11.61
Rhizosphere 79.46
Stem 0
Stem Tuber 0
Unclassified 6.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1007353 3300000546 Bacteria 1189
2 JGI24740J21852_10010899 3300001979 Bacteria 3477
3 JGI24748J21848_1000342 3300002074 Bacteria 5373
4 JGI24034J26672_10000196 3300002239 Bacteria 8101
5 JGI24742J22300_10000222 3300002244 Bacteria 8493
6 rootH2_10229049 3300003320 Unclassified 2828
7 Ga0070658_10436717 3300005327 Bacteria 1127
8 Ga0070683_100000502 3300005329 Bacteria 27604
9 Ga0070683_100000527 3300005329 Bacteria 26899
10 Ga0070683_100409722 3300005329 Bacteria 1293
11 Ga0068869_101731186 3300005334 Bacteria 558
12 Ga0070682_100000061 3300005337 Bacteria 105134
13 Ga0068868_100000220 3300005338 Bacteria 38739
14 Ga0070689_100327175 3300005340 Bacteria 1281
15 Ga0070691_10000013 3300005341 Bacteria 50559
16 Ga0070691_10000169 3300005341 Bacteria 21336
17 Ga0070661_100000110 3300005344 Bacteria 68106
18 Ga0070661_100348030 3300005344 Bacteria 1162
19 Ga0070692_10042484 3300005345 Bacteria 2334
20 Ga0070668_100011266 3300005347 Bacteria 6658
21 Ga0070668_100058968 3300005347 Bacteria 2971
22 Ga0070675_100000091 3300005354 Bacteria 52149
23 Ga0070674_100000030 3300005356 Bacteria 69481
24 Ga0070688_100000053 3300005365 Bacteria 55064
25 Ga0070688_100000918 3300005365 Bacteria 14725
26 Ga0070688_100611627 3300005365 Bacteria 835
27 Ga0070659_100368008 3300005366 Bacteria 1209
28 Ga0070667_100009466 3300005367 Bacteria 8081
29 Ga0070714_100039823 3300005435 Bacteria 3959
30 Ga0070713_100000023 3300005436 Bacteria 98528
31 Ga0070713_100268303 3300005436 Bacteria 1562
32 Ga0070711_100271011 3300005439 Bacteria 1339
33 Ga0070678_100020905 3300005456 Bacteria 4303
34 Ga0070685_10000032 3300005466 Bacteria 84253
35 Ga0070685_10000086 3300005466 Bacteria 57017
36 Ga0070685_10101986 3300005466 Bacteria 1754
37 Ga0070684_100087613 3300005535 Bacteria 2764
38 Ga0070684_100172963 3300005535 Bacteria 1962
39 Ga0070684_100708063 3300005535 Bacteria 939
40 Ga0070672_100000005 3300005543 Bacteria 121014
41 Ga0070686_100456419 3300005544 Bacteria 983
42 Ga0070665_100108613 3300005548 Bacteria 2777
43 Ga0070665_100728122 3300005548 Bacteria 1005
44 Ga0068855_100048599 3300005563 Bacteria 5006
45 Ga0068854_100004036 3300005578 Bacteria 9217
46 Ga0068856_100001228 3300005614 Bacteria 26877
47 Ga0068856_100014788 3300005614 Bacteria 7534
48 Ga0068856_101549391 3300005614 Unclassified 676
49 Ga0070702_100128161 3300005615 Bacteria 1599
50 Ga0068852_100000037 3300005616 Bacteria 97602
51 Ga0068859_100427862 3300005617 Bacteria 1420
52 Ga0068859_101256087 3300005617 Unclassified 816
53 Ga0068864_100000043 3300005618 Bacteria 162928
54 Ga0068866_10000005 3300005718 Bacteria 196339
55 Ga0068866_10000130 3300005718 Bacteria 33217
56 Ga0068851_10000372 3300005834 Bacteria 20278
57 Ga0068870_10625888 3300005840 Unclassified 734
58 Ga0068863_100017589 3300005841 Bacteria 6848
59 Ga0068863_100093058 3300005841 Bacteria 2861
60 Ga0068863_100153338 3300005841 Bacteria 2205
61 Ga0068858_100425332 3300005842 Unclassified 1277
62 Ga0068860_100247554 3300005843 Bacteria 1735
63 Ga0068862_100000366 3300005844 Bacteria 49032
64 Ga0081455_10043693 3300005937 Bacteria 3916
65 Ga0081540_1000046 3300005983 Bacteria 131375
66 Ga0081539_10001074 3300005985 Bacteria 49797
67 Ga0070712_100031210 3300006175 Bacteria 3588
68 Ga0097621_101257464 3300006237 Bacteria 698
69 Ga0075430_100100132 3300006846 Bacteria 2420
70 Ga0068865_100000081 3300006881 Bacteria 51047
71 Ga0068865_100507015 3300006881 Bacteria 1007
72 Ga0097620_100427874 3300006931 Bacteria 1420
73 Ga0097620_101255923 3300006931 Unclassified 816
74 Ga0105245_10000303 3300009098 Bacteria 47259
75 Ga0105245_10114305 3300009098 Bacteria 2514
76 Ga0105245_13075908 3300009098 Bacteria 517
77 Ga0105247_10000148 3300009101 Bacteria 68936
78 Ga0105247_10125827 3300009101 Bacteria 1666
79 Ga0105247_10133889 3300009101 Bacteria 1618
80 Ga0105241_10798017 3300009174 Bacteria 869
81 Ga0105242_10000052 3300009176 Bacteria 79244
82 Ga0105242_10001217 3300009176 Bacteria 20313
83 Ga0105242_10012891 3300009176 Bacteria 6443
84 Ga0105242_10230516 3300009176 Bacteria 1659
85 Ga0105248_10000017 3300009177 Bacteria 298089
86 Ga0105248_10522237 3300009177 Bacteria 1339
87 Ga0105238_11388238 3300009551 Bacteria 729
88 Ga0105249_10000916 3300009553 Bacteria 26081
89 Ga0105249_10454881 3300009553 Bacteria 1319
90 Ga0099796_10428672 3300010159 Unclassified 585
91 Ga0105239_10022212 3300010375 Bacteria 6993
92 Ga0157371_10002739 3300013102 Bacteria 16585
93 Ga0157370_10003677 3300013104 Bacteria 17915
94 Ga0157370_10472288 3300013104 Bacteria 1153
95 Ga0157369_10000105 3300013105 Bacteria 117996
96 Ga0157378_10036731 3300013297 Bacteria 4335
97 Ga0157378_10047863 3300013297 Bacteria 3802
98 Ga0157378_10061322 3300013297 Bacteria 3356
99 Ga0163162_10577697 3300013306 Bacteria 1251
100 Ga0163162_11365937 3300013306 Bacteria 806
101 Ga0157372_10000284 3300013307 Bacteria 56386
102 Ga0157375_10000620 3300013308 Bacteria 31506
103 Ga0157375_10000945 3300013308 Bacteria 25164
104 Ga0157375_12999082 3300013308 Unclassified 564
105 Ga0163163_10272169 3300014325 Bacteria 1745
106 Ga0157380_10000186 3300014326 Bacteria 35981
107 Ga0157380_10786076 3300014326 Bacteria 967
108 Ga0157379_10727553 3300014968 Bacteria 933
109 Ga0157376_10097609 3300014969 Bacteria 2560
110 Ga0157376_10737699 3300014969 Bacteria 993
111 Ga0163161_10014293 3300017792 Bacteria 5526
112 Ga0207656_10000244 3300025321 Bacteria 18974
113 Ga0207642_10000005 3300025899 Bacteria 401934
114 Ga0207642_10000047 3300025899 Bacteria 35336
115 Ga0207710_10000096 3300025900 Bacteria 116063
116 Ga0207705_10031630 3300025909 Bacteria 3779
117 Ga0207654_10148892 3300025911 Bacteria 1500
118 Ga0207693_10043212 3300025915 Bacteria 3546
119 Ga0207663_10142308 3300025916 Bacteria 1672
120 Ga0207649_10000015 3300025920 Bacteria 245662
121 Ga0207650_10289809 3300025925 Bacteria 1335
122 Ga0207659_10000707 3300025926 Bacteria 19793
123 Ga0207687_10000040 3300025927 Bacteria 113598
124 Ga0207687_10011372 3300025927 Bacteria 5817
125 Ga0207700_10000003 3300025928 Bacteria 500797
126 Ga0207664_10311671 3300025929 Bacteria 1386
127 Ga0207690_10006804 3300025932 Bacteria 6781
128 Ga0207686_10000119 3300025934 Bacteria 64297
129 Ga0207686_10001615 3300025934 Bacteria 12620
130 Ga0207686_10010792 3300025934 Bacteria 4979
131 Ga0207686_10051942 3300025934 Bacteria 2556
132 Ga0207669_10000029 3300025937 Bacteria 88351
133 Ga0207669_10000047 3300025937 Bacteria 60937
134 Ga0207704_10000018 3300025938 Bacteria 153994
135 Ga0207704_10357170 3300025938 Bacteria 1140
136 Ga0207691_10000028 3300025940 Bacteria 121090
137 Ga0207711_10000011 3300025941 Bacteria 518817
138 Ga0207661_10000391 3300025944 Bacteria 28421
139 Ga0207661_10000438 3300025944 Bacteria 26840
140 Ga0207661_10013749 3300025944 Bacteria 5911
141 Ga0207667_10034807 3300025949 Bacteria 5406
142 Ga0207712_10000994 3300025961 Bacteria 20219
143 Ga0207668_10004404 3300025972 Bacteria 8272
144 Ga0207668_10367965 3300025972 Bacteria 1206
145 Ga0207640_10000954 3300025981 Bacteria 16092
146 Ga0207658_10050400 3300025986 Bacteria 3063
147 Ga0207658_10231307 3300025986 Bacteria 1561
148 Ga0207677_10000929 3300026023 Bacteria 16369
149 Ga0207703_10000030 3300026035 Bacteria 199014
150 Ga0207703_10046470 3300026035 Bacteria 3496
151 Ga0207703_10316601 3300026035 Bacteria 1428
152 Ga0207678_10149046 3300026067 Bacteria 1997
153 Ga0207678_10981891 3300026067 Bacteria 747
154 Ga0207708_10049477 3300026075 Bacteria 3200
155 Ga0207702_10000419 3300026078 Bacteria 48574
156 Ga0207702_10003974 3300026078 Bacteria 13277
157 Ga0207641_10018672 3300026088 Bacteria 5685
158 Ga0207641_10322071 3300026088 Bacteria 1466
159 Ga0207676_10000042 3300026095 Bacteria 163475
160 Ga0207675_100230213 3300026118 Bacteria 1788
161 Ga0207683_10012181 3300026121 Bacteria 7341
162 Ga0207698_10000015 3300026142 Bacteria 207368
163 Ga0268266_10279837 3300028379 Bacteria 1551
164 Ga0268266_10595233 3300028379 Bacteria 1062
165 Ga0268265_10003823 3300028380 Bacteria 10667
166 Ga0268264_10161901 3300028381 Bacteria 2017
167 Ga0265319_1000010 3300028563 Bacteria 188773
168 Ga0265336_10021567 3300028666 Bacteria 2058
169 Ga0265338_10000051 3300028800 Bacteria 211202
170 Ga0265324_10082465 3300029957 Bacteria 1094
171 Ga0265332_10321690 3300031238 Bacteria 638
172 Ga0265325_10055330 3300031241 Bacteria 2029
173 Ga0265331_10045209 3300031250 Bacteria 2126
174 Ga0307415_100008478 3300032126 Bacteria 5701
175 Ga0451791_1330042 3300041451 Bacteria 723
176 Ga0451804_0496889 3300041463 Bacteria 853
177 Ga0451807_2483056 3300041486 Bacteria 1768
178 Ga0451833_0961990 3300041491 Bacteria 2462
179 Ga0451849_1196561 3300041505 Bacteria 978
180 Ga0451853_1492241 3300041512 Bacteria 2616
181 Ga0451853_2139338 3300041512 Unclassified 2042
182 Ga0466963_0000012 3300044694 Bacteria 62839
183 Ga0466963_0023597 3300044694 Bacteria 3909
184 Ga0466957_0053812 3300044842 Bacteria 2455
185 Ga0466957_0296275 3300044842 Bacteria 1086
186 Ga0466957_1367152 3300044842 Unclassified 515
187 Ga0466967_0000012 3300045976 Bacteria 104270
188 Ga0466967_0449082 3300045976 Bacteria 1260
189 Ga0495629_0000899 3300046459 Bacteria 23864
190 Ga0495629_0006397 3300046459 Bacteria 8736
191 Ga0495629_0020943 3300046459 Bacteria 4667
192 Ga0495629_0543520 3300046459 Bacteria 780
193 Ga0495641_0045048 3300046461 Bacteria 2032
194 Ga0495641_0259644 3300046461 Bacteria 781
195 Ga0495594_0000012 3300046499 Bacteria 105133
196 Ga0495608_0000013 3300046511 Bacteria 228481
197 Ga0495610_0081787 3300046512 Unclassified 1482
198 Ga0495628_0006106 3300046516 Bacteria 10535
199 Ga0495628_0207884 3300046516 Bacteria 1473
200 Ga0495630_0001450 3300046517 Bacteria 16430
201 Ga0495630_0039333 3300046517 Bacteria 3537
202 Ga0495630_0042315 3300046517 Bacteria 3402
203 Ga0495652_0000018 3300046529 Bacteria 201634
204 Ga0495640_0003807 3300046533 Bacteria 12117
205 Ga0495587_0010082 3300046536 Bacteria 6029
206 Ga0495587_0043491 3300046536 Bacteria 2675
207 Ga0495598_0003920 3300046537 Bacteria 3191
208 Ga0495622_0000076 3300046557 Bacteria 86777
209 Ga0495625_0000395 3300046660 Bacteria 66640
210 Ga0495588_0000247 3300046674 Bacteria 45295
211 Ga0495657_0000003 3300046675 Bacteria 279680
212 Ga0495647_0000307 3300046681 Bacteria 13755
213 Ga0495658_0001961 3300046683 Bacteria 10521
214 Ga0495613_0000132 3300046689 Bacteria 74233
215 Ga0495624_0000196 3300046690 Bacteria 46319
216 Ga0495600_0010574 3300046809 Bacteria 5730
217 Ga0495660_0060048 3300046810 Bacteria 2044
218 Ga0495604_0000448 3300047317 Bacteria 36537
219 Ga0495604_0005506 3300047317 Bacteria 10039
220 Ga0495674_0000039 3300047319 Bacteria 97645
221 Ga0495672_0101490 3300047320 Bacteria 1559
222 Ga0495672_0385291 3300047320 Bacteria 644
223 Ga0495676_0005595 3300047321 Bacteria 11530
224 Ga0495676_0045466 3300047321 Bacteria 3573
225 Ga0495680_0007059 3300047322 Bacteria 10353
226 Ga0495675_0000094 3300047444 Bacteria 63338
227 Ga0495675_0046300 3300047444 Bacteria 2769
228 Ga0495686_0170239 3300047472 Bacteria 1267
229 Ga0495602_0001025 3300048088 Bacteria 27203
230 Ga0495602_0006709 3300048088 Bacteria 12072
231 Ga0495602_0116722 3300048088 Bacteria 2156
232 Ga0496100_0000019 3300048903 Bacteria 149995
233 Ga0496101_0000005 3300048904 Bacteria 331455
234 Ga0496102_0000129 3300048905 Bacteria 104478
235 Ga0496102_0339523 3300048905 Bacteria 1415
236 Ga0496103_0000087 3300048906 Bacteria 104566
237 Ga0496103_0047770 3300048906 Bacteria 2645
238 Ga0496103_0228785 3300048906 Bacteria 1196
239 Ga0496104_0000010 3300048907 Bacteria 475255
240 Ga0496104_0013569 3300048907 Bacteria 7343
241 Ga0496104_0527504 3300048907 Bacteria 1092
242 Ga0496105_0000005 3300048908 Bacteria 475797
243 Ga0496106_0000156 3300048909 Bacteria 50301
244 Ga0496107_0000004 3300048910 Bacteria 297680
245 Ga0496107_0104614 3300048910 Bacteria 2078
246 Ga0496108_0000005 3300048911 Bacteria 535059
247 Ga0496108_0001236 3300048911 Bacteria 20040
248 Ga0496108_0003961 3300048911 Bacteria 11896
249 Ga0496108_1287411 3300048911 Bacteria 615
250 Ga0496109_0000002 3300048912 Bacteria 443393
251 Ga0496109_0000011 3300048912 Bacteria 234908
252 Ga0496109_0000589 3300048912 Bacteria 30428
253 Ga0496109_0242634 3300048912 Bacteria 1696
254 Ga0496110_0000185 3300048913 Bacteria 39094
255 Ga0496110_0096030 3300048913 Bacteria 2656
256 Ga0496110_0257616 3300048913 Bacteria 1588
257 Ga0496110_0872644 3300048913 Bacteria 805
258 Ga0496111_0002441 3300048914 Bacteria 11230
259 Ga0496111_0208039 3300048914 Bacteria 1454
260 Ga0496111_0599866 3300048914 Bacteria 806
261 Ga0496112_0001010 3300048915 Bacteria 20632
262 Ga0496113_0000017 3300048916 Bacteria 74327
263 Ga0496113_0053415 3300048916 Bacteria 3021
264 Ga0496114_0000003 3300048917 Bacteria 630981
265 Ga0496114_0042214 3300048917 Bacteria 3780
266 Ga0496115_0000022 3300048918 Bacteria 164224
267 Ga0496115_0000027 3300048918 Bacteria 145505
268 Ga0496116_0000120 3300048919 Bacteria 166804
269 Ga0496116_0389278 3300048919 Bacteria 622
270 Ga0496117_0001845 3300048920 Bacteria 28614
271 Ga0496117_0088520 3300048920 Bacteria 2003
272 Ga0496117_0181272 3300048920 Bacteria 1210
273 Ga0496118_0002153 3300048921 Bacteria 27471
274 Ga0496118_0038805 3300048921 Bacteria 3811
275 Ga0496118_0039670 3300048921 Bacteria 3755
276 Ga0496119_0005570 3300048922 Bacteria 11984
277 Ga0496119_0041355 3300048922 Bacteria 2936
278 Ga0496119_0069048 3300048922 Bacteria 2078
279 Ga0496120_0014583 3300048923 Bacteria 5231
280 Ga0496120_0056516 3300048923 Bacteria 2214
281 Ga0496121_0027386 3300048924 Bacteria 5334
282 Ga0496124_0369155 3300048927 Bacteria 1008
283 Ga0496124_0831925 3300048927 Unclassified 568
284 Ga0496125_0028914 3300048928 Bacteria 4992
285 Ga0496126_0568824 3300048929 Bacteria 897
286 Ga0501031_0972177 3300049568 Bacteria 543
287 Ga0501036_0444342 3300049572 Unclassified 1080
288 Ga0501039_0237033 3300049575 Bacteria 1435
289 Ga0501041_0230531 3300049577 Bacteria 1163
290 Ga0501042_0045383 3300049578 Bacteria 3132
291 Ga0501042_0227803 3300049578 Bacteria 1344
292 Ga0501043_0451172 3300049579 Bacteria 966
293 Ga0501043_0893644 3300049579 Bacteria 637
294 Ga0501047_0145836 3300049581 Bacteria 2244
295 Ga0501047_0240669 3300049581 Bacteria 1660
296 Ga0501048_0601371 3300049582 Bacteria 789
297 Ga0501068_0139058 3300049584 Bacteria 1522
298 Ga0501068_0143928 3300049584 Bacteria 1495
299 Ga0501069_0014783 3300049585 Bacteria 4176
300 Ga0501069_0141099 3300049585 Bacteria 1382
301 Ga0501070_0090004 3300049586 Bacteria 2540
302 Ga0501070_0262123 3300049586 Bacteria 1412
303 Ga0501071_0276103 3300049587 Bacteria 1271
304 Ga0501071_1310199 3300049587 Bacteria 559
305 Ga0501072_0032014 3300049588 Bacteria 4117
306 Ga0501074_0111472 3300049590 Bacteria 1957
307 Ga0501076_0609113 3300049592 Bacteria 901
308 Ga0501079_0121387 3300049741 Bacteria 2032
309 Ga0501080_0102070 3300049742 Bacteria 2661
310 Ga0501080_0211800 3300049742 Unclassified 1776
311 Ga0501081_1143003 3300049743 Unclassified 589
312 Ga0501083_0127711 3300049744 Bacteria 1666
313 Ga0501083_0174994 3300049744 Bacteria 1402
314 Ga0501044_0019507 3300049823 Bacteria 7250
315 Ga0501045_0526600 3300049824 Bacteria 877
316 nmdc:mga0qj67_118045_c1 3300050509 Bacteria 2144
317 nmdc:mga0rr50_760495_c1 3300050513 Bacteria 827
318 Ga0495601_0000029 3300053077 Bacteria 111437
319 Ga0495601_0056300 3300053077 Bacteria 2490
320 Ga0495612_0010530 3300053078 Bacteria 3738
321 Ga0495655_0000010 3300053083 Bacteria 125615
322 Ga0495655_0001176 3300053083 Bacteria 4048
323 Ga0495595_0000007 3300053084 Bacteria 228504
324 Ga0495595_0046927 3300053084 Bacteria 1991
325 Ga0495619_0000001 3300053085 Bacteria 586054
326 Ga0495619_0000067 3300053085 Bacteria 83418
327 Ga0495619_0000851 3300053085 Bacteria 20034
328 Ga0495619_0020030 3300053085 Bacteria 4256
329 Ga0500566_0008386 3300053094 Bacteria 6111
330 Ga0500566_0202816 3300053094 Unclassified 1000
331 Ga0500641_0004436 3300053096 Bacteria 4963
332 Ga0500595_160090 3300053119 Bacteria 627
333 Ga0500628_000024 3300053129 Bacteria 64538
334 Ga0500658_0130106 3300053134 Bacteria 1122
335 Ga0500568_0022468 3300053139 Bacteria 2697
336 Ga0501082_0185533 3300060353 Bacteria 1810

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047320 Ga0495672_0101490 Ga0495672_0101490_764_1138 123
2 3300047444 Ga0495675_0046300 Ga0495675_0046300_1273_1644 123
3 3300013104 Ga0157370_10472288 Ga0157370_104722882 128
4 3300046459 Ga0495629_0543520 Ga0495629_0543520_206_598 128
5 3300048911 Ga0496108_1287411 Ga0496108_1287411_141_530 128
6 3300005436 Ga0070713_100268303 Ga0070713_1002683032 129
7 3300005439 Ga0070711_100271011 Ga0070711_1002710112 129
8 3300005548 Ga0070665_100108613 Ga0070665_1001086133 129
9 3300005983 Ga0081540_1000046 Ga0081540_100004616 129
10 3300009176 Ga0105242_10230516 Ga0105242_102305163 129
11 3300009177 Ga0105248_10522237 Ga0105248_105222372 129
12 3300025916 Ga0207663_10142308 Ga0207663_101423083 129
13 3300044694 Ga0466963_0023597 Ga0466963_0023597_3148_3537 129
14 3300044842 Ga0466957_1367152 Ga0466957_1367152_105_494 129
15 3300045976 Ga0466967_0449082 Ga0466967_0449082_256_645 129
16 3300046529 Ga0495652_0000018 Ga0495652_0000018_183747_184136 129
17 3300046536 Ga0495587_0043491 Ga0495587_0043491_140_529 129
18 3300048927 Ga0496124_0369155 Ga0496124_0369155_144_542 129
19 3300049568 Ga0501031_0972177 Ga0501031_0972177_67_459 129
20 3300049572 Ga0501036_0444342 Ga0501036_0444342_409_801 129
21 3300049575 Ga0501039_0237033 Ga0501039_0237033_1000_1392 129
22 3300049577 Ga0501041_0230531 Ga0501041_0230531_628_1020 129
23 3300049579 Ga0501043_0893644 Ga0501043_0893644_43_435 129
24 3300049581 Ga0501047_0145836 Ga0501047_0145836_1633_2022 129
25 3300049581 Ga0501047_0240669 Ga0501047_0240669_575_967 129
26 3300049582 Ga0501048_0601371 Ga0501048_0601371_102_494 129
27 3300049585 Ga0501069_0014783 Ga0501069_0014783_974_1363 129
28 3300049585 Ga0501069_0141099 Ga0501069_0141099_961_1353 129
29 3300049586 Ga0501070_0262123 Ga0501070_0262123_325_714 129
30 3300049587 Ga0501071_0276103 Ga0501071_0276103_161_553 129
31 3300049587 Ga0501071_1310199 Ga0501071_1310199_70_462 129
32 3300049588 Ga0501072_0032014 Ga0501072_0032014_2801_3193 129
33 3300049590 Ga0501074_0111472 Ga0501074_0111472_43_435 129
34 3300049592 Ga0501076_0609113 Ga0501076_0609113_457_849 129
35 3300049741 Ga0501079_0121387 Ga0501079_0121387_312_704 129
36 3300049742 Ga0501080_0102070 Ga0501080_0102070_644_1036 129
37 3300049823 Ga0501044_0019507 Ga0501044_0019507_1078_1470 129
38 3300049824 Ga0501045_0526600 Ga0501045_0526600_463_855 129
39 3300053077 Ga0495601_0056300 Ga0495601_0056300_1028_1417 129
40 3300060353 Ga0501082_0185533 Ga0501082_0185533_318_710 129
41 3300000546 LJNas_1007353 LJNas_10073532 130
42 3300001979 JGI24740J21852_10010899 JGI24740J21852_100108992 130
43 3300002074 JGI24748J21848_1000342 JGI24748J21848_10003427 130
44 3300002239 JGI24034J26672_10000196 JGI24034J26672_100001963 130
45 3300002244 JGI24742J22300_10000222 JGI24742J22300_1000022211 130
46 3300003320 rootH2_10229049 rootH2_102290492 130
47 3300005327 Ga0070658_10436717 Ga0070658_104367172 130
48 3300005329 Ga0070683_100000502 Ga0070683_10000050214 130
49 3300005329 Ga0070683_100000527 Ga0070683_10000052712 130
50 3300005329 Ga0070683_100409722 Ga0070683_1004097223 130
51 3300005334 Ga0068869_101731186 Ga0068869_1017311862 130
52 3300005337 Ga0070682_100000061 Ga0070682_10000006151 130
53 3300005338 Ga0068868_100000220 Ga0068868_10000022029 130
54 3300005340 Ga0070689_100327175 Ga0070689_1003271752 130
55 3300005341 Ga0070691_10000013 Ga0070691_1000001348 130
56 3300005341 Ga0070691_10000169 Ga0070691_100001696 130
57 3300005344 Ga0070661_100000110 Ga0070661_10000011017 130
58 3300005344 Ga0070661_100348030 Ga0070661_1003480302 130
59 3300005345 Ga0070692_10042484 Ga0070692_100424843 130
60 3300005347 Ga0070668_100011266 Ga0070668_1000112662 130
61 3300005347 Ga0070668_100058968 Ga0070668_1000589683 130
62 3300005354 Ga0070675_100000091 Ga0070675_1000000913 130
63 3300005356 Ga0070674_100000030 Ga0070674_10000003024 130
64 3300005365 Ga0070688_100000053 Ga0070688_10000005316 130
65 3300005365 Ga0070688_100000918 Ga0070688_10000091813 130
66 3300005365 Ga0070688_100611627 Ga0070688_1006116272 130
67 3300005366 Ga0070659_100368008 Ga0070659_1003680082 130
68 3300005367 Ga0070667_100009466 Ga0070667_1000094668 130
69 3300005435 Ga0070714_100039823 Ga0070714_1000398232 130
70 3300005436 Ga0070713_100000023 Ga0070713_10000002387 130
71 3300005456 Ga0070678_100020905 Ga0070678_1000209055 130
72 3300005466 Ga0070685_10000032 Ga0070685_1000003216 130
73 3300005466 Ga0070685_10000086 Ga0070685_1000008644 130
74 3300005466 Ga0070685_10101986 Ga0070685_101019863 130
75 3300005535 Ga0070684_100087613 Ga0070684_1000876133 130
76 3300005535 Ga0070684_100172963 Ga0070684_1001729633 130
77 3300005535 Ga0070684_100708063 Ga0070684_1007080632 130
78 3300005543 Ga0070672_100000005 Ga0070672_10000000558 130
79 3300005544 Ga0070686_100456419 Ga0070686_1004564192 130
80 3300005548 Ga0070665_100728122 Ga0070665_1007281221 130
81 3300005563 Ga0068855_100048599 Ga0068855_1000485995 130
82 3300005578 Ga0068854_100004036 Ga0068854_1000040362 130
83 3300005614 Ga0068856_100001228 Ga0068856_10000122816 130
84 3300005614 Ga0068856_100014788 Ga0068856_1000147887 130
85 3300005614 Ga0068856_101549391 Ga0068856_1015493912 130
86 3300005615 Ga0070702_100128161 Ga0070702_1001281612 130
87 3300005616 Ga0068852_100000037 Ga0068852_10000003773 130
88 3300005617 Ga0068859_100427862 Ga0068859_1004278622 130
89 3300005617 Ga0068859_101256087 Ga0068859_1012560872 130
90 3300005618 Ga0068864_100000043 Ga0068864_10000004387 130
91 3300005718 Ga0068866_10000005 Ga0068866_1000000595 130
92 3300005718 Ga0068866_10000130 Ga0068866_1000013021 130
93 3300005834 Ga0068851_10000372 Ga0068851_1000037211 130
94 3300005840 Ga0068870_10625888 Ga0068870_106258882 130
95 3300005841 Ga0068863_100017589 Ga0068863_1000175895 130
96 3300005841 Ga0068863_100093058 Ga0068863_1000930582 130
97 3300005841 Ga0068863_100153338 Ga0068863_1001533382 130
98 3300005842 Ga0068858_100425332 Ga0068858_1004253322 130
99 3300005843 Ga0068860_100247554 Ga0068860_1002475542 130
100 3300005844 Ga0068862_100000366 Ga0068862_10000036615 130
101 3300005937 Ga0081455_10043693 Ga0081455_100436933 130
102 3300005985 Ga0081539_10001074 Ga0081539_1000107440 130
103 3300006175 Ga0070712_100031210 Ga0070712_1000312104 130
104 3300006237 Ga0097621_101257464 Ga0097621_1012574642 130
105 3300006846 Ga0075430_100100132 Ga0075430_1001001322 130
106 3300006881 Ga0068865_100000081 Ga0068865_10000008137 130
107 3300006881 Ga0068865_100507015 Ga0068865_1005070152 130
108 3300006931 Ga0097620_100427874 Ga0097620_1004278742 130
109 3300006931 Ga0097620_101255923 Ga0097620_1012559232 130
110 3300009098 Ga0105245_10000303 Ga0105245_1000030330 130
111 3300009098 Ga0105245_10114305 Ga0105245_101143052 130
112 3300009098 Ga0105245_13075908 Ga0105245_130759081 130
113 3300009101 Ga0105247_10000148 Ga0105247_100001482 130
114 3300009101 Ga0105247_10125827 Ga0105247_101258274 130
115 3300009101 Ga0105247_10133889 Ga0105247_101338893 130
116 3300009174 Ga0105241_10798017 Ga0105241_107980172 130
117 3300009176 Ga0105242_10000052 Ga0105242_1000005225 130
118 3300009176 Ga0105242_10001217 Ga0105242_1000121711 130
119 3300009176 Ga0105242_10012891 Ga0105242_100128914 130
120 3300009177 Ga0105248_10000017 Ga0105248_10000017233 130
121 3300009551 Ga0105238_11388238 Ga0105238_113882382 130
122 3300009553 Ga0105249_10000916 Ga0105249_1000091621 130
123 3300009553 Ga0105249_10454881 Ga0105249_104548812 130
124 3300010159 Ga0099796_10428672 Ga0099796_104286722 130
125 3300010375 Ga0105239_10022212 Ga0105239_100222125 130
126 3300013102 Ga0157371_10002739 Ga0157371_100027397 130
127 3300013104 Ga0157370_10003677 Ga0157370_1000367713 130
128 3300013105 Ga0157369_10000105 Ga0157369_1000010571 130
129 3300013297 Ga0157378_10036731 Ga0157378_100367316 130
130 3300013297 Ga0157378_10047863 Ga0157378_100478633 130
131 3300013297 Ga0157378_10061322 Ga0157378_100613224 130
132 3300013306 Ga0163162_10577697 Ga0163162_105776971 130
133 3300013306 Ga0163162_11365937 Ga0163162_113659372 130
134 3300013307 Ga0157372_10000284 Ga0157372_1000028445 130
135 3300013308 Ga0157375_10000620 Ga0157375_1000062023 130
136 3300013308 Ga0157375_10000945 Ga0157375_1000094511 130
137 3300013308 Ga0157375_12999082 Ga0157375_129990821 130
138 3300014325 Ga0163163_10272169 Ga0163163_102721693 130
139 3300014326 Ga0157380_10000186 Ga0157380_1000018617 130
140 3300014326 Ga0157380_10786076 Ga0157380_107860762 130
141 3300014968 Ga0157379_10727553 Ga0157379_107275532 130
142 3300014969 Ga0157376_10097609 Ga0157376_100976093 130
143 3300014969 Ga0157376_10737699 Ga0157376_107376991 130
144 3300017792 Ga0163161_10014293 Ga0163161_100142933 130
145 3300025321 Ga0207656_10000244 Ga0207656_1000024416 130
146 3300025899 Ga0207642_10000005 Ga0207642_10000005300 130
147 3300025899 Ga0207642_10000047 Ga0207642_1000004721 130
148 3300025900 Ga0207710_10000096 Ga0207710_1000009688 130
149 3300025909 Ga0207705_10031630 Ga0207705_100316305 130
150 3300025911 Ga0207654_10148892 Ga0207654_101488922 130
151 3300025915 Ga0207693_10043212 Ga0207693_100432122 130
152 3300025920 Ga0207649_10000015 Ga0207649_10000015199 130
153 3300025925 Ga0207650_10289809 Ga0207650_102898092 130
154 3300025926 Ga0207659_10000707 Ga0207659_1000070714 130
155 3300025927 Ga0207687_10000040 Ga0207687_10000040103 130
156 3300025927 Ga0207687_10011372 Ga0207687_100113725 130
157 3300025928 Ga0207700_10000003 Ga0207700_1000000387 130
158 3300025929 Ga0207664_10311671 Ga0207664_103116712 130
159 3300025932 Ga0207690_10006804 Ga0207690_100068042 130
160 3300025934 Ga0207686_10000119 Ga0207686_1000011911 130
161 3300025934 Ga0207686_10001615 Ga0207686_1000161511 130
162 3300025934 Ga0207686_10010792 Ga0207686_100107924 130
163 3300025934 Ga0207686_10051942 Ga0207686_100519424 130
164 3300025937 Ga0207669_10000029 Ga0207669_1000002924 130
165 3300025937 Ga0207669_10000047 Ga0207669_1000004717 130
166 3300025938 Ga0207704_10000018 Ga0207704_1000001881 130
167 3300025938 Ga0207704_10357170 Ga0207704_103571702 130
168 3300025940 Ga0207691_10000028 Ga0207691_1000002872 130
169 3300025941 Ga0207711_10000011 Ga0207711_10000011280 130
170 3300025944 Ga0207661_10000391 Ga0207661_1000039115 130
171 3300025944 Ga0207661_10000438 Ga0207661_1000043811 130
172 3300025944 Ga0207661_10013749 Ga0207661_100137494 130
173 3300025949 Ga0207667_10034807 Ga0207667_100348075 130
174 3300025961 Ga0207712_10000994 Ga0207712_1000099419 130
175 3300025972 Ga0207668_10004404 Ga0207668_100044042 130
176 3300025972 Ga0207668_10367965 Ga0207668_103679652 130
177 3300025981 Ga0207640_10000954 Ga0207640_1000095421 130
178 3300025986 Ga0207658_10050400 Ga0207658_100504003 130
179 3300025986 Ga0207658_10231307 Ga0207658_102313072 130
180 3300026023 Ga0207677_10000929 Ga0207677_100009295 130
181 3300026035 Ga0207703_10000030 Ga0207703_10000030147 130
182 3300026035 Ga0207703_10046470 Ga0207703_100464702 130
183 3300026035 Ga0207703_10316601 Ga0207703_103166013 130
184 3300026067 Ga0207678_10149046 Ga0207678_101490462 130
185 3300026067 Ga0207678_10981891 Ga0207678_109818912 130
186 3300026075 Ga0207708_10049477 Ga0207708_100494776 130
187 3300026078 Ga0207702_10000419 Ga0207702_1000041918 130
188 3300026078 Ga0207702_10003974 Ga0207702_100039746 130
189 3300026088 Ga0207641_10018672 Ga0207641_100186725 130
190 3300026088 Ga0207641_10322071 Ga0207641_103220713 130
191 3300026095 Ga0207676_10000042 Ga0207676_1000004280 130
192 3300026118 Ga0207675_100230213 Ga0207675_1002302133 130
193 3300026121 Ga0207683_10012181 Ga0207683_100121815 130
194 3300026142 Ga0207698_10000015 Ga0207698_10000015195 130
195 3300028379 Ga0268266_10279837 Ga0268266_102798372 130
196 3300028379 Ga0268266_10595233 Ga0268266_105952332 130
197 3300028380 Ga0268265_10003823 Ga0268265_100038237 130
198 3300028381 Ga0268264_10161901 Ga0268264_101619014 130
199 3300028563 Ga0265319_1000010 Ga0265319_1000010148 130
200 3300028666 Ga0265336_10021567 Ga0265336_100215672 130
201 3300028800 Ga0265338_10000051 Ga0265338_1000005141 130
202 3300029957 Ga0265324_10082465 Ga0265324_100824652 130
203 3300031238 Ga0265332_10321690 Ga0265332_103216902 130
204 3300031241 Ga0265325_10055330 Ga0265325_100553304 130
205 3300031250 Ga0265331_10045209 Ga0265331_100452092 130
206 3300032126 Ga0307415_100008478 Ga0307415_1000084787 130
207 3300041451 Ga0451791_1330042 Ga0451791_1330042_99_491 130
208 3300041463 Ga0451804_0496889 Ga0451804_0496889_129_521 130
209 3300041486 Ga0451807_2483056 Ga0451807_2483056_775_1167 130
210 3300041491 Ga0451833_0961990 Ga0451833_0961990_1141_1533 130
211 3300041505 Ga0451849_1196561 Ga0451849_1196561_24_416 130
212 3300041512 Ga0451853_1492241 Ga0451853_1492241_1184_1576 130
213 3300041512 Ga0451853_2139338 Ga0451853_2139338_1504_1896 130
214 3300044694 Ga0466963_0000012 Ga0466963_0000012_30584_30976 130
215 3300044842 Ga0466957_0053812 Ga0466957_0053812_412_807 130
216 3300044842 Ga0466957_0296275 Ga0466957_0296275_365_757 130
217 3300045976 Ga0466967_0000012 Ga0466967_0000012_67250_67645 130
218 3300046459 Ga0495629_0000899 Ga0495629_0000899_15414_15809 130
219 3300046459 Ga0495629_0006397 Ga0495629_0006397_4165_4557 130
220 3300046459 Ga0495629_0020943 Ga0495629_0020943_1933_2325 130
221 3300046461 Ga0495641_0045048 Ga0495641_0045048_1279_1674 130
222 3300046461 Ga0495641_0259644 Ga0495641_0259644_106_498 130
223 3300046499 Ga0495594_0000012 Ga0495594_0000012_33045_33440 130
224 3300046511 Ga0495608_0000013 Ga0495608_0000013_190446_190850 130
225 3300046512 Ga0495610_0081787 Ga0495610_0081787_697_1092 130
226 3300046516 Ga0495628_0006106 Ga0495628_0006106_670_1062 130
227 3300046516 Ga0495628_0207884 Ga0495628_0207884_979_1374 130
228 3300046517 Ga0495630_0001450 Ga0495630_0001450_8842_9237 130
229 3300046517 Ga0495630_0039333 Ga0495630_0039333_2213_2605 130
230 3300046517 Ga0495630_0042315 Ga0495630_0042315_11_403 130
231 3300046533 Ga0495640_0003807 Ga0495640_0003807_8988_9380 130
232 3300046536 Ga0495587_0010082 Ga0495587_0010082_561_953 130
233 3300046537 Ga0495598_0003920 Ga0495598_0003920_836_1228 130
234 3300046557 Ga0495622_0000076 Ga0495622_0000076_19714_20109 130
235 3300046660 Ga0495625_0000395 Ga0495625_0000395_50738_51130 130
236 3300046674 Ga0495588_0000247 Ga0495588_0000247_563_958 130
237 3300046675 Ga0495657_0000003 Ga0495657_0000003_241645_242049 130
238 3300046681 Ga0495647_0000307 Ga0495647_0000307_4615_5010 130
239 3300046683 Ga0495658_0001961 Ga0495658_0001961_2305_2766 130
240 3300046689 Ga0495613_0000132 Ga0495613_0000132_58558_58950 130
241 3300046690 Ga0495624_0000196 Ga0495624_0000196_3167_3562 130
242 3300046809 Ga0495600_0010574 Ga0495600_0010574_2299_2700 130
243 3300046810 Ga0495660_0060048 Ga0495660_0060048_1414_1809 130
244 3300047317 Ga0495604_0000448 Ga0495604_0000448_13825_14232 130
245 3300047317 Ga0495604_0005506 Ga0495604_0005506_4182_4583 130
246 3300047319 Ga0495674_0000039 Ga0495674_0000039_793_1185 130
247 3300047320 Ga0495672_0385291 Ga0495672_0385291_237_632 130
248 3300047321 Ga0495676_0005595 Ga0495676_0005595_7523_7915 130
249 3300047321 Ga0495676_0045466 Ga0495676_0045466_2130_2522 130
250 3300047322 Ga0495680_0007059 Ga0495680_0007059_3283_3675 130
251 3300047444 Ga0495675_0000094 Ga0495675_0000094_37632_38036 130
252 3300047472 Ga0495686_0170239 Ga0495686_0170239_406_798 130
253 3300048088 Ga0495602_0001025 Ga0495602_0001025_1918_2319 130
254 3300048088 Ga0495602_0006709 Ga0495602_0006709_11001_11393 130
255 3300048088 Ga0495602_0116722 Ga0495602_0116722_1457_1852 130
256 3300048903 Ga0496100_0000019 Ga0496100_0000019_9884_10276 130
257 3300048904 Ga0496101_0000005 Ga0496101_0000005_9884_10276 130
258 3300048905 Ga0496102_0000129 Ga0496102_0000129_20783_21175 130
259 3300048905 Ga0496102_0339523 Ga0496102_0339523_374_769 130
260 3300048906 Ga0496103_0000087 Ga0496103_0000087_20781_21173 130
261 3300048906 Ga0496103_0047770 Ga0496103_0047770_755_1150 130
262 3300048906 Ga0496103_0228785 Ga0496103_0228785_64_456 130
263 3300048907 Ga0496104_0000010 Ga0496104_0000010_378590_378982 130
264 3300048907 Ga0496104_0013569 Ga0496104_0013569_470_874 130
265 3300048907 Ga0496104_0527504 Ga0496104_0527504_651_1043 130
266 3300048908 Ga0496105_0000005 Ga0496105_0000005_378590_378982 130
267 3300048909 Ga0496106_0000156 Ga0496106_0000156_10175_10567 130
268 3300048910 Ga0496107_0000004 Ga0496107_0000004_10101_10493 130
269 3300048910 Ga0496107_0104614 Ga0496107_0104614_204_599 130
270 3300048911 Ga0496108_0000005 Ga0496108_0000005_522014_522409 130
271 3300048911 Ga0496108_0001236 Ga0496108_0001236_6901_7296 130
272 3300048911 Ga0496108_0003961 Ga0496108_0003961_6287_6682 130
273 3300048912 Ga0496109_0000002 Ga0496109_0000002_12683_13078 130
274 3300048912 Ga0496109_0000011 Ga0496109_0000011_60546_60941 130
275 3300048912 Ga0496109_0000589 Ga0496109_0000589_13948_14343 130
276 3300048912 Ga0496109_0242634 Ga0496109_0242634_1067_1459 130
277 3300048913 Ga0496110_0000185 Ga0496110_0000185_30195_30590 130
278 3300048913 Ga0496110_0096030 Ga0496110_0096030_691_1086 130
279 3300048913 Ga0496110_0257616 Ga0496110_0257616_400_801 130
280 3300048913 Ga0496110_0872644 Ga0496110_0872644_57_452 130
281 3300048914 Ga0496111_0002441 Ga0496111_0002441_8952_9347 130
282 3300048914 Ga0496111_0208039 Ga0496111_0208039_756_1151 130
283 3300048914 Ga0496111_0599866 Ga0496111_0599866_360_761 130
284 3300048915 Ga0496112_0001010 Ga0496112_0001010_1346_1741 130
285 3300048916 Ga0496113_0000017 Ga0496113_0000017_32259_32654 130
286 3300048916 Ga0496113_0053415 Ga0496113_0053415_1235_1627 130
287 3300048917 Ga0496114_0000003 Ga0496114_0000003_409407_409799 130
288 3300048917 Ga0496114_0042214 Ga0496114_0042214_1750_2142 130
289 3300048918 Ga0496115_0000022 Ga0496115_0000022_104844_105236 130
290 3300048918 Ga0496115_0000027 Ga0496115_0000027_135694_136086 130
291 3300048919 Ga0496116_0000120 Ga0496116_0000120_92050_92445 130
292 3300048919 Ga0496116_0389278 Ga0496116_0389278_28_423 130
293 3300048920 Ga0496117_0001845 Ga0496117_0001845_8478_8873 130
294 3300048920 Ga0496117_0088520 Ga0496117_0088520_917_1312 130
295 3300048920 Ga0496117_0181272 Ga0496117_0181272_426_821 130
296 3300048921 Ga0496118_0002153 Ga0496118_0002153_20546_20941 130
297 3300048921 Ga0496118_0038805 Ga0496118_0038805_169_564 130
298 3300048921 Ga0496118_0039670 Ga0496118_0039670_2823_3218 130
299 3300048922 Ga0496119_0005570 Ga0496119_0005570_10917_11312 130
300 3300048922 Ga0496119_0041355 Ga0496119_0041355_115_507 130
301 3300048922 Ga0496119_0069048 Ga0496119_0069048_321_716 130
302 3300048923 Ga0496120_0014583 Ga0496120_0014583_3953_4348 130
303 3300048923 Ga0496120_0056516 Ga0496120_0056516_1716_2108 130
304 3300048924 Ga0496121_0027386 Ga0496121_0027386_4480_4875 130
305 3300048927 Ga0496124_0831925 Ga0496124_0831925_163_558 130
306 3300048928 Ga0496125_0028914 Ga0496125_0028914_1725_2120 130
307 3300048929 Ga0496126_0568824 Ga0496126_0568824_383_778 130
308 3300049578 Ga0501042_0045383 Ga0501042_0045383_1537_1929 130
309 3300049578 Ga0501042_0227803 Ga0501042_0227803_591_983 130
310 3300049579 Ga0501043_0451172 Ga0501043_0451172_525_920 130
311 3300049584 Ga0501068_0139058 Ga0501068_0139058_471_866 130
312 3300049584 Ga0501068_0143928 Ga0501068_0143928_550_945 130
313 3300049586 Ga0501070_0090004 Ga0501070_0090004_1409_1804 130
314 3300049742 Ga0501080_0211800 Ga0501080_0211800_1241_1636 130
315 3300049743 Ga0501081_1143003 Ga0501081_1143003_23_430 130
316 3300049744 Ga0501083_0127711 Ga0501083_0127711_28_423 130
317 3300049744 Ga0501083_0174994 Ga0501083_0174994_314_709 130
318 3300050509 nmdc:mga0qj67_118045_c1 nmdc:mga0qj67_118045_c1_46_438 130
319 3300050513 nmdc:mga0rr50_760495_c1 nmdc:mga0rr50_760495_c1_42_434 130
320 3300053077 Ga0495601_0000029 Ga0495601_0000029_39814_40206 130
321 3300053078 Ga0495612_0010530 Ga0495612_0010530_669_1064 130
322 3300053083 Ga0495655_0000010 Ga0495655_0000010_59456_59848 130
323 3300053083 Ga0495655_0001176 Ga0495655_0001176_3517_3909 130
324 3300053084 Ga0495595_0000007 Ga0495595_0000007_190469_190873 130
325 3300053084 Ga0495595_0046927 Ga0495595_0046927_608_1009 130
326 3300053085 Ga0495619_0000001 Ga0495619_0000001_326736_327131 130
327 3300053085 Ga0495619_0000067 Ga0495619_0000067_17098_17493 130
328 3300053085 Ga0495619_0000851 Ga0495619_0000851_1622_2026 130
329 3300053085 Ga0495619_0020030 Ga0495619_0020030_1264_1656 130
330 3300053094 Ga0500566_0008386 Ga0500566_0008386_1244_1636 130
331 3300053094 Ga0500566_0202816 Ga0500566_0202816_284_679 130
332 3300053096 Ga0500641_0004436 Ga0500641_0004436_2465_2857 130
333 3300053119 Ga0500595_160090 Ga0500595_160090_98_493 130
334 3300053129 Ga0500628_000024 Ga0500628_000024_49557_49949 130
335 3300053134 Ga0500658_0130106 Ga0500658_0130106_314_709 130
336 3300053139 Ga0500568_0022468 Ga0500568_0022468_506_901 130

Structural Annotation

Top 5 Hits

ID Description Score Start End
7e5t-assembly5.cif.gz_E crystal structure of fsa2 0.6744 6 129
7dmo-assembly1.cif.gz_B-2 crystal structures of two pericyclases catalyzing [4+2] cycloadditions 0.6683 9 130
7e5t-assembly4.cif.gz_D crystal structure of fsa2 0.6623 6 129
7e5v-assembly3.cif.gz_C crystal structure of phm7 in complex with inhibitor 0.6563 9 127
7e5t-assembly2.cif.gz_B crystal structure of fsa2 0.6561 6 129
ID Description Score Start End Superfamily
af_Q65X45_193_272_3.10.450.10 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8105 91 126 3.10.450.10
af_Q9V3E0_280_403_2.40.370.10 Mainly Beta;Beta Barrel;AttH-like fold;AttH-like domain 0.7493 6 128 2.40.370.10
af_O45136_1_426_2.40.160.10 Mainly Beta;Beta Barrel;Porin;Porin 0.744 7 130 2.40.160.10
af_Q9V3E0_280_403_2.40.370.10 Mainly Beta;Beta Barrel;AttH-like fold;AttH-like domain 0.7383 6 128 2.40.370.10
2qkpC00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.7344 94 124 3.30.450.20
ID Description Score Start End GO Terms
AF-A0A537YM20-F1-model_v4 Uncharacterized protein 0.9383 1 127
AF-A0A2W6BXU1-F1-model_v4 Uncharacterized protein 0.9128 9 130
AF-A0A537YM20-F1-model_v4 Uncharacterized protein 0.9106 1 127
AF-A0A7V9H838-F1-model_v4 DUF2804 family protein 0.909 7 130
AF-A0A7V9HQV8-F1-model_v4 Uncharacterized protein 0.9089 1 128

Feature Viewer

pLDDT pTM Quality
90.45 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map