F412704

General Info

Members Datasets Scaffolds Average Seq Length
336 126 336 171

Family's Representative Sequence

Representative Sequence 3300025926|Ga0207659_10188056|Ga0207659_101880562
Length 203
Sequence LRGTAGRFAWANGPDKRAGDVEMIATGTAAVKAVAKPPTDDKRWRIVEAAMRRQGYDVHAVIESLHAVQQAFGFIDDKSMRYVAESLQVPVSKVYGVATFYHYFTLKPQGKHACIVCLGTACYIKGSGDMLRQVEAKYNIKEGQTTEDGELSLLAARCIGACGLAPAAVLDGDVLGKGTASELIEKIETKLAIGSGVSGGVAK

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
3 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
4 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
5 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
6 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
7 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
8 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
9 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
10 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
11 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
12 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
13 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
14 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
15 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
16 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
17 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
18 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
19 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
20 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
21 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
32 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
33 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
34 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
35 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
36 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
37 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
38 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
39 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
40 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
41 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
42 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
43 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
44 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
45 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
46 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
47 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
48 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
49 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
50 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
51 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
52 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
53 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
54 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
55 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
56 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
57 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
58 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
59 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
60 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
61 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
68 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
69 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
70 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
71 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
72 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
73 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
74 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
75 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
76 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
77 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
78 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
79 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
81 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
82 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
83 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
84 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
85 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
86 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
87 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
88 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
89 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
90 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
91 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
92 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
93 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
94 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
95 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
96 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
97 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
98 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
99 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
100 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
101 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
102 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
103 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
104 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
105 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
106 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
107 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
108 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
109 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
110 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
111 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
112 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
113 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
114 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
115 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
116 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
117 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
118 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
119 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
122 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
123 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
124 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
125 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
126 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.35
Metatranscriptomes 5.65
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.3
Rhizosphere 99.4
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10000692 3300003320 Bacteria 7537
2 Ga0070689_100217747 3300005340 Unclassified 1565
3 Ga0070675_100038052 3300005354 Bacteria 3920
4 Ga0070711_100467977 3300005439 Unclassified 1034
5 Ga0068855_100283167 3300005563 Bacteria 1840
6 Ga0068863_100247563 3300005841 Bacteria 1721
7 Ga0070717_10146793 3300006028 Bacteria 2038
8 Ga0070712_101138911 3300006175 Bacteria 678
9 Ga0075428_100029890 3300006844 Bacteria 6026
10 Ga0075430_100004015 3300006846 Bacteria 12411
11 Ga0075434_100383401 3300006871 Bacteria 1426
12 Ga0105240_10005659 3300009093 Bacteria 18545
13 Ga0105240_10261541 3300009093 Bacteria 1996
14 Ga0105240_10492143 3300009093 Unclassified 1365
15 Ga0105248_10384729 3300009177 Bacteria 1580
16 Ga0105248_11332537 3300009177 Unclassified 812
17 Ga0105249_10451651 3300009553 Unclassified 1324
18 Ga0163162_11184485 3300013306 Unclassified 867
19 Ga0163162_12726540 3300013306 Unclassified 569
20 Ga0157372_11030885 3300013307 Unclassified 953
21 Ga0163163_10119668 3300014325 Bacteria 2666
22 Ga0157376_10141370 3300014969 Bacteria 2160
23 Ga0157376_10907330 3300014969 Bacteria 899
24 Ga0163161_10498276 3300017792 Unclassified 991
25 Ga0213872_10002439 3300021361 Bacteria 10937
26 Ga0213872_10257560 3300021361 Bacteria 733
27 Ga0207695_10469101 3300025913 Bacteria 1141
28 Ga0207695_10855674 3300025913 Bacteria 789
29 Ga0207663_10694479 3300025916 Bacteria 805
30 Ga0207694_10383189 3300025924 Bacteria 1167
31 Ga0207659_10188056 3300025926 Bacteria 1641
32 Ga0207670_10207675 3300025936 Unclassified 1491
33 Ga0207711_11421586 3300025941 Unclassified 636
34 Ga0207702_10261648 3300026078 Bacteria 1629
35 Ga0207641_10223287 3300026088 Bacteria 1748
36 Ga0268266_10096746 3300028379 Bacteria 2596
37 Ga0268264_10549717 3300028381 Bacteria 1132
38 Ga0265337_1000980 3300028556 Bacteria 14955
39 Ga0265337_1004843 3300028556 Bacteria 5504
40 Ga0265337_1006055 3300028556 Bacteria 4717
41 Ga0265337_1006312 3300028556 Bacteria 4590
42 Ga0265326_10010027 3300028558 Bacteria 2822
43 Ga0265326_10018242 3300028558 Bacteria 2020
44 Ga0265326_10055529 3300028558 Unclassified 1120
45 Ga0265319_1000007 3300028563 Bacteria 217194
46 Ga0265319_1010701 3300028563 Bacteria 3813
47 Ga0265319_1011417 3300028563 Bacteria 3638
48 Ga0265319_1015892 3300028563 Bacteria 2899
49 Ga0265319_1023162 3300028563 Bacteria 2252
50 Ga0265319_1024215 3300028563 Bacteria 2188
51 Ga0265319_1049999 3300028563 Bacteria 1382
52 Ga0265334_10003156 3300028573 Bacteria 7522
53 Ga0265334_10014353 3300028573 Bacteria 3303
54 Ga0265318_10000034 3300028577 Bacteria 143153
55 Ga0265318_10000102 3300028577 Bacteria 79573
56 Ga0265318_10006045 3300028577 Bacteria 5612
57 Ga0265318_10053423 3300028577 Bacteria 1515
58 Ga0265323_10051872 3300028653 Bacteria 1453
59 Ga0265336_10004796 3300028666 Bacteria 5068
60 Ga0265338_10000016 3300028800 Bacteria 347424
61 Ga0265338_10000150 3300028800 Bacteria 126424
62 Ga0265338_10000198 3300028800 Bacteria 113584
63 Ga0265338_10000243 3300028800 Bacteria 100885
64 Ga0265338_10004648 3300028800 Bacteria 18444
65 Ga0265338_10006448 3300028800 Bacteria 14958
66 Ga0265338_10014568 3300028800 Bacteria 8735
67 Ga0265338_10019673 3300028800 Bacteria 7145
68 Ga0265338_10029221 3300028800 Bacteria 5470
69 Ga0265338_10031083 3300028800 Bacteria 5242
70 Ga0265338_10056401 3300028800 Bacteria 3484
71 Ga0265338_10142706 3300028800 Bacteria 1873
72 Ga0265338_10406646 3300028800 Unclassified 969
73 Ga0265324_10004263 3300029957 Bacteria 6531
74 Ga0265324_10007175 3300029957 Bacteria 4549
75 Ga0265324_10009180 3300029957 Bacteria 3875
76 Ga0265324_10070666 3300029957 Unclassified 1189
77 Ga0265332_10011122 3300031238 Bacteria 4000
78 Ga0265332_10055368 3300031238 Bacteria 1700
79 Ga0265332_10203311 3300031238 Bacteria 823
80 Ga0265328_10062595 3300031239 Bacteria 1366
81 Ga0265320_10000367 3300031240 Bacteria 36497
82 Ga0265320_10001362 3300031240 Bacteria 17820
83 Ga0265320_10001983 3300031240 Bacteria 14441
84 Ga0265320_10005693 3300031240 Bacteria 7951
85 Ga0265320_10015743 3300031240 Bacteria 4263
86 Ga0265320_10053116 3300031240 Bacteria 1959
87 Ga0265320_10088373 3300031240 Bacteria 1438
88 Ga0265320_10126792 3300031240 Bacteria 1161
89 Ga0265320_10128963 3300031240 Bacteria 1149
90 Ga0265325_10005882 3300031241 Bacteria 7517
91 Ga0265325_10017957 3300031241 Bacteria 3928
92 Ga0265325_10020855 3300031241 Bacteria 3607
93 Ga0265325_10144613 3300031241 Bacteria 1128
94 Ga0265329_10034555 3300031242 Bacteria 1633
95 Ga0265340_10001343 3300031247 Bacteria 14104
96 Ga0265340_10031209 3300031247 Bacteria 2666
97 Ga0265340_10120008 3300031247 Unclassified 1210
98 Ga0265339_10005735 3300031249 Bacteria 8246
99 Ga0265339_10009212 3300031249 Bacteria 6225
100 Ga0265339_10062363 3300031249 Bacteria 2004
101 Ga0265339_10128563 3300031249 Bacteria 1297
102 Ga0265339_10207227 3300031249 Unclassified 964
103 Ga0265339_10455675 3300031249 Bacteria 593
104 Ga0265331_10045511 3300031250 Bacteria 2119
105 Ga0265331_10094557 3300031250 Bacteria 1379
106 Ga0265327_10000092 3300031251 Bacteria 195619
107 Ga0265327_10000966 3300031251 Bacteria 41122
108 Ga0265327_10001868 3300031251 Bacteria 24383
109 Ga0265316_10041939 3300031344 Bacteria 3659
110 Ga0265316_10104468 3300031344 Bacteria 2150
111 Ga0265316_10117383 3300031344 Bacteria 2011
112 Ga0265316_10163542 3300031344 Bacteria 1663
113 Ga0265316_10263619 3300031344 Bacteria 1263
114 Ga0265316_10279268 3300031344 Bacteria 1220
115 Ga0265316_10284232 3300031344 Bacteria 1208
116 Ga0265316_10351219 3300031344 Bacteria 1068
117 Ga0265316_10430303 3300031344 Unclassified 948
118 Ga0265316_10606108 3300031344 Bacteria 776
119 Ga0265313_10004583 3300031595 Bacteria 10516
120 Ga0265313_10008236 3300031595 Bacteria 6959
121 Ga0265313_10015634 3300031595 Bacteria 4406
122 Ga0265313_10019845 3300031595 Bacteria 3727
123 Ga0316575_10006847 3300031665 Bacteria 4120
124 Ga0316575_10036673 3300031665 Bacteria 1929
125 Ga0316575_10109516 3300031665 Bacteria 1126
126 Ga0316579_10000467 3300031691 Bacteria 13066
127 Ga0316579_10002202 3300031691 Bacteria 7340
128 Ga0316579_10009209 3300031691 Bacteria 4146
129 Ga0316579_10038426 3300031691 Bacteria 2213
130 Ga0316579_10099145 3300031691 Bacteria 1394
131 Ga0265314_10001931 3300031711 Bacteria 22152
132 Ga0265314_10002132 3300031711 Bacteria 20745
133 Ga0265314_10077002 3300031711 Bacteria 2214
134 Ga0265314_10088561 3300031711 Bacteria 2021
135 Ga0265314_10153542 3300031711 Bacteria 1409
136 Ga0265342_10013266 3300031712 Bacteria 5539
137 Ga0265342_10097287 3300031712 Bacteria 1681
138 Ga0265342_10161209 3300031712 Bacteria 1239
139 Ga0316576_10000271 3300031727 Bacteria 22695
140 Ga0316576_10003571 3300031727 Bacteria 9159
141 Ga0316576_10021484 3300031727 Bacteria 4465
142 Ga0316576_10025227 3300031727 Bacteria 4160
143 Ga0316576_10038989 3300031727 Bacteria 3409
144 Ga0316576_10046361 3300031727 Bacteria 3145
145 Ga0316576_10050622 3300031727 Bacteria 3021
146 Ga0316576_10066263 3300031727 Bacteria 2655
147 Ga0316576_10104621 3300031727 Bacteria 2118
148 Ga0316576_10177195 3300031727 Bacteria 1608
149 Ga0316576_10237369 3300031727 Bacteria 1370
150 Ga0316576_10345315 3300031727 Bacteria 1108
151 Ga0316578_10000044 3300031728 Bacteria 25781
152 Ga0316578_10003377 3300031728 Bacteria 7285
153 Ga0316578_10016683 3300031728 Bacteria 3981
154 Ga0316578_10022055 3300031728 Bacteria 3544
155 Ga0316578_10038380 3300031728 Bacteria 2761
156 Ga0316578_10046512 3300031728 Bacteria 2529
157 Ga0316578_10071441 3300031728 Bacteria 2055
158 Ga0316578_10146866 3300031728 Bacteria 1420
159 Ga0316577_10000086 3300031733 Bacteria 24604
160 Ga0316577_10000839 3300031733 Bacteria 13408
161 Ga0316577_10011359 3300031733 Bacteria 4823
162 Ga0316577_10018915 3300031733 Bacteria 3812
163 Ga0316577_10212698 3300031733 Bacteria 1093
164 Ga0316577_10263357 3300031733 Bacteria 975
165 Ga0316577_10381623 3300031733 Bacteria 800
166 Ga0316577_10476061 3300031733 Bacteria 710
167 Ga0316583_10028220 3300032133 Bacteria 2002
168 Ga0316583_10037842 3300032133 Bacteria 1711
169 Ga0316583_10244423 3300032133 Bacteria 622
170 Ga0316585_10000011 3300032137 Bacteria 28942
171 Ga0316585_10035764 3300032137 Bacteria 1573
172 Ga0316585_10037185 3300032137 Bacteria 1545
173 Ga0316585_10039954 3300032137 Bacteria 1493
174 Ga0316585_10063183 3300032137 Bacteria 1197
175 Ga0316585_10074157 3300032137 Bacteria 1106
176 Ga0316580_10000021 3300032139 Bacteria 24429
177 Ga0316580_10021832 3300032139 Bacteria 1975
178 Ga0316580_10022774 3300032139 Bacteria 1933
179 Ga0316580_10040441 3300032139 Bacteria 1441
180 Ga0316580_10059480 3300032139 Bacteria 1173
181 Ga0316580_10084355 3300032139 Bacteria 971
182 Ga0316593_10012255 3300032168 Bacteria 2513
183 Ga0316593_10027383 3300032168 Bacteria 1828
184 Ga0316593_10077348 3300032168 Bacteria 1157
185 Ga0316593_10206234 3300032168 Bacteria 728
186 Ga0316592_1000605 3300033524 Bacteria 5196
187 Ga0316592_1005280 3300033524 Bacteria 2446
188 Ga0316592_1023756 3300033524 Bacteria 1317
189 Ga0316586_1003875 3300033527 Bacteria 2000
190 Ga0316588_1001056 3300033528 Bacteria 4345
191 Ga0316588_1005408 3300033528 Bacteria 2485
192 Ga0316588_1011050 3300033528 Bacteria 1917
193 Ga0316587_1012511 3300033529 Bacteria 1380
194 Ga0316587_1012893 3300033529 Bacteria 1364
195 Ga0316587_1084080 3300033529 Bacteria 603
196 Ga0316596_1010105 3300033541 Bacteria 2278
197 Ga0316596_1015753 3300033541 Bacteria 1887
198 Ga0316596_1018172 3300033541 Bacteria 1775
199 Ga0316596_1023235 3300033541 Bacteria 1587
200 Ga0316596_1113858 3300033541 Bacteria 735
201 Ga0373926_0019723 3300035083 Bacteria 2326
202 Ga0373926_0037904 3300035083 Bacteria 1716
203 Ga0373934_0189028 3300035086 Unclassified 847
204 Ga0373944_0137591 3300035089 Unclassified 853
205 Ga0373956_0160889 3300035119 Unclassified 1058
206 Ga0373943_0020992 3300035170 Bacteria 3016
207 Ga0373955_0145679 3300035172 Bacteria 1391
208 Ga0316574_0000004 3300035398 Bacteria 49638
209 Ga0316574_0060545 3300035398 Bacteria 2377
210 Ga0316574_0092690 3300035398 Bacteria 1928
211 Ga0316574_0106140 3300035398 Bacteria 1799
212 Ga0316574_0145306 3300035398 Bacteria 1528
213 Ga0316574_0196124 3300035398 Bacteria 1298
214 Ga0316574_0439286 3300035398 Bacteria 818
215 Ga0316574_0715326 3300035398 Bacteria 613
216 Ga0373927_0007273 3300035695 Bacteria 7509
217 Ga0373927_0478632 3300035695 Bacteria 823
218 Ga0373947_0301549 3300035725 Bacteria 1068
219 Ga0373947_0745923 3300035725 Unclassified 668
220 Ga0373947_0805948 3300035725 Unclassified 641
221 Ga0373937_0226120 3300036401 Bacteria 1761
222 Ga0373937_0790421 3300036401 Unclassified 897
223 Ga0316582_0000357 3300036647 Bacteria 16240
224 Ga0316582_0011703 3300036647 Bacteria 4862
225 Ga0316582_0142888 3300036647 Bacteria 1614
226 Ga0316582_0151543 3300036647 Bacteria 1567
227 Ga0316582_0255277 3300036647 Bacteria 1202
228 Ga0316582_0289043 3300036647 Bacteria 1125
229 Ga0316582_0319921 3300036647 Bacteria 1066
230 Ga0316584_0001240 3300036712 Bacteria 15084
231 Ga0316584_0003867 3300036712 Bacteria 9822
232 Ga0316584_0016375 3300036712 Bacteria 5314
233 Ga0316584_0021235 3300036712 Bacteria 4716
234 Ga0316584_0030504 3300036712 Bacteria 3982
235 Ga0316584_0038098 3300036712 Bacteria 3576
236 Ga0316584_0038110 3300036712 Bacteria 3575
237 Ga0316584_0055264 3300036712 Bacteria 2972
238 Ga0316584_0073627 3300036712 Bacteria 2560
239 Ga0316584_0147070 3300036712 Bacteria 1755
240 Ga0316584_0274500 3300036712 Bacteria 1226
241 Ga0316584_0338904 3300036712 Bacteria 1081
242 Ga0316584_0555923 3300036712 Bacteria 800
243 Ga0316584_0692099 3300036712 Bacteria 699
244 Ga0373925_0009994 3300037068 Bacteria 6890
245 Ga0373925_0341547 3300037068 Bacteria 1215
246 Ga0316581_0027319 3300037588 Bacteria 1706
247 Ga0316581_0137165 3300037588 Bacteria 754
248 Ga0436360_0394766 3300039438 Unclassified 1309
249 Ga0436360_1130985 3300039438 Bacteria 2366
250 Ga0436361_0407823 3300039447 Bacteria 1564
251 Ga0436361_0742006 3300039447 Bacteria 1100
252 Ga0436361_0866738 3300039447 Bacteria 1567
253 Ga0436361_0906768 3300039447 Unclassified 966
254 Ga0436361_1172994 3300039447 Bacteria 16033
255 Ga0436361_1220732 3300039447 Bacteria 6855
256 Ga0436362_0505069 3300039453 Bacteria 4811
257 Ga0451807_1779121 3300041486 Bacteria 694
258 Ga0451577_0025440 3300042876 Bacteria 5370
259 Ga0451577_0025803 3300042876 Bacteria 5328
260 Ga0451577_0211654 3300042876 Bacteria 1751
261 Ga0451577_0399007 3300042876 Bacteria 1248
262 Ga0451577_0538535 3300042876 Bacteria 1060
263 Ga0451577_0607074 3300042876 Bacteria 993
264 Ga0453683_0000527 3300044673 Bacteria 43044
265 Ga0453683_0067439 3300044673 Bacteria 2236
266 Ga0453683_0102274 3300044673 Bacteria 1799
267 Ga0453683_0192575 3300044673 Bacteria 1294
268 Ga0453684_0000068 3300044712 Bacteria 461699
269 Ga0453684_0002669 3300044712 Bacteria 42512
270 Ga0453684_0012641 3300044712 Bacteria 13880
271 Ga0453684_0024853 3300044712 Bacteria 8726
272 Ga0453684_0043724 3300044712 Bacteria 6014
273 Ga0453684_0064111 3300044712 Bacteria 4695
274 Ga0453684_0180912 3300044712 Bacteria 2475
275 Ga0453684_0285416 3300044712 Bacteria 1881
276 Ga0453684_0429613 3300044712 Bacteria 1474
277 Ga0453684_0449394 3300044712 Bacteria 1435
278 Ga0453684_0684760 3300044712 Bacteria 1116
279 Ga0451576_0025192 3300045051 Bacteria 6412
280 Ga0451576_0108470 3300045051 Bacteria 2889
281 Ga0451576_0262593 3300045051 Bacteria 1805
282 Ga0451576_0326397 3300045051 Unclassified 1606
283 Ga0451576_0809976 3300045051 Bacteria 983
284 Ga0451576_1780091 3300045051 Bacteria 637
285 Ga0451576_1963740 3300045051 Unclassified 603
286 Ga0495629_0204373 3300046459 Bacteria 1365
287 Ga0495651_0160356 3300046462 Bacteria 1612
288 Ga0495653_0702177 3300046463 Unclassified 614
289 Ga0495580_0401819 3300046472 Bacteria 924
290 Ga0495662_0020026 3300046476 Bacteria 3238
291 Ga0495664_0018477 3300046477 Bacteria 3996
292 Ga0495608_0180107 3300046511 Bacteria 1337
293 Ga0495618_0006965 3300046514 Bacteria 6848
294 Ga0495630_0000049 3300046517 Bacteria 97884
295 Ga0495630_0118700 3300046517 Bacteria 2006
296 Ga0495630_0174837 3300046517 Bacteria 1637
297 Ga0495630_0188957 3300046517 Bacteria 1571
298 Ga0495630_1227846 3300046517 Unclassified 566
299 Ga0495666_0002667 3300046526 Bacteria 8899
300 Ga0495666_0116149 3300046526 Bacteria 1255
301 Ga0495665_0125005 3300046531 Bacteria 1347
302 Ga0495665_0182188 3300046531 Unclassified 1091
303 Ga0495640_0178124 3300046533 Bacteria 1356
304 Ga0495586_0000185 3300046535 Bacteria 41119
305 Ga0495586_0004030 3300046535 Bacteria 7873
306 Ga0495587_0057428 3300046536 Bacteria 2288
307 Ga0495645_0823824 3300046543 Unclassified 555
308 Ga0495622_0222238 3300046557 Unclassified 836
309 Ga0495667_0158352 3300046559 Bacteria 1457
310 Ga0495634_0001149 3300046642 Bacteria 24443
311 Ga0495634_0053923 3300046642 Bacteria 2692
312 Ga0495634_0100815 3300046642 Bacteria 1865
313 Ga0495635_0041617 3300046663 Bacteria 3174
314 Ga0495599_0068929 3300046678 Bacteria 2208
315 Ga0495647_0107559 3300046681 Bacteria 1161
316 Ga0495658_0401495 3300046683 Unclassified 874
317 Ga0495658_0708484 3300046683 Unclassified 645
318 Ga0495613_0007466 3300046689 Bacteria 8144
319 Ga0495613_0152757 3300046689 Bacteria 1646
320 Ga0495613_0216959 3300046689 Unclassified 1344
321 Ga0495600_0411486 3300046809 Unclassified 840
322 Ga0495581_0060647 3300047315 Unclassified 2186
323 Ga0495674_0002484 3300047319 Bacteria 17985
324 Ga0495674_0077107 3300047319 Bacteria 2866
325 Ga0495676_0104476 3300047321 Unclassified 2090
326 Ga0495680_0383910 3300047322 Unclassified 972
327 Ga0495675_0059191 3300047444 Bacteria 2429
328 Ga0495684_0142288 3300047471 Bacteria 1798
329 Ga0501036_0526449 3300049572 Bacteria 983
330 Ga0501043_0113086 3300049579 Bacteria 2132
331 Ga0501047_0293628 3300049581 Bacteria 1469
332 nmdc:mga09592_1205392_c1 3300050508 Bacteria 625
333 nmdc:mga0qj67_8987_c1 3300050509 Bacteria 7411
334 nmdc:mga06r32_7072_c1 3300050510 Bacteria 10098
335 nmdc:mga08x19_333621_c1 3300050514 Bacteria 1057
336 Ga0495619_0502478 3300053085 Bacteria 834

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009177 Ga0105248_10384729 Ga0105248_103847292 143
2 3300009553 Ga0105249_10451651 Ga0105249_104516512 143
3 3300031238 Ga0265332_10203311 Ga0265332_102033111 158
4 3300028556 Ga0265337_1000980 Ga0265337_10009802 159
5 3300028556 Ga0265337_1004843 Ga0265337_10048433 159
6 3300028558 Ga0265326_10010027 Ga0265326_100100272 159
7 3300028563 Ga0265319_1011417 Ga0265319_10114173 159
8 3300028563 Ga0265319_1015892 Ga0265319_10158921 159
9 3300028563 Ga0265319_1023162 Ga0265319_10231622 159
10 3300028573 Ga0265334_10014353 Ga0265334_100143532 159
11 3300028577 Ga0265318_10000102 Ga0265318_1000010242 159
12 3300028577 Ga0265318_10006045 Ga0265318_100060451 159
13 3300028577 Ga0265318_10053423 Ga0265318_100534231 159
14 3300028800 Ga0265338_10000150 Ga0265338_1000015072 159
15 3300028800 Ga0265338_10006448 Ga0265338_100064485 159
16 3300028800 Ga0265338_10142706 Ga0265338_101427062 159
17 3300029957 Ga0265324_10007175 Ga0265324_100071755 159
18 3300029957 Ga0265324_10070666 Ga0265324_100706662 159
19 3300031238 Ga0265332_10055368 Ga0265332_100553682 159
20 3300031239 Ga0265328_10062595 Ga0265328_100625952 159
21 3300031240 Ga0265320_10000367 Ga0265320_1000036731 159
22 3300031240 Ga0265320_10126792 Ga0265320_101267922 159
23 3300031240 Ga0265320_10128963 Ga0265320_101289632 159
24 3300031241 Ga0265325_10005882 Ga0265325_100058823 159
25 3300031247 Ga0265340_10031209 Ga0265340_100312092 159
26 3300031247 Ga0265340_10120008 Ga0265340_101200082 159
27 3300031249 Ga0265339_10009212 Ga0265339_100092123 159
28 3300031249 Ga0265339_10207227 Ga0265339_102072272 159
29 3300031344 Ga0265316_10163542 Ga0265316_101635421 159
30 3300031344 Ga0265316_10284232 Ga0265316_102842321 159
31 3300031595 Ga0265313_10008236 Ga0265313_100082363 159
32 3300031595 Ga0265313_10015634 Ga0265313_100156345 159
33 3300031711 Ga0265314_10153542 Ga0265314_101535422 159
34 3300031712 Ga0265342_10013266 Ga0265342_100132665 159
35 3300031712 Ga0265342_10161209 Ga0265342_101612092 159
36 3300039447 Ga0436361_0742006 Ga0436361_0742006_45_524 159
37 3300046543 Ga0495645_0823824 Ga0495645_0823824_46_531 159
38 3300050509 nmdc:mga0qj67_8987_c1 nmdc:mga0qj67_8987_c1_19_528 159
39 3300028800 Ga0265338_10056401 Ga0265338_100564014 160
40 3300042876 Ga0451577_0025440 Ga0451577_0025440_2227_2718 162
41 3300046517 Ga0495630_0174837 Ga0495630_0174837_77_574 162
42 3300009177 Ga0105248_11332537 Ga0105248_113325371 163
43 3300025941 Ga0207711_11421586 Ga0207711_114215861 163
44 3300031665 Ga0316575_10109516 Ga0316575_101095161 163
45 3300031691 Ga0316579_10009209 Ga0316579_100092092 163
46 3300031691 Ga0316579_10038426 Ga0316579_100384262 163
47 3300031727 Ga0316576_10021484 Ga0316576_100214845 163
48 3300031727 Ga0316576_10046361 Ga0316576_100463611 163
49 3300031727 Ga0316576_10050622 Ga0316576_100506222 163
50 3300031727 Ga0316576_10066263 Ga0316576_100662632 163
51 3300031728 Ga0316578_10038380 Ga0316578_100383801 163
52 3300031733 Ga0316577_10011359 Ga0316577_100113592 163
53 3300031733 Ga0316577_10381623 Ga0316577_103816231 163
54 3300032133 Ga0316583_10037842 Ga0316583_100378422 163
55 3300032137 Ga0316585_10035764 Ga0316585_100357642 163
56 3300032137 Ga0316585_10037185 Ga0316585_100371852 163
57 3300032139 Ga0316580_10022774 Ga0316580_100227743 163
58 3300032139 Ga0316580_10040441 Ga0316580_100404412 163
59 3300032139 Ga0316580_10059480 Ga0316580_100594801 163
60 3300032139 Ga0316580_10084355 Ga0316580_100843552 163
61 3300032168 Ga0316593_10027383 Ga0316593_100273832 163
62 3300033524 Ga0316592_1005280 Ga0316592_10052803 163
63 3300033527 Ga0316586_1003875 Ga0316586_10038752 163
64 3300033528 Ga0316588_1011050 Ga0316588_10110503 163
65 3300033529 Ga0316587_1012893 Ga0316587_10128931 163
66 3300033541 Ga0316596_1023235 Ga0316596_10232352 163
67 3300035398 Ga0316574_0092690 Ga0316574_0092690_348_854 163
68 3300035398 Ga0316574_0145306 Ga0316574_0145306_881_1375 163
69 3300035398 Ga0316574_0439286 Ga0316574_0439286_171_665 163
70 3300035398 Ga0316574_0715326 Ga0316574_0715326_59_553 163
71 3300036647 Ga0316582_0011703 Ga0316582_0011703_2327_2833 163
72 3300036647 Ga0316582_0151543 Ga0316582_0151543_193_687 163
73 3300036647 Ga0316582_0289043 Ga0316582_0289043_132_626 163
74 3300036712 Ga0316584_0003867 Ga0316584_0003867_838_1332 163
75 3300036712 Ga0316584_0030504 Ga0316584_0030504_2243_2761 163
76 3300036712 Ga0316584_0038110 Ga0316584_0038110_402_908 163
77 3300036712 Ga0316584_0147070 Ga0316584_0147070_92_586 163
78 3300036712 Ga0316584_0692099 Ga0316584_0692099_153_647 163
79 3300037588 Ga0316581_0137165 Ga0316581_0137165_230_736 163
80 3300021361 Ga0213872_10002439 Ga0213872_1000243911 164
81 3300021361 Ga0213872_10257560 Ga0213872_102575601 164
82 3300031665 Ga0316575_10006847 Ga0316575_100068472 164
83 3300031691 Ga0316579_10000467 Ga0316579_100004677 164
84 3300031691 Ga0316579_10099145 Ga0316579_100991451 164
85 3300031727 Ga0316576_10000271 Ga0316576_1000027117 164
86 3300031727 Ga0316576_10003571 Ga0316576_100035715 164
87 3300031727 Ga0316576_10038989 Ga0316576_100389894 164
88 3300031727 Ga0316576_10104621 Ga0316576_101046212 164
89 3300031728 Ga0316578_10000044 Ga0316578_1000004416 164
90 3300031728 Ga0316578_10003377 Ga0316578_100033775 164
91 3300031728 Ga0316578_10046512 Ga0316578_100465122 164
92 3300031728 Ga0316578_10071441 Ga0316578_100714411 164
93 3300031733 Ga0316577_10000086 Ga0316577_1000008619 164
94 3300031733 Ga0316577_10000839 Ga0316577_1000083913 164
95 3300031733 Ga0316577_10018915 Ga0316577_100189152 164
96 3300031733 Ga0316577_10212698 Ga0316577_102126982 164
97 3300031733 Ga0316577_10263357 Ga0316577_102633571 164
98 3300032133 Ga0316583_10028220 Ga0316583_100282202 164
99 3300032133 Ga0316583_10244423 Ga0316583_102444231 164
100 3300032137 Ga0316585_10000011 Ga0316585_100000119 164
101 3300032137 Ga0316585_10039954 Ga0316585_100399542 164
102 3300032139 Ga0316580_10000021 Ga0316580_1000002118 164
103 3300032139 Ga0316580_10021832 Ga0316580_100218322 164
104 3300032168 Ga0316593_10206234 Ga0316593_102062341 164
105 3300033524 Ga0316592_1023756 Ga0316592_10237561 164
106 3300033528 Ga0316588_1005408 Ga0316588_10054082 164
107 3300033529 Ga0316587_1012511 Ga0316587_10125112 164
108 3300033529 Ga0316587_1084080 Ga0316587_10840801 164
109 3300033541 Ga0316596_1010105 Ga0316596_10101052 164
110 3300033541 Ga0316596_1015753 Ga0316596_10157531 164
111 3300033541 Ga0316596_1018172 Ga0316596_10181722 164
112 3300035398 Ga0316574_0000004 Ga0316574_0000004_6649_7143 164
113 3300035398 Ga0316574_0060545 Ga0316574_0060545_1734_2231 164
114 3300036647 Ga0316582_0000357 Ga0316582_0000357_6656_7150 164
115 3300036647 Ga0316582_0142888 Ga0316582_0142888_382_879 164
116 3300036647 Ga0316582_0319921 Ga0316582_0319921_465_959 164
117 3300036712 Ga0316584_0001240 Ga0316584_0001240_14537_15031 164
118 3300036712 Ga0316584_0016375 Ga0316584_0016375_4263_4757 164
119 3300036712 Ga0316584_0021235 Ga0316584_0021235_3299_3796 164
120 3300036712 Ga0316584_0038098 Ga0316584_0038098_2072_2608 164
121 3300036712 Ga0316584_0055264 Ga0316584_0055264_747_1241 164
122 3300039438 Ga0436360_0394766 Ga0436360_0394766_741_1241 164
123 3300039438 Ga0436360_1130985 Ga0436360_1130985_603_1103 164
124 3300039447 Ga0436361_0407823 Ga0436361_0407823_838_1338 164
125 3300039447 Ga0436361_0866738 Ga0436361_0866738_764_1264 164
126 3300039447 Ga0436361_0906768 Ga0436361_0906768_324_824 164
127 3300039447 Ga0436361_1172994 Ga0436361_1172994_9204_9704 164
128 3300039447 Ga0436361_1220732 Ga0436361_1220732_2043_2543 164
129 3300039453 Ga0436362_0505069 Ga0436362_0505069_4186_4686 164
130 3300044673 Ga0453683_0000527 Ga0453683_0000527_8199_8696 164
131 3300044673 Ga0453683_0102274 Ga0453683_0102274_852_1349 164
132 3300044673 Ga0453683_0192575 Ga0453683_0192575_290_787 164
133 3300044712 Ga0453684_0000068 Ga0453684_0000068_266817_267320 164
134 3300044712 Ga0453684_0012641 Ga0453684_0012641_5760_6263 164
135 3300044712 Ga0453684_0429613 Ga0453684_0429613_923_1420 164
136 3300044712 Ga0453684_0684760 Ga0453684_0684760_543_1040 164
137 3300046463 Ga0495653_0702177 Ga0495653_0702177_39_539 164
138 3300046557 Ga0495622_0222238 Ga0495622_0222238_78_578 164
139 3300006028 Ga0070717_10146793 Ga0070717_101467932 165
140 3300006175 Ga0070712_101138911 Ga0070712_1011389111 165
141 3300006871 Ga0075434_100383401 Ga0075434_1003834011 165
142 3300013306 Ga0163162_12726540 Ga0163162_127265401 165
143 3300013307 Ga0157372_11030885 Ga0157372_110308852 165
144 3300014325 Ga0163163_10119668 Ga0163163_101196682 165
145 3300025916 Ga0207663_10694479 Ga0207663_106944792 165
146 3300031249 Ga0265339_10455675 Ga0265339_104556751 165
147 3300031344 Ga0265316_10430303 Ga0265316_104303032 165
148 3300031665 Ga0316575_10036673 Ga0316575_100366732 165
149 3300031691 Ga0316579_10002202 Ga0316579_100022026 165
150 3300031727 Ga0316576_10025227 Ga0316576_100252273 165
151 3300031727 Ga0316576_10177195 Ga0316576_101771952 165
152 3300031728 Ga0316578_10022055 Ga0316578_100220553 165
153 3300031728 Ga0316578_10146866 Ga0316578_101468662 165
154 3300031733 Ga0316577_10476061 Ga0316577_104760612 165
155 3300032137 Ga0316585_10063183 Ga0316585_100631832 165
156 3300032168 Ga0316593_10012255 Ga0316593_100122552 165
157 3300032168 Ga0316593_10077348 Ga0316593_100773482 165
158 3300033524 Ga0316592_1000605 Ga0316592_10006051 165
159 3300033528 Ga0316588_1001056 Ga0316588_10010562 165
160 3300033541 Ga0316596_1113858 Ga0316596_11138581 165
161 3300035398 Ga0316574_0106140 Ga0316574_0106140_108_608 165
162 3300036712 Ga0316584_0073627 Ga0316584_0073627_239_739 165
163 3300036712 Ga0316584_0555923 Ga0316584_0555923_242_742 165
164 3300037588 Ga0316581_0027319 Ga0316581_0027319_357_857 165
165 3300044712 Ga0453684_0180912 Ga0453684_0180912_1483_1986 165
166 3300045051 Ga0451576_1780091 Ga0451576_1780091_124_624 165
167 3300046472 Ga0495580_0401819 Ga0495580_0401819_80_580 165
168 3300046531 Ga0495665_0125005 Ga0495665_0125005_499_999 165
169 3300006844 Ga0075428_100029890 Ga0075428_1000298905 166
170 3300006846 Ga0075430_100004015 Ga0075430_1000040152 166
171 3300009093 Ga0105240_10492143 Ga0105240_104921432 166
172 3300025913 Ga0207695_10855674 Ga0207695_108556742 166
173 3300031241 Ga0265325_10144613 Ga0265325_101446132 166
174 3300031249 Ga0265339_10005735 Ga0265339_100057354 166
175 3300031344 Ga0265316_10263619 Ga0265316_102636192 166
176 3300031711 Ga0265314_10002132 Ga0265314_100021324 166
177 3300031712 Ga0265342_10097287 Ga0265342_100972872 166
178 3300031727 Ga0316576_10237369 Ga0316576_102373691 166
179 3300031728 Ga0316578_10016683 Ga0316578_100166834 166
180 3300032137 Ga0316585_10074157 Ga0316585_100741571 166
181 3300035398 Ga0316574_0196124 Ga0316574_0196124_602_1126 166
182 3300036712 Ga0316584_0274500 Ga0316584_0274500_152_676 166
183 3300044673 Ga0453683_0067439 Ga0453683_0067439_448_951 166
184 3300045051 Ga0451576_0025192 Ga0451576_0025192_3112_3615 166
185 3300050508 nmdc:mga09592_1205392_c1 nmdc:mga09592_1205392_c1_85_609 166
186 3300050510 nmdc:mga06r32_7072_c1 nmdc:mga06r32_7072_c1_423_947 166
187 3300028379 Ga0268266_10096746 Ga0268266_100967463 168
188 3300005354 Ga0070675_100038052 Ga0070675_1000380522 170
189 3300025926 Ga0207659_10188056 Ga0207659_101880562 170
190 3300046809 Ga0495600_0411486 Ga0495600_0411486_212_724 170
191 3300028381 Ga0268264_10549717 Ga0268264_105497171 171
192 3300005563 Ga0068855_100283167 Ga0068855_1002831672 173
193 3300009093 Ga0105240_10261541 Ga0105240_102615412 173
194 3300025913 Ga0207695_10469101 Ga0207695_104691012 173
195 3300028558 Ga0265326_10018242 Ga0265326_100182422 173
196 3300028563 Ga0265319_1010701 Ga0265319_10107012 173
197 3300028573 Ga0265334_10003156 Ga0265334_100031565 173
198 3300028577 Ga0265318_10000034 Ga0265318_1000003483 173
199 3300028800 Ga0265338_10000243 Ga0265338_1000024320 173
200 3300028800 Ga0265338_10004648 Ga0265338_100046483 173
201 3300029957 Ga0265324_10004263 Ga0265324_100042635 173
202 3300031238 Ga0265332_10011122 Ga0265332_100111223 173
203 3300031240 Ga0265320_10001983 Ga0265320_100019832 173
204 3300031242 Ga0265329_10034555 Ga0265329_100345551 173
205 3300031247 Ga0265340_10001343 Ga0265340_100013435 173
206 3300031249 Ga0265339_10062363 Ga0265339_100623632 173
207 3300031250 Ga0265331_10045511 Ga0265331_100455111 173
208 3300031250 Ga0265331_10094557 Ga0265331_100945572 173
209 3300031251 Ga0265327_10000966 Ga0265327_1000096621 173
210 3300031251 Ga0265327_10001868 Ga0265327_1000186812 173
211 3300031344 Ga0265316_10104468 Ga0265316_101044682 173
212 3300031595 Ga0265313_10004583 Ga0265313_100045835 173
213 3300031711 Ga0265314_10001931 Ga0265314_100019319 173
214 3300035695 Ga0373927_0478632 Ga0373927_0478632_34_555 173
215 3300041486 Ga0451807_1779121 Ga0451807_1779121_77_598 173
216 3300049572 Ga0501036_0526449 Ga0501036_0526449_220_741 173
217 3300049579 Ga0501043_0113086 Ga0501043_0113086_1001_1522 173
218 3300049581 Ga0501047_0293628 Ga0501047_0293628_212_733 173
219 3300005439 Ga0070711_100467977 Ga0070711_1004679771 174
220 3300028563 Ga0265319_1000007 Ga0265319_1000007151 174
221 3300028800 Ga0265338_10031083 Ga0265338_100310833 174
222 3300031240 Ga0265320_10015743 Ga0265320_100157432 174
223 3300031711 Ga0265314_10077002 Ga0265314_100770022 174
224 3300035083 Ga0373926_0037904 Ga0373926_0037904_188_712 174
225 3300046517 Ga0495630_0188957 Ga0495630_0188957_162_686 174
226 3300046683 Ga0495658_0401495 Ga0495658_0401495_284_808 174
227 3300003320 rootH2_10000692 rootH2_100006922 175
228 3300005340 Ga0070689_100217747 Ga0070689_1002177472 175
229 3300005841 Ga0068863_100247563 Ga0068863_1002475632 175
230 3300009093 Ga0105240_10005659 Ga0105240_1000565910 175
231 3300013306 Ga0163162_11184485 Ga0163162_111844851 175
232 3300014969 Ga0157376_10141370 Ga0157376_101413702 175
233 3300014969 Ga0157376_10907330 Ga0157376_109073301 175
234 3300017792 Ga0163161_10498276 Ga0163161_104982761 175
235 3300025924 Ga0207694_10383189 Ga0207694_103831892 175
236 3300025936 Ga0207670_10207675 Ga0207670_102076752 175
237 3300026078 Ga0207702_10261648 Ga0207702_102616482 175
238 3300026088 Ga0207641_10223287 Ga0207641_102232872 175
239 3300028556 Ga0265337_1006055 Ga0265337_10060551 175
240 3300028556 Ga0265337_1006312 Ga0265337_10063123 175
241 3300028558 Ga0265326_10055529 Ga0265326_100555292 175
242 3300028563 Ga0265319_1024215 Ga0265319_10242152 175
243 3300028563 Ga0265319_1049999 Ga0265319_10499991 175
244 3300028653 Ga0265323_10051872 Ga0265323_100518723 175
245 3300028666 Ga0265336_10004796 Ga0265336_100047964 175
246 3300028800 Ga0265338_10000016 Ga0265338_10000016106 175
247 3300028800 Ga0265338_10000198 Ga0265338_1000019860 175
248 3300028800 Ga0265338_10014568 Ga0265338_100145689 175
249 3300028800 Ga0265338_10019673 Ga0265338_100196735 175
250 3300028800 Ga0265338_10029221 Ga0265338_100292213 175
251 3300028800 Ga0265338_10406646 Ga0265338_104066462 175
252 3300029957 Ga0265324_10009180 Ga0265324_100091803 175
253 3300031240 Ga0265320_10001362 Ga0265320_1000136215 175
254 3300031240 Ga0265320_10005693 Ga0265320_100056933 175
255 3300031240 Ga0265320_10053116 Ga0265320_100531163 175
256 3300031240 Ga0265320_10088373 Ga0265320_100883732 175
257 3300031241 Ga0265325_10017957 Ga0265325_100179573 175
258 3300031241 Ga0265325_10020855 Ga0265325_100208553 175
259 3300031249 Ga0265339_10128563 Ga0265339_101285631 175
260 3300031251 Ga0265327_10000092 Ga0265327_10000092163 175
261 3300031344 Ga0265316_10041939 Ga0265316_100419392 175
262 3300031344 Ga0265316_10117383 Ga0265316_101173832 175
263 3300031344 Ga0265316_10279268 Ga0265316_102792682 175
264 3300031344 Ga0265316_10351219 Ga0265316_103512192 175
265 3300031344 Ga0265316_10606108 Ga0265316_106061081 175
266 3300031595 Ga0265313_10019845 Ga0265313_100198452 175
267 3300031711 Ga0265314_10088561 Ga0265314_100885612 175
268 3300031727 Ga0316576_10345315 Ga0316576_103453152 175
269 3300035083 Ga0373926_0019723 Ga0373926_0019723_59_592 175
270 3300035086 Ga0373934_0189028 Ga0373934_0189028_32_565 175
271 3300035089 Ga0373944_0137591 Ga0373944_0137591_26_559 175
272 3300035119 Ga0373956_0160889 Ga0373956_0160889_510_1043 175
273 3300035170 Ga0373943_0020992 Ga0373943_0020992_2298_2831 175
274 3300035172 Ga0373955_0145679 Ga0373955_0145679_614_1147 175
275 3300035695 Ga0373927_0007273 Ga0373927_0007273_6720_7253 175
276 3300035725 Ga0373947_0301549 Ga0373947_0301549_194_727 175
277 3300035725 Ga0373947_0745923 Ga0373947_0745923_69_602 175
278 3300035725 Ga0373947_0805948 Ga0373947_0805948_50_583 175
279 3300036401 Ga0373937_0226120 Ga0373937_0226120_437_970 175
280 3300036401 Ga0373937_0790421 Ga0373937_0790421_209_877 175
281 3300036647 Ga0316582_0255277 Ga0316582_0255277_167_760 175
282 3300036712 Ga0316584_0338904 Ga0316584_0338904_308_901 175
283 3300037068 Ga0373925_0009994 Ga0373925_0009994_6297_6830 175
284 3300037068 Ga0373925_0341547 Ga0373925_0341547_122_655 175
285 3300042876 Ga0451577_0025803 Ga0451577_0025803_4600_5127 175
286 3300042876 Ga0451577_0211654 Ga0451577_0211654_45_593 175
287 3300042876 Ga0451577_0399007 Ga0451577_0399007_144_671 175
288 3300042876 Ga0451577_0538535 Ga0451577_0538535_41_568 175
289 3300042876 Ga0451577_0607074 Ga0451577_0607074_224_871 175
290 3300044712 Ga0453684_0002669 Ga0453684_0002669_29087_29620 175
291 3300044712 Ga0453684_0024853 Ga0453684_0024853_6247_6795 175
292 3300044712 Ga0453684_0043724 Ga0453684_0043724_5232_5759 175
293 3300044712 Ga0453684_0064111 Ga0453684_0064111_1461_1988 175
294 3300044712 Ga0453684_0285416 Ga0453684_0285416_97_633 175
295 3300044712 Ga0453684_0449394 Ga0453684_0449394_314_841 175
296 3300045051 Ga0451576_0108470 Ga0451576_0108470_555_1088 175
297 3300045051 Ga0451576_0262593 Ga0451576_0262593_139_672 175
298 3300045051 Ga0451576_0326397 Ga0451576_0326397_769_1302 175
299 3300045051 Ga0451576_0809976 Ga0451576_0809976_399_932 175
300 3300045051 Ga0451576_1963740 Ga0451576_1963740_56_589 175
301 3300046459 Ga0495629_0204373 Ga0495629_0204373_225_758 175
302 3300046462 Ga0495651_0160356 Ga0495651_0160356_665_1198 175
303 3300046476 Ga0495662_0020026 Ga0495662_0020026_1954_2487 175
304 3300046477 Ga0495664_0018477 Ga0495664_0018477_3355_3888 175
305 3300046511 Ga0495608_0180107 Ga0495608_0180107_127_660 175
306 3300046514 Ga0495618_0006965 Ga0495618_0006965_1371_1904 175
307 3300046517 Ga0495630_0000049 Ga0495630_0000049_86870_87403 175
308 3300046517 Ga0495630_0118700 Ga0495630_0118700_609_1142 175
309 3300046517 Ga0495630_1227846 Ga0495630_1227846_20_553 175
310 3300046526 Ga0495666_0002667 Ga0495666_0002667_2891_3424 175
311 3300046526 Ga0495666_0116149 Ga0495666_0116149_572_1105 175
312 3300046531 Ga0495665_0182188 Ga0495665_0182188_329_862 175
313 3300046533 Ga0495640_0178124 Ga0495640_0178124_463_996 175
314 3300046535 Ga0495586_0000185 Ga0495586_0000185_3801_4334 175
315 3300046535 Ga0495586_0004030 Ga0495586_0004030_2185_2718 175
316 3300046536 Ga0495587_0057428 Ga0495587_0057428_1106_1639 175
317 3300046559 Ga0495667_0158352 Ga0495667_0158352_677_1210 175
318 3300046642 Ga0495634_0001149 Ga0495634_0001149_206_739 175
319 3300046642 Ga0495634_0053923 Ga0495634_0053923_1843_2376 175
320 3300046642 Ga0495634_0100815 Ga0495634_0100815_1105_1638 175
321 3300046663 Ga0495635_0041617 Ga0495635_0041617_1235_1768 175
322 3300046678 Ga0495599_0068929 Ga0495599_0068929_1592_2125 175
323 3300046681 Ga0495647_0107559 Ga0495647_0107559_12_545 175
324 3300046683 Ga0495658_0708484 Ga0495658_0708484_35_568 175
325 3300046689 Ga0495613_0007466 Ga0495613_0007466_1610_2143 175
326 3300046689 Ga0495613_0152757 Ga0495613_0152757_218_751 175
327 3300046689 Ga0495613_0216959 Ga0495613_0216959_477_1010 175
328 3300047315 Ga0495581_0060647 Ga0495581_0060647_297_830 175
329 3300047319 Ga0495674_0002484 Ga0495674_0002484_11615_12148 175
330 3300047319 Ga0495674_0077107 Ga0495674_0077107_2181_2714 175
331 3300047321 Ga0495676_0104476 Ga0495676_0104476_1163_1696 175
332 3300047322 Ga0495680_0383910 Ga0495680_0383910_229_762 175
333 3300047444 Ga0495675_0059191 Ga0495675_0059191_124_657 175
334 3300047471 Ga0495684_0142288 Ga0495684_0142288_154_690 175
335 3300050514 nmdc:mga08x19_333621_c1 nmdc:mga08x19_333621_c1_359_892 175
336 3300053085 Ga0495619_0502478 Ga0495619_0502478_245_778 175

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01257

2Fe-2S_thioredx

Thioredoxin-like [2Fe-2S] ferredoxin

47

191

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5j4z-assembly1.cif.gz_E architecture of tight respirasome 0.8284 92 175
7p8n-assembly1.cif.gz_a tmhydabc- t. maritima hydrogenase with bridge closed 0.7752 92 169
2b5a-assembly1.cif.gz_A c.bcli, control element of the bcli restriction-modification system 0.7658 57 78
7p92-assembly1.cif.gz_B tmhydabc- t. maritima bifurcating hydrogenase with bridge domain up 0.7449 87 171
8bew-assembly1.cif.gz_B cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from thermoanaerobacter kivui in the oxidised state 0.7425 89 174
ID Description Score Start End Superfamily
af_P9WIV5_106_200_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9063 92 174 3.40.30.10
af_Q9D6J6_126_223_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8978 92 174 3.40.30.10
af_P0AFD1_83_165_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8882 90 171 3.40.30.10
af_A4HX94_128_234_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8687 92 174 3.40.30.10
af_P0AFD1_83_165_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8687 90 171 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7V5QAJ9-F1-model_v4 NADH-quinone oxidoreductase subunit E 0.6119 43 174 GO:0016491
GO:0046872
GO:0051537
AF-A0A1G3UMG9-F1-model_v4 Hydrogenase 0.6093 40 174 GO:0016491
GO:0046872
GO:0051537
AF-A0A0D6PTH8-F1-model_v4 deleted 0.6058 40 175
AF-A0A7Z9LZ55-F1-model_v4 NAD(P)H-dependent oxidoreductase subunit E 0.6037 40 174 GO:0003954
GO:0046872
GO:0051537
AF-A0A2E4EZY1-F1-model_v4 NAD(P)H-dependent oxidoreductase subunit E 0.6029 43 174 GO:0046872
GO:0051536

Feature Viewer

pLDDT pTM Quality
86.02 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map