F412696

General Info

Members Datasets Scaffolds Average Seq Length
336 191 672 222

Family's Representative Sequence

Representative Sequence 3300025911|Ga0207654_10202714|Ga0207654_102027141
Length 283
Sequence VSLKNRNTLGSAKPRRLRRAQSFTEPLANLHLDPTILLTRIADGSTIINYTSGQLIFAQGDPADAIFYIQRGKVKLTVVSKPGREGVLAILGTGDFFGESCLAGQPLCMKSATAIGDATIMRVEKQAMIRLLRQEPAFSELFMTHLLSRNIRIEEDLMDQLFNSSEKRLARILLILANFGKEGKPEPAIAKISQETLAEMIGTTRSRVSFFMNKFRKLGFIEYNGGLKIHSSLLNVVLLDQEPAGLDNKPLLPGPVSLPQKNSASLSSFEQTAWTLGFILPVS

Samples

Sample ID Description Type Environment
1 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
148 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
149 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
150 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
151 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
152 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
153 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
154 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
155 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
156 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
159 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
171 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
172 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
173 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
174 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
175 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
176 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
177 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
178 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
179 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
180 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
181 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
182 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
185 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.36
Nodule 0
Rhizoplane 4.76
Rhizosphere 89.58
Stem 0
Stem Tuber 0
Unclassified 10.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207654_10202714 3300025911 Unclassified 1307
2 SwRhRL2b_contig_2824246 2162886007 Bacteria 2481
3 Ga0058859_11654298 3300004798 Bacteria 878
4 Ga0065712_10098184 3300005290 Bacteria 2127
5 Ga0065712_10251807 3300005290 Bacteria 958
6 Ga0065715_10022312 3300005293 Bacteria 2037
7 Ga0065715_10113792 3300005293 Bacteria 2475
8 Ga0065715_10162960 3300005293 Bacteria 1603
9 Ga0065707_10100439 3300005295 Bacteria 2930
10 Ga0070658_10195583 3300005327 Bacteria 1705
11 Ga0070676_10003737 3300005328 Bacteria 7979
12 Ga0070676_10137078 3300005328 Bacteria 1554
13 Ga0070683_100007142 3300005329 Bacteria 9411
14 Ga0070690_100005815 3300005330 Bacteria 6949
15 Ga0070670_100135902 3300005331 Bacteria 2124
16 Ga0068869_100428802 3300005334 Unclassified 1092
17 Ga0070680_100250707 3300005336 Bacteria 1497
18 Ga0070680_100408515 3300005336 Bacteria 1158
19 Ga0070682_100145179 3300005337 Bacteria 1622
20 Ga0068868_100112033 3300005338 Bacteria 2218
21 Ga0070689_100005235 3300005340 Bacteria 8838
22 Ga0070689_100192734 3300005340 Unclassified 1660
23 Ga0070691_10007993 3300005341 Bacteria 4837
24 Ga0070687_100048232 3300005343 Bacteria 2189
25 Ga0070661_100049318 3300005344 Bacteria 3082
26 Ga0070661_100125126 3300005344 Bacteria 1928
27 Ga0070661_100545825 3300005344 Bacteria 932
28 Ga0070669_100002994 3300005353 Bacteria 12177
29 Ga0070675_100026815 3300005354 Bacteria 4625
30 Ga0070675_100333142 3300005354 Bacteria 1343
31 Ga0070675_100741567 3300005354 Bacteria 896
32 Ga0070671_100015032 3300005355 Bacteria 6251
33 Ga0070671_100093557 3300005355 Bacteria 2519
34 Ga0070671_100128591 3300005355 Bacteria 2133
35 Ga0070674_100061389 3300005356 Bacteria 2623
36 Ga0070674_100079237 3300005356 Bacteria 2343
37 Ga0070673_100030656 3300005364 Bacteria 4029
38 Ga0070673_100057735 3300005364 Bacteria 3067
39 Ga0070673_100133200 3300005364 Unclassified 2089
40 Ga0070673_100377586 3300005364 Bacteria 1263
41 Ga0070688_100053128 3300005365 Bacteria 2533
42 Ga0070688_100139049 3300005365 Unclassified 1647
43 Ga0070659_100286189 3300005366 Bacteria 1372
44 Ga0070667_100034032 3300005367 Bacteria 4263
45 Ga0070703_10106668 3300005406 Bacteria 996
46 Ga0070711_100164277 3300005439 Unclassified 1686
47 Ga0070705_100003274 3300005440 Bacteria 7972
48 Ga0070700_100004588 3300005441 Bacteria 7231
49 Ga0070694_100016945 3300005444 Bacteria 4595
50 Ga0070694_100055593 3300005444 Bacteria 2685
51 Ga0070663_100254156 3300005455 Bacteria 1392
52 Ga0070678_100085804 3300005456 Bacteria 2400
53 Ga0070678_100244444 3300005456 Bacteria 1502
54 Ga0070681_10524566 3300005458 Bacteria 1098
55 Ga0068867_100001677 3300005459 Bacteria 15433
56 Ga0070699_100007391 3300005518 Bacteria 9566
57 Ga0070679_100282664 3300005530 Bacteria 1612
58 Ga0070679_100374479 3300005530 Bacteria 1371
59 Ga0070679_100607519 3300005530 Bacteria 1037
60 Ga0070684_100249541 3300005535 Bacteria 1622
61 Ga0070684_100268884 3300005535 Bacteria 1560
62 Ga0068853_100376494 3300005539 Bacteria 1325
63 Ga0070672_100089760 3300005543 Bacteria 2477
64 Ga0070672_100619706 3300005543 Bacteria 943
65 Ga0070695_100006284 3300005545 Bacteria 7018
66 Ga0070696_100001403 3300005546 Bacteria 15746
67 Ga0070665_100021920 3300005548 Bacteria 6425
68 Ga0070665_100329989 3300005548 Bacteria 1530
69 Ga0070704_100000107 3300005549 Bacteria 29019
70 Ga0070664_100119528 3300005564 Bacteria 2306
71 Ga0070664_100283793 3300005564 Bacteria 1493
72 Ga0070664_100289762 3300005564 Bacteria 1478
73 Ga0070664_100638778 3300005564 Unclassified 989
74 Ga0068857_100038150 3300005577 Bacteria 4255
75 Ga0068854_100028987 3300005578 Bacteria 3829
76 Ga0068854_100190754 3300005578 Bacteria 1606
77 Ga0068856_100487800 3300005614 Bacteria 1253
78 Ga0070702_100003278 3300005615 Bacteria 7209
79 Ga0070702_100248627 3300005615 Bacteria 1204
80 Ga0068859_100011317 3300005617 Bacteria 8978
81 Ga0068864_100053628 3300005618 Bacteria 3479
82 Ga0068864_100192837 3300005618 Unclassified 1869
83 Ga0068864_100257752 3300005618 Bacteria 1621
84 Ga0068866_10179616 3300005718 Bacteria 1249
85 Ga0068861_100008561 3300005719 Bacteria 7039
86 Ga0068861_100013201 3300005719 Bacteria 5779
87 Ga0068863_100071435 3300005841 Bacteria 3284
88 Ga0068863_100143588 3300005841 Bacteria 2282
89 Ga0068858_100068498 3300005842 Unclassified 3289
90 Ga0068858_100103547 3300005842 Bacteria 2655
91 Ga0068860_100032938 3300005843 Bacteria 4976
92 Ga0068862_100003969 3300005844 Bacteria 12568
93 Ga0068862_100013946 3300005844 Bacteria 6662
94 Ga0075368_10119974 3300006042 Bacteria 1089
95 Ga0075364_10016291 3300006051 Bacteria 4622
96 Ga0075367_10049440 3300006178 Bacteria 2478
97 Ga0075367_10084319 3300006178 Bacteria 1927
98 Ga0075367_10170658 3300006178 Bacteria 1355
99 Ga0075369_10190919 3300006186 Bacteria 944
100 Ga0075366_10009750 3300006195 Bacteria 5370
101 Ga0075366_10018998 3300006195 Bacteria 3973
102 Ga0075370_10092664 3300006353 Bacteria 1744
103 Ga0075370_10143879 3300006353 Bacteria 1395
104 Ga0068871_100065868 3300006358 Bacteria 2968
105 Ga0075430_100025704 3300006846 Bacteria 5010
106 Ga0075430_100029168 3300006846 Bacteria 4683
107 Ga0075430_100085744 3300006846 Bacteria 2637
108 Ga0075431_100017080 3300006847 Bacteria 7372
109 Ga0075431_100107013 3300006847 Unclassified 2885
110 Ga0075431_100112318 3300006847 Bacteria 2812
111 Ga0075431_100226578 3300006847 Bacteria 1905
112 Ga0075431_100622139 3300006847 Bacteria 1062
113 Ga0075433_10129108 3300006852 Bacteria 2246
114 Ga0075433_10311697 3300006852 Bacteria 1393
115 Ga0075434_100000326 3300006871 Bacteria 34180
116 Ga0075434_100002498 3300006871 Bacteria 16209
117 Ga0075434_100090179 3300006871 Bacteria 3067
118 Ga0075429_100023808 3300006880 Bacteria 5313
119 Ga0075429_100120887 3300006880 Unclassified 2289
120 Ga0075429_100503185 3300006880 Bacteria 1062
121 Ga0068865_100122462 3300006881 Bacteria 1936
122 Ga0068865_100844206 3300006881 Unclassified 793
123 Ga0075436_100001782 3300006914 Bacteria 14762
124 Ga0097620_100011317 3300006931 Bacteria 8978
125 Ga0097620_100141856 3300006931 Bacteria 2476
126 Ga0075435_100000020 3300007076 Bacteria 91240
127 Ga0075435_100098670 3300007076 Bacteria 2418
128 Ga0105240_10140770 3300009093 Bacteria 2885
129 Ga0111539_10001741 3300009094 Bacteria 28916
130 Ga0111539_10005595 3300009094 Bacteria 16254
131 Ga0111539_10048034 3300009094 Bacteria 5098
132 Ga0111539_10102335 3300009094 Bacteria 3362
133 Ga0111539_10467106 3300009094 Bacteria 1469
134 Ga0114129_10002924 3300009147 Bacteria 23894
135 Ga0114129_10007301 3300009147 Bacteria 15735
136 Ga0114129_10044096 3300009147 Bacteria 6274
137 Ga0114129_10055781 3300009147 Bacteria 5537
138 Ga0114129_10398740 3300009147 Bacteria 1813
139 Ga0105243_10006092 3300009148 Bacteria 9325
140 Ga0105243_10006954 3300009148 Bacteria 8712
141 Ga0105241_10200635 3300009174 Unclassified 1666
142 Ga0105248_10085563 3300009177 Bacteria 3548
143 Ga0105248_10311617 3300009177 Bacteria 1772
144 Ga0105237_10081396 3300009545 Unclassified 3229
145 Ga0105237_10146441 3300009545 Unclassified 2357
146 Ga0105238_10965807 3300009551 Bacteria 872
147 Ga0105249_10018123 3300009553 Bacteria 6259
148 Ga0105249_11191061 3300009553 Bacteria 833
149 Ga0105246_10331586 3300011119 Bacteria 1240
150 Ga0105246_10673267 3300011119 Bacteria 903
151 Ga0157370_10272454 3300013104 Unclassified 1564
152 Ga0157374_10200135 3300013296 Bacteria 1956
153 Ga0157378_10101457 3300013297 Bacteria 2628
154 Ga0157378_10209781 3300013297 Bacteria 1846
155 Ga0157375_10006452 3300013308 Bacteria 10218
156 Ga0157375_10134259 3300013308 Unclassified 2597
157 Ga0157375_11071235 3300013308 Bacteria 943
158 Ga0163163_10020205 3300014325 Bacteria 6268
159 Ga0163163_10326964 3300014325 Bacteria 1587
160 Ga0157380_10010705 3300014326 Bacteria 6608
161 Ga0157380_10214907 3300014326 Unclassified 1716
162 Ga0157380_10429408 3300014326 Unclassified 1263
163 Ga0182008_10425974 3300014497 Bacteria 717
164 Ga0157377_10175293 3300014745 Bacteria 1344
165 Ga0157377_10303355 3300014745 Unclassified 1055
166 Ga0157379_10811803 3300014968 Bacteria 883
167 Ga0157376_10030627 3300014969 Bacteria 4298
168 Ga0157376_10058523 3300014969 Unclassified 3228
169 Ga0182007_10162631 3300015262 Unclassified 764
170 Ga0207697_10000779 3300025315 Bacteria 18050
171 Ga0207697_10010662 3300025315 Bacteria 3921
172 Ga0207697_10018350 3300025315 Bacteria 2869
173 Ga0207697_10108169 3300025315 Bacteria 1189
174 Ga0207688_10006824 3300025901 Bacteria 6212
175 Ga0207688_10014938 3300025901 Bacteria 4213
176 Ga0207645_10002823 3300025907 Bacteria 13494
177 Ga0207645_10149196 3300025907 Unclassified 1526
178 Ga0207643_10040702 3300025908 Bacteria 2617
179 Ga0207695_10276879 3300025913 Bacteria 1572
180 Ga0207671_10130190 3300025914 Unclassified 1931
181 Ga0207660_10340397 3300025917 Bacteria 1201
182 Ga0207662_10482041 3300025918 Bacteria 852
183 Ga0207652_10068897 3300025921 Bacteria 3070
184 Ga0207681_10007879 3300025923 Bacteria 6516
185 Ga0207681_10048727 3300025923 Bacteria 2861
186 Ga0207681_10398549 3300025923 Bacteria 1111
187 Ga0207694_10669626 3300025924 Bacteria 875
188 Ga0207650_10027009 3300025925 Bacteria 4103
189 Ga0207650_10053434 3300025925 Bacteria 2994
190 Ga0207650_10240757 3300025925 Unclassified 1462
191 Ga0207659_10192638 3300025926 Bacteria 1623
192 Ga0207659_10271429 3300025926 Bacteria 1384
193 Ga0207644_10058694 3300025931 Bacteria 2782
194 Ga0207644_10115685 3300025931 Bacteria 2034
195 Ga0207644_10534192 3300025931 Unclassified 970
196 Ga0207690_10356990 3300025932 Bacteria 1157
197 Ga0207706_10536381 3300025933 Bacteria 1008
198 Ga0207709_10023773 3300025935 Bacteria 3491
199 Ga0207670_10048099 3300025936 Bacteria 2844
200 Ga0207670_10093922 3300025936 Unclassified 2127
201 Ga0207669_10091571 3300025937 Bacteria 1981
202 Ga0207704_10051376 3300025938 Bacteria 2492
203 Ga0207704_10114785 3300025938 Bacteria 1829
204 Ga0207691_10064049 3300025940 Bacteria 3332
205 Ga0207711_10818377 3300025941 Bacteria 867
206 Ga0207689_10415183 3300025942 Bacteria 1123
207 Ga0207661_10006839 3300025944 Bacteria 8085
208 Ga0207661_11095435 3300025944 Bacteria 733
209 Ga0207679_10259792 3300025945 Bacteria 1481
210 Ga0207679_10380437 3300025945 Bacteria 1237
211 Ga0207679_10504025 3300025945 Bacteria 1080
212 Ga0207651_10253735 3300025960 Bacteria 1440
213 Ga0207651_10490507 3300025960 Bacteria 1060
214 Ga0207651_10575369 3300025960 Bacteria 982
215 Ga0207640_10021297 3300025981 Bacteria 3863
216 Ga0207658_10125286 3300025986 Bacteria 2055
217 Ga0207658_10331591 3300025986 Bacteria 1320
218 Ga0207658_10604280 3300025986 Bacteria 986
219 Ga0207703_10439264 3300026035 Bacteria 1217
220 Ga0207678_10061096 3300026067 Bacteria 3240
221 Ga0207678_10085777 3300026067 Bacteria 2691
222 Ga0207708_10009394 3300026075 Bacteria 7239
223 Ga0207702_10438024 3300026078 Bacteria 1266
224 Ga0207641_10056627 3300026088 Bacteria 3332
225 Ga0207648_10003103 3300026089 Bacteria 17546
226 Ga0207648_10475828 3300026089 Bacteria 1140
227 Ga0207676_10018238 3300026095 Bacteria 5099
228 Ga0207676_10052914 3300026095 Unclassified 3176
229 Ga0207676_10363936 3300026095 Bacteria 1341
230 Ga0207674_10050200 3300026116 Bacteria 4263
231 Ga0207674_10284367 3300026116 Bacteria 1602
232 Ga0207675_100002967 3300026118 Bacteria 16695
233 Ga0207675_100011617 3300026118 Bacteria 8233
234 Ga0207683_10037905 3300026121 Bacteria 4199
235 Ga0207683_10112056 3300026121 Bacteria 2443
236 Ga0207683_10280273 3300026121 Bacteria 1523
237 Ga0207683_10855393 3300026121 Bacteria 844
238 Ga0209971_1009338 3300027682 Bacteria 2324
239 Ga0209971_1036059 3300027682 Bacteria 1190
240 Ga0209974_10082655 3300027876 Bacteria 1107
241 Ga0209974_10169125 3300027876 Bacteria 796
242 Ga0207428_10007345 3300027907 Bacteria 10058
243 Ga0207428_10025634 3300027907 Bacteria 4933
244 Ga0207428_10229403 3300027907 Unclassified 1390
245 Ga0207428_10283591 3300027907 Unclassified 1229
246 Ga0268266_10274669 3300028379 Bacteria 1565
247 Ga0268265_10001346 3300028380 Bacteria 20935
248 Ga0268265_10009377 3300028380 Bacteria 6614
249 Ga0307405_10031113 3300031731 Bacteria 3138
250 Ga0307405_10057069 3300031731 Bacteria 2451
251 Ga0307410_10032130 3300031852 Bacteria 3374
252 Ga0307412_10009599 3300031911 Bacteria 5557
253 Ga0307412_10021722 3300031911 Bacteria 3925
254 Ga0307412_10075609 3300031911 Bacteria 2311
255 Ga0307409_100027005 3300031995 Bacteria 4060
256 Ga0307409_100321179 3300031995 Bacteria 1449
257 Ga0307416_100031885 3300032002 Bacteria 3974
258 Ga0307416_100109734 3300032002 Bacteria 2427
259 Ga0307416_100719842 3300032002 Unclassified 1088
260 Ga0307414_10047659 3300032004 Bacteria 2951
261 Ga0307411_10005092 3300032005 Bacteria 6408
262 Ga0307415_100037419 3300032126 Bacteria 3189
263 Ga0373939_0008094 3300035114 Unclassified 2571
264 Ga0373941_0061141 3300035115 Bacteria 1226
265 Ga0373954_0136955 3300035118 Bacteria 1193
266 Ga0373956_0035769 3300035119 Bacteria 2191
267 Ga0373960_0047519 3300035121 Bacteria 1263
268 Ga0373955_0033710 3300035172 Bacteria 2699
269 Ga0373933_0250178 3300035724 Bacteria 1141
270 Ga0439450_008497 3300042008 Unclassified 1917
271 Ga0439435_0026267 3300042436 Bacteria 1549
272 Ga0439460_0048166 3300042461 Bacteria 1271
273 Ga0451576_0714716 3300045051 Bacteria 1052
274 Ga0495669_0001462 3300046684 Bacteria 9740
275 Ga0495604_0265807 3300047317 Bacteria 1164
276 Ga0496104_0017525 3300048907 Bacteria 6525
277 Ga0496105_0068097 3300048908 Bacteria 2940
278 Ga0496106_0485994 3300048909 Bacteria 992
279 Ga0496106_0498718 3300048909 Bacteria 978
280 Ga0496108_0048586 3300048911 Bacteria 3547
281 Ga0496108_0248364 3300048911 Bacteria 1548
282 Ga0496109_0003852 3300048912 Bacteria 12529
283 Ga0496109_0548857 3300048912 Bacteria 1090
284 Ga0496110_0002853 3300048913 Bacteria 13045
285 Ga0496110_0241839 3300048913 Bacteria 1642
286 Ga0496111_0053428 3300048914 Bacteria 2919
287 Ga0496111_0509721 3300048914 Bacteria 885
288 Ga0496112_0117040 3300048915 Bacteria 2635
289 Ga0496113_0363436 3300048916 Bacteria 1161
290 Ga0496114_0376136 3300048917 Bacteria 1257
291 Ga0496114_0632839 3300048917 Bacteria 942
292 Ga0501291_019747 3300049514 Bacteria 1060
293 Ga0501299_004426 3300049522 Bacteria 2099
294 Ga0501299_012329 3300049522 Bacteria 1457
295 Ga0501217_083145 3300049661 Unclassified 889
296 Ga0501249_044065 3300049679 Bacteria 1016
297 Ga0501245_013847 3300049708 Bacteria 1198
298 Ga0501279_014885 3300049775 Bacteria 1074
299 nmdc:mga03n38_179000_c1 3300050490 Bacteria 1085
300 nmdc:mga00v17_295915_c1 3300050491 Bacteria 1051
301 nmdc:mga0yw44_243759_c1 3300050492 Bacteria 1195
302 nmdc:mga0k408_27600_c1 3300050493 Bacteria 3225
303 nmdc:mga06z11_226662_c1 3300050494 Bacteria 1094
304 nmdc:mga06z11_239721_c1 3300050494 Bacteria 1065
305 nmdc:mga04h51_149718_c1 3300050495 Bacteria 891
306 nmdc:mga07m45_23180_c1 3300050496 Bacteria 3392
307 nmdc:mga05p37_1540_c2 3300050507 Bacteria 7689
308 nmdc:mga05p37_19100_c1 3300050507 Bacteria 8289
309 nmdc:mga05p37_354278_c1 3300050507 Bacteria 1727
310 nmdc:mga05p37_35620_c1 3300050507 Bacteria 6104
311 nmdc:mga05p37_451551_c1 3300050507 Bacteria 1487
312 nmdc:mga09592_320504_c1 3300050508 Unclassified 1343
313 nmdc:mga09592_76834_c1 3300050508 Bacteria 2840
314 nmdc:mga0qj67_174019_c1 3300050509 Bacteria 1748
315 nmdc:mga0qj67_20034_c1 3300050509 Bacteria 5118
316 nmdc:mga0qj67_31252_c1 3300050509 Bacteria 4147
317 nmdc:mga06r32_238816_c1 3300050510 Bacteria 1805
318 nmdc:mga06r32_272370_c1 3300050510 Bacteria 1680
319 nmdc:mga06r32_283469_c1 3300050510 Bacteria 1644
320 nmdc:mga06r32_54640_c1 3300050510 Unclassified 3830
321 nmdc:mga08y16_12804_c1 3300050511 Bacteria 8822
322 nmdc:mga08y16_208113_c1 3300050511 Bacteria 2026
323 nmdc:mga08y16_24352_c1 3300050511 Bacteria 6389
324 nmdc:mga08y16_2772_c1 3300050511 Bacteria 17960
325 nmdc:mga0n895_15759_c1 3300050512 Bacteria 6909
326 nmdc:mga0n895_215664_c1 3300050512 Bacteria 1949
327 nmdc:mga0n895_65783_c1 3300050512 Bacteria 3589
328 nmdc:mga0n895_80_c1 3300050512 Bacteria 54788
329 nmdc:mga0n895_96218_c1 3300050512 Bacteria 2966
330 nmdc:mga0rr50_35_c1 3300050513 Bacteria 91254
331 nmdc:mga0rr50_67227_c1 3300050513 Bacteria 2722
332 nmdc:mga08x19_1276_c1 3300050514 Bacteria 15624
333 nmdc:mga08x19_601176_c1 3300050514 Bacteria 779
334 nmdc:mga0a205_127737_c1 3300050515 Bacteria 2442
335 nmdc:mga0a205_504550_c1 3300050515 Bacteria 1066
336 nmdc:mga0a205_72293_c1 3300050515 Bacteria 3332
337 Ga0207654_10202714
338 SwRhRL2b_contig_2824246
339 Ga0058859_11654298
340 Ga0065712_10098184
341 Ga0065712_10251807
342 Ga0065715_10022312
343 Ga0065715_10113792
344 Ga0065715_10162960
345 Ga0065707_10100439
346 Ga0070658_10195583
347 Ga0070676_10003737
348 Ga0070676_10137078
349 Ga0070683_100007142
350 Ga0070690_100005815
351 Ga0070670_100135902
352 Ga0068869_100428802
353 Ga0070680_100250707
354 Ga0070680_100408515
355 Ga0070682_100145179
356 Ga0068868_100112033
357 Ga0070689_100005235
358 Ga0070689_100192734
359 Ga0070691_10007993
360 Ga0070687_100048232
361 Ga0070661_100049318
362 Ga0070661_100125126
363 Ga0070661_100545825
364 Ga0070669_100002994
365 Ga0070675_100026815
366 Ga0070675_100333142
367 Ga0070675_100741567
368 Ga0070671_100015032
369 Ga0070671_100093557
370 Ga0070671_100128591
371 Ga0070674_100061389
372 Ga0070674_100079237
373 Ga0070673_100030656
374 Ga0070673_100057735
375 Ga0070673_100133200
376 Ga0070673_100377586
377 Ga0070688_100053128
378 Ga0070688_100139049
379 Ga0070659_100286189
380 Ga0070667_100034032
381 Ga0070703_10106668
382 Ga0070711_100164277
383 Ga0070705_100003274
384 Ga0070700_100004588
385 Ga0070694_100016945
386 Ga0070694_100055593
387 Ga0070663_100254156
388 Ga0070678_100085804
389 Ga0070678_100244444
390 Ga0070681_10524566
391 Ga0068867_100001677
392 Ga0070699_100007391
393 Ga0070679_100282664
394 Ga0070679_100374479
395 Ga0070679_100607519
396 Ga0070684_100249541
397 Ga0070684_100268884
398 Ga0068853_100376494
399 Ga0070672_100089760
400 Ga0070672_100619706
401 Ga0070695_100006284
402 Ga0070696_100001403
403 Ga0070665_100021920
404 Ga0070665_100329989
405 Ga0070704_100000107
406 Ga0070664_100119528
407 Ga0070664_100283793
408 Ga0070664_100289762
409 Ga0070664_100638778
410 Ga0068857_100038150
411 Ga0068854_100028987
412 Ga0068854_100190754
413 Ga0068856_100487800
414 Ga0070702_100003278
415 Ga0070702_100248627
416 Ga0068859_100011317
417 Ga0068864_100053628
418 Ga0068864_100192837
419 Ga0068864_100257752
420 Ga0068866_10179616
421 Ga0068861_100008561
422 Ga0068861_100013201
423 Ga0068863_100071435
424 Ga0068863_100143588
425 Ga0068858_100068498
426 Ga0068858_100103547
427 Ga0068860_100032938
428 Ga0068862_100003969
429 Ga0068862_100013946
430 Ga0075368_10119974
431 Ga0075364_10016291
432 Ga0075367_10049440
433 Ga0075367_10084319
434 Ga0075367_10170658
435 Ga0075369_10190919
436 Ga0075366_10009750
437 Ga0075366_10018998
438 Ga0075370_10092664
439 Ga0075370_10143879
440 Ga0068871_100065868
441 Ga0075430_100025704
442 Ga0075430_100029168
443 Ga0075430_100085744
444 Ga0075431_100017080
445 Ga0075431_100107013
446 Ga0075431_100112318
447 Ga0075431_100226578
448 Ga0075431_100622139
449 Ga0075433_10129108
450 Ga0075433_10311697
451 Ga0075434_100000326
452 Ga0075434_100002498
453 Ga0075434_100090179
454 Ga0075429_100023808
455 Ga0075429_100120887
456 Ga0075429_100503185
457 Ga0068865_100122462
458 Ga0068865_100844206
459 Ga0075436_100001782
460 Ga0097620_100011317
461 Ga0097620_100141856
462 Ga0075435_100000020
463 Ga0075435_100098670
464 Ga0105240_10140770
465 Ga0111539_10001741
466 Ga0111539_10005595
467 Ga0111539_10048034
468 Ga0111539_10102335
469 Ga0111539_10467106
470 Ga0114129_10002924
471 Ga0114129_10007301
472 Ga0114129_10044096
473 Ga0114129_10055781
474 Ga0114129_10398740
475 Ga0105243_10006092
476 Ga0105243_10006954
477 Ga0105241_10200635
478 Ga0105248_10085563
479 Ga0105248_10311617
480 Ga0105237_10081396
481 Ga0105237_10146441
482 Ga0105238_10965807
483 Ga0105249_10018123
484 Ga0105249_11191061
485 Ga0105246_10331586
486 Ga0105246_10673267
487 Ga0157370_10272454
488 Ga0157374_10200135
489 Ga0157378_10101457
490 Ga0157378_10209781
491 Ga0157375_10006452
492 Ga0157375_10134259
493 Ga0157375_11071235
494 Ga0163163_10020205
495 Ga0163163_10326964
496 Ga0157380_10010705
497 Ga0157380_10214907
498 Ga0157380_10429408
499 Ga0182008_10425974
500 Ga0157377_10175293
501 Ga0157377_10303355
502 Ga0157379_10811803
503 Ga0157376_10030627
504 Ga0157376_10058523
505 Ga0182007_10162631
506 Ga0207697_10000779
507 Ga0207697_10010662
508 Ga0207697_10018350
509 Ga0207697_10108169
510 Ga0207688_10006824
511 Ga0207688_10014938
512 Ga0207645_10002823
513 Ga0207645_10149196
514 Ga0207643_10040702
515 Ga0207695_10276879
516 Ga0207671_10130190
517 Ga0207660_10340397
518 Ga0207662_10482041
519 Ga0207652_10068897
520 Ga0207681_10007879
521 Ga0207681_10048727
522 Ga0207681_10398549
523 Ga0207694_10669626
524 Ga0207650_10027009
525 Ga0207650_10053434
526 Ga0207650_10240757
527 Ga0207659_10192638
528 Ga0207659_10271429
529 Ga0207644_10058694
530 Ga0207644_10115685
531 Ga0207644_10534192
532 Ga0207690_10356990
533 Ga0207706_10536381
534 Ga0207709_10023773
535 Ga0207670_10048099
536 Ga0207670_10093922
537 Ga0207669_10091571
538 Ga0207704_10051376
539 Ga0207704_10114785
540 Ga0207691_10064049
541 Ga0207711_10818377
542 Ga0207689_10415183
543 Ga0207661_10006839
544 Ga0207661_11095435
545 Ga0207679_10259792
546 Ga0207679_10380437
547 Ga0207679_10504025
548 Ga0207651_10253735
549 Ga0207651_10490507
550 Ga0207651_10575369
551 Ga0207640_10021297
552 Ga0207658_10125286
553 Ga0207658_10331591
554 Ga0207658_10604280
555 Ga0207703_10439264
556 Ga0207678_10061096
557 Ga0207678_10085777
558 Ga0207708_10009394
559 Ga0207702_10438024
560 Ga0207641_10056627
561 Ga0207648_10003103
562 Ga0207648_10475828
563 Ga0207676_10018238
564 Ga0207676_10052914
565 Ga0207676_10363936
566 Ga0207674_10050200
567 Ga0207674_10284367
568 Ga0207675_100002967
569 Ga0207675_100011617
570 Ga0207683_10037905
571 Ga0207683_10112056
572 Ga0207683_10280273
573 Ga0207683_10855393
574 Ga0209971_1009338
575 Ga0209971_1036059
576 Ga0209974_10082655
577 Ga0209974_10169125
578 Ga0207428_10007345
579 Ga0207428_10025634
580 Ga0207428_10229403
581 Ga0207428_10283591
582 Ga0268266_10274669
583 Ga0268265_10001346
584 Ga0268265_10009377
585 Ga0307405_10031113
586 Ga0307405_10057069
587 Ga0307410_10032130
588 Ga0307412_10009599
589 Ga0307412_10021722
590 Ga0307412_10075609
591 Ga0307409_100027005
592 Ga0307409_100321179
593 Ga0307416_100031885
594 Ga0307416_100109734
595 Ga0307416_100719842
596 Ga0307414_10047659
597 Ga0307411_10005092
598 Ga0307415_100037419
599 Ga0373939_0008094
600 Ga0373941_0061141
601 Ga0373954_0136955
602 Ga0373956_0035769
603 Ga0373960_0047519
604 Ga0373955_0033710
605 Ga0373933_0250178
606 Ga0439450_008497
607 Ga0439435_0026267
608 Ga0439460_0048166
609 Ga0451576_0714716
610 Ga0495669_0001462
611 Ga0495604_0265807
612 Ga0496104_0017525
613 Ga0496105_0068097
614 Ga0496106_0485994
615 Ga0496106_0498718
616 Ga0496108_0048586
617 Ga0496108_0248364
618 Ga0496109_0003852
619 Ga0496109_0548857
620 Ga0496110_0002853
621 Ga0496110_0241839
622 Ga0496111_0053428
623 Ga0496111_0509721
624 Ga0496112_0117040
625 Ga0496113_0363436
626 Ga0496114_0376136
627 Ga0496114_0632839
628 Ga0501291_019747
629 Ga0501299_004426
630 Ga0501299_012329
631 Ga0501217_083145
632 Ga0501249_044065
633 Ga0501245_013847
634 Ga0501279_014885
635 nmdc:mga03n38_179000_c1
636 nmdc:mga00v17_295915_c1
637 nmdc:mga0yw44_243759_c1
638 nmdc:mga0k408_27600_c1
639 nmdc:mga06z11_226662_c1
640 nmdc:mga06z11_239721_c1
641 nmdc:mga04h51_149718_c1
642 nmdc:mga07m45_23180_c1
643 nmdc:mga05p37_1540_c2
644 nmdc:mga05p37_19100_c1
645 nmdc:mga05p37_354278_c1
646 nmdc:mga05p37_35620_c1
647 nmdc:mga05p37_451551_c1
648 nmdc:mga09592_320504_c1
649 nmdc:mga09592_76834_c1
650 nmdc:mga0qj67_174019_c1
651 nmdc:mga0qj67_20034_c1
652 nmdc:mga0qj67_31252_c1
653 nmdc:mga06r32_238816_c1
654 nmdc:mga06r32_272370_c1
655 nmdc:mga06r32_283469_c1
656 nmdc:mga06r32_54640_c1
657 nmdc:mga08y16_12804_c1
658 nmdc:mga08y16_208113_c1
659 nmdc:mga08y16_24352_c1
660 nmdc:mga08y16_2772_c1
661 nmdc:mga0n895_15759_c1
662 nmdc:mga0n895_215664_c1
663 nmdc:mga0n895_65783_c1
664 nmdc:mga0n895_80_c1
665 nmdc:mga0n895_96218_c1
666 nmdc:mga0rr50_35_c1
667 nmdc:mga0rr50_67227_c1
668 nmdc:mga08x19_1276_c1
669 nmdc:mga08x19_601176_c1
670 nmdc:mga0a205_127737_c1
671 nmdc:mga0a205_504550_c1
672 nmdc:mga0a205_72293_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00027

cNMP_binding

Cyclic nucleotide-binding domain

47

135

0.94

PF13545

HTH_Crp_2

Crp-like helix-turn-helix domain

167

232

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ku7-assembly1.cif.gz_A structures of pkgi reveal a cgmp-selective activation mechanism 0.9518 22 108
5kbf-assembly2.cif.gz_B camp bound pfpka-r (141-441) 0.9338 23 108
4qx5-assembly1.cif.gz_A neutron diffraction reveals hydrogen bonds critical for cgmp-selective activation: insights for pkg agonist design 0.932 20 105
5j3u-assembly1.cif.gz_A co-crystal structure of the regulatory domain of toxoplasma gondii pka with camp 0.9315 23 108
5j48-assembly2.cif.gz_B pkg i's carboyl terminal cyclic nucleotide binding domain (cnb-b) in a complex with 8-pcpt-cgmp 0.9297 20 105
ID Description Score Start End Superfamily
2xkpF01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9633 23 126 2.60.120.10
5cvrA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9407 24 135 2.60.120.10
2xkpF01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9368 23 126 2.60.120.10
af_O76360_306_441_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9341 23 108 2.60.120.10
5kbfB01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9338 23 108 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A353EHB4-F1-model_v4 Cyclic nucleotide-binding protein 0.9525 23 108
AF-T0ZZD3-F1-model_v4 Transcriptional regulator, Crp/Fnr family 0.9486 24 97 GO:0003700
GO:0005829
AF-A0A6N1DTY7-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.9483 23 108 GO:0005829
AF-A0A6N7ALD4-F1-model_v4 Flp 0.9433 23 102 GO:0003700
GO:0005829
AF-A0A6N6X6Q4-F1-model_v4 deleted 0.9389 23 133

Map