F412553

General Info

Members Datasets Scaffolds Average Seq Length
336 196 672 183

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100201374|Ga0070659_1002013742
Length 193
Sequence MNLTAANQLTILRMLLVPAFVILLLYGYRGWALVAFFAAGLTDMFDGLAARLTGEKTTLGAWLDPMADKLLLVSMFVMLTLPDIGSVNRLPLWFTVLVISRDVAIVATVAVVNLAIGHRTFRPSMYGKVATALFIVTGIAALYFNYLEQRSSLVQGLIYASTVITFVSAADYAVRVIRMPHQTGGGPSSTSAP

Samples

Sample ID Description Type Environment
1 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
132 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
133 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
134 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
135 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
136 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
137 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
141 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
161 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
162 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
163 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
164 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
165 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
166 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
167 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
168 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
169 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
170 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
171 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
174 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
175 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
176 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
177 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
178 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
179 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
182 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
190 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
191 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
192 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
193 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
194 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
196 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.57
Nodule 0
Rhizoplane 3.87
Rhizosphere 92.26
Stem 0
Stem Tuber 0
Unclassified 12.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070659_100201374 3300005366 Bacteria 1639
2 Ga0065712_10069548 3300005290 Bacteria 7072
3 Ga0065712_10083343 3300005290 Bacteria 2839
4 Ga0065715_10192021 3300005293 Bacteria 1409
5 Ga0065715_10239609 3300005293 Unclassified 1204
6 Ga0065715_10317096 3300005293 Bacteria 1009
7 Ga0065715_10468531 3300005293 Bacteria 808
8 Ga0065707_10090028 3300005295 Bacteria 4227
9 Ga0070676_10055081 3300005328 Bacteria 2346
10 Ga0070670_100077847 3300005331 Bacteria 2849
11 Ga0070670_100101599 3300005331 Bacteria 2476
12 Ga0070670_100530186 3300005331 Unclassified 1049
13 Ga0068869_100161517 3300005334 Bacteria 1744
14 Ga0070666_10057518 3300005335 Bacteria 2628
15 Ga0070682_100362689 3300005337 Unclassified 1084
16 Ga0070682_100378280 3300005337 Bacteria 1064
17 Ga0068868_100072779 3300005338 Bacteria 2742
18 Ga0070660_100323003 3300005339 Bacteria 1268
19 Ga0070689_100003930 3300005340 Bacteria 9970
20 Ga0070661_101099802 3300005344 Bacteria 662
21 Ga0070668_100853933 3300005347 Unclassified 811
22 Ga0070669_100001008 3300005353 Bacteria 20525
23 Ga0070669_100039308 3300005353 Bacteria 3437
24 Ga0070675_100796668 3300005354 Bacteria 864
25 Ga0070675_101122348 3300005354 Bacteria 723
26 Ga0070671_100031147 3300005355 Bacteria 4405
27 Ga0070674_100269189 3300005356 Bacteria 1346
28 Ga0070674_100373814 3300005356 Bacteria 1158
29 Ga0070673_100000857 3300005364 Bacteria 17053
30 Ga0070688_100074663 3300005365 Bacteria 2178
31 Ga0070688_100340161 3300005365 Bacteria 1095
32 Ga0070659_100117197 3300005366 Bacteria 2154
33 Ga0070659_100135047 3300005366 Bacteria 2006
34 Ga0070659_100294854 3300005366 Bacteria 1351
35 Ga0070667_100261864 3300005367 Bacteria 1548
36 Ga0070667_100451467 3300005367 Bacteria 1175
37 Ga0070667_100569714 3300005367 Bacteria 1042
38 Ga0070703_10045514 3300005406 Unclassified 1384
39 Ga0070701_10018445 3300005438 Bacteria 3279
40 Ga0070700_100031374 3300005441 Bacteria 3183
41 Ga0070700_100186526 3300005441 Bacteria 1447
42 Ga0070694_100115406 3300005444 Bacteria 1919
43 Ga0070663_100233213 3300005455 Bacteria 1450
44 Ga0070678_100094741 3300005456 Bacteria 2299
45 Ga0070678_100757591 3300005456 Bacteria 879
46 Ga0070662_100283318 3300005457 Bacteria 1342
47 Ga0070681_10074886 3300005458 Bacteria 3346
48 Ga0070681_10133400 3300005458 Bacteria 2415
49 Ga0070699_100167714 3300005518 Bacteria 1945
50 Ga0070699_100556055 3300005518 Bacteria 1045
51 Ga0070679_100869261 3300005530 Bacteria 845
52 Ga0070672_100001846 3300005543 Bacteria 13223
53 Ga0070695_100131754 3300005545 Bacteria 1724
54 Ga0070695_100194422 3300005545 Unclassified 1446
55 Ga0070696_100599100 3300005546 Unclassified 888
56 Ga0070693_100086869 3300005547 Bacteria 1877
57 Ga0070704_100227161 3300005549 Bacteria 1520
58 Ga0068855_100294630 3300005563 Bacteria 1798
59 Ga0068855_100301312 3300005563 Bacteria 1775
60 Ga0070664_100398512 3300005564 Bacteria 1258
61 Ga0068856_100510588 3300005614 Bacteria 1223
62 Ga0070702_100013379 3300005615 Bacteria 4141
63 Ga0068852_100257236 3300005616 Bacteria 1675
64 Ga0068852_100403132 3300005616 Bacteria 1346
65 Ga0068859_100288513 3300005617 Bacteria 1734
66 Ga0068864_100077208 3300005618 Bacteria 2912
67 Ga0068864_101033708 3300005618 Bacteria 816
68 Ga0068864_101092015 3300005618 Bacteria 794
69 Ga0068866_10175874 3300005718 Bacteria 1260
70 Ga0068861_100385000 3300005719 Bacteria 1240
71 Ga0068863_100160814 3300005841 Bacteria 2152
72 Ga0068858_100304276 3300005842 Bacteria 1521
73 Ga0068862_100021759 3300005844 Bacteria 5362
74 Ga0068862_100080395 3300005844 Bacteria 2826
75 Ga0068862_100542713 3300005844 Bacteria 1109
76 Ga0075365_10032682 3300006038 Unclassified 3347
77 Ga0075363_100091706 3300006048 Bacteria 1673
78 Ga0075364_10159332 3300006051 Bacteria 1523
79 Ga0070712_100216312 3300006175 Bacteria 1514
80 Ga0075367_10002143 3300006178 Bacteria 8883
81 Ga0075367_10277598 3300006178 Bacteria 1053
82 Ga0075370_10015003 3300006353 Bacteria 4140
83 Ga0068871_100195732 3300006358 Unclassified 1743
84 Ga0075428_100756927 3300006844 Bacteria 1033
85 Ga0075430_100048968 3300006846 Unclassified 3567
86 Ga0075430_100067568 3300006846 Bacteria 3000
87 Ga0075431_100123829 3300006847 Bacteria 2667
88 Ga0075431_100168325 3300006847 Bacteria 2252
89 Ga0075433_10052640 3300006852 Unclassified 3548
90 Ga0075434_100019943 3300006871 Bacteria 6494
91 Ga0075434_100570339 3300006871 Bacteria 1151
92 Ga0075434_101455211 3300006871 Unclassified 695
93 Ga0075429_100162186 3300006880 Bacteria 1958
94 Ga0075429_100240614 3300006880 Bacteria 1585
95 Ga0068865_100528838 3300006881 Bacteria 987
96 Ga0097620_100288513 3300006931 Bacteria 1734
97 Ga0075435_100002897 3300007076 Bacteria 11517
98 Ga0075435_100257513 3300007076 Bacteria 1486
99 Ga0075435_100357119 3300007076 Bacteria 1253
100 Ga0111539_10001903 3300009094 Bacteria 27805
101 Ga0111539_10203229 3300009094 Bacteria 2310
102 Ga0111539_10396884 3300009094 Bacteria 1606
103 Ga0111539_10867741 3300009094 Bacteria 1050
104 Ga0111539_11022177 3300009094 Bacteria 961
105 Ga0111539_11555980 3300009094 Bacteria 767
106 Ga0105245_10196670 3300009098 Bacteria 1934
107 Ga0114129_10005999 3300009147 Bacteria 17217
108 Ga0114129_10025327 3300009147 Bacteria 8406
109 Ga0114129_10054644 3300009147 Bacteria 5598
110 Ga0114129_10111497 3300009147 Bacteria 3774
111 Ga0114129_10382890 3300009147 Bacteria 1857
112 Ga0105243_10023867 3300009148 Bacteria 4661
113 Ga0105241_10238917 3300009174 Bacteria 1535
114 Ga0105242_10099981 3300009176 Bacteria 2455
115 Ga0105242_11328067 3300009176 Bacteria 744
116 Ga0105248_10030983 3300009177 Bacteria 5976
117 Ga0105249_10027664 3300009553 Bacteria 5117
118 Ga0105239_10709338 3300010375 Bacteria 1150
119 Ga0157370_10713419 3300013104 Bacteria 915
120 Ga0157369_10374326 3300013105 Bacteria 1478
121 Ga0157378_10075666 3300013297 Bacteria 3032
122 Ga0157372_10282722 3300013307 Bacteria 1929
123 Ga0157372_10859909 3300013307 Bacteria 1053
124 Ga0157372_11023585 3300013307 Bacteria 956
125 Ga0163163_10190829 3300014325 Bacteria 2097
126 Ga0157380_10335442 3300014326 Bacteria 1408
127 Ga0157377_10514151 3300014745 Bacteria 839
128 Ga0157377_10695167 3300014745 Bacteria 738
129 Ga0157379_10335143 3300014968 Bacteria 1383
130 Ga0154015_1607857 3300020610 Bacteria 751
131 Ga0207673_1011814 3300025290 Bacteria 1133
132 Ga0207697_10005545 3300025315 Bacteria 5851
133 Ga0207642_10657551 3300025899 Bacteria 657
134 Ga0207688_10011516 3300025901 Bacteria 4813
135 Ga0207688_10013446 3300025901 Unclassified 4448
136 Ga0207645_10007919 3300025907 Bacteria 7465
137 Ga0207645_10419008 3300025907 Unclassified 902
138 Ga0207707_10404987 3300025912 Bacteria 1171
139 Ga0207660_10367999 3300025917 Bacteria 1154
140 Ga0207662_10003019 3300025918 Bacteria 8581
141 Ga0207649_10816159 3300025920 Bacteria 729
142 Ga0207652_10110263 3300025921 Bacteria 2440
143 Ga0207652_10604686 3300025921 Bacteria 983
144 Ga0207681_10072092 3300025923 Bacteria 2411
145 Ga0207681_10337470 3300025923 Bacteria 1203
146 Ga0207650_10076703 3300025925 Bacteria 2525
147 Ga0207659_10132192 3300025926 Bacteria 1928
148 Ga0207659_10210174 3300025926 Bacteria 1559
149 Ga0207659_10415008 3300025926 Bacteria 1128
150 Ga0207690_10103036 3300025932 Bacteria 2042
151 Ga0207690_10106445 3300025932 Bacteria 2012
152 Ga0207690_10438037 3300025932 Bacteria 1048
153 Ga0207690_10703171 3300025932 Bacteria 831
154 Ga0207709_10128360 3300025935 Bacteria 1724
155 Ga0207670_10055689 3300025936 Bacteria 2673
156 Ga0207669_10335420 3300025937 Bacteria 1162
157 Ga0207669_10575842 3300025937 Unclassified 912
158 Ga0207704_10600945 3300025938 Unclassified 901
159 Ga0207704_10973324 3300025938 Archaea 716
160 Ga0207691_10172453 3300025940 Bacteria 1894
161 Ga0207711_10041733 3300025941 Bacteria 3908
162 Ga0207711_10516367 3300025941 Bacteria 1114
163 Ga0207689_10061088 3300025942 Bacteria 3099
164 Ga0207712_10011422 3300025961 Bacteria 5658
165 Ga0207668_10290953 3300025972 Bacteria 1344
166 Ga0207640_10021800 3300025981 Bacteria 3823
167 Ga0207658_10584440 3300025986 Bacteria 1002
168 Ga0207677_10013316 3300026023 Bacteria 4762
169 Ga0207703_10091016 3300026035 Bacteria 2565
170 Ga0207678_10459656 3300026067 Bacteria 1107
171 Ga0207708_10008578 3300026075 Bacteria 7563
172 Ga0207708_10178664 3300026075 Bacteria 1684
173 Ga0207702_10178640 3300026078 Bacteria 1953
174 Ga0207648_10006957 3300026089 Bacteria 11197
175 Ga0207676_10066049 3300026095 Bacteria 2883
176 Ga0207676_10207948 3300026095 Bacteria 1734
177 Ga0207675_100179057 3300026118 Unclassified 2029
178 Ga0207683_10058319 3300026121 Bacteria 3390
179 Ga0207683_10138160 3300026121 Bacteria 2194
180 Ga0207683_10746150 3300026121 Bacteria 908
181 Ga0207683_11256090 3300026121 Bacteria 686
182 Ga0207698_10250451 3300026142 Bacteria 1620
183 Ga0207698_11459401 3300026142 Bacteria 699
184 Ga0207428_10026158 3300027907 Unclassified 4873
185 Ga0268266_10748365 3300028379 Bacteria 943
186 Ga0268265_10071205 3300028380 Bacteria 2707
187 Ga0268265_10442913 3300028380 Bacteria 1211
188 Ga0268265_10511011 3300028380 Bacteria 1134
189 Ga0307408_101055658 3300031548 Bacteria 751
190 Ga0307405_10244056 3300031731 Bacteria 1332
191 Ga0307410_10022533 3300031852 Bacteria 3896
192 Ga0307410_10201087 3300031852 Bacteria 1521
193 Ga0307412_10249125 3300031911 Bacteria 1378
194 Ga0307412_10427384 3300031911 Bacteria 1085
195 Ga0307409_100002440 3300031995 Bacteria 9717
196 Ga0307409_100013348 3300031995 Bacteria 5283
197 Ga0307409_100253477 3300031995 Bacteria 1610
198 Ga0307409_100514758 3300031995 Bacteria 1168
199 Ga0307409_100840829 3300031995 Unclassified 928
200 Ga0307416_100010715 3300032002 Bacteria 6074
201 Ga0307416_100457817 3300032002 Bacteria 1330
202 Ga0307416_100822922 3300032002 Bacteria 1025
203 Ga0307414_10260985 3300032004 Unclassified 1446
204 Ga0307414_10534761 3300032004 Bacteria 1042
205 Ga0307411_10044515 3300032005 Bacteria 2848
206 Ga0307411_10851341 3300032005 Unclassified 807
207 Ga0307415_100031244 3300032126 Bacteria 3428
208 Ga0307415_100528577 3300032126 Unclassified 1037
209 Ga0395905_0540100 3300037471 Bacteria 1067
210 Ga0395905_1243490 3300037471 Bacteria 648
211 Ga0439436_0096240 3300041404 Unclassified 825
212 Ga0451789_0779226 3300041443 Bacteria 630
213 Ga0451853_0172960 3300041512 Unclassified 750
214 Ga0439433_0035880 3300041999 Bacteria 1144
215 Ga0439433_0057922 3300041999 Bacteria 921
216 Ga0439435_0002830 3300042436 Bacteria 3514
217 Ga0439460_0098921 3300042461 Bacteria 935
218 Ga0439440_0028777 3300042993 Bacteria 1299
219 Ga0451576_0452708 3300045051 Bacteria 1348
220 Ga0495629_0086699 3300046459 Bacteria 2184
221 Ga0495613_0084606 3300046689 Bacteria 2303
222 Ga0496101_0710477 3300048904 Bacteria 793
223 Ga0496102_0424700 3300048905 Bacteria 1248
224 Ga0496103_0515323 3300048906 Unclassified 765
225 Ga0496104_0609193 3300048907 Bacteria 1002
226 Ga0496106_0413368 3300048909 Bacteria 1084
227 Ga0496110_0183848 3300048913 Bacteria 1898
228 Ga0496110_0746615 3300048913 Unclassified 882
229 Ga0496112_0325012 3300048915 Unclassified 1482
230 Ga0496112_0499238 3300048915 Unclassified 1152
231 Ga0496112_0594369 3300048915 Bacteria 1039
232 Ga0496112_0597128 3300048915 Bacteria 1036
233 Ga0496112_0714899 3300048915 Bacteria 929
234 Ga0501031_0027465 3300049568 Bacteria 3711
235 Ga0501033_0317673 3300049570 Unclassified 1094
236 Ga0501033_0796826 3300049570 Bacteria 639
237 Ga0501034_0099575 3300049571 Bacteria 2901
238 Ga0501036_0139394 3300049572 Bacteria 2047
239 Ga0501036_0606728 3300049572 Bacteria 908
240 Ga0501038_0164154 3300049574 Unclassified 1803
241 Ga0501039_0076874 3300049575 Bacteria 2596
242 Ga0501039_0170120 3300049575 Bacteria 1713
243 Ga0501039_0217554 3300049575 Unclassified 1502
244 Ga0501040_0249647 3300049576 Bacteria 1265
245 Ga0501041_0090253 3300049577 Bacteria 1892
246 Ga0501042_0173783 3300049578 Bacteria 1554
247 Ga0501042_0346759 3300049578 Unclassified 1074
248 Ga0501042_0809834 3300049578 Bacteria 682
249 Ga0501046_0110719 3300049580 Unclassified 2098
250 Ga0501047_0097928 3300049581 Bacteria 2811
251 Ga0501048_0112119 3300049582 Unclassified 1926
252 Ga0501067_0017080 3300049583 Bacteria 4010
253 Ga0501069_0019913 3300049585 Bacteria 3631
254 Ga0501069_0444177 3300049585 Bacteria 771
255 Ga0501070_0681839 3300049586 Bacteria 814
256 Ga0501071_0072220 3300049587 Bacteria 2517
257 Ga0501071_0140783 3300049587 Bacteria 1796
258 Ga0501071_0196464 3300049587 Bacteria 1514
259 Ga0501071_0278838 3300049587 Bacteria 1265
260 Ga0501072_0076060 3300049588 Bacteria 2656
261 Ga0501072_0280890 3300049588 Bacteria 1324
262 Ga0501073_0160961 3300049589 Bacteria 1555
263 Ga0501074_0021451 3300049590 Bacteria 4690
264 Ga0501075_0031265 3300049591 Bacteria 3950
265 Ga0501075_0050445 3300049591 Bacteria 3128
266 Ga0501075_0053270 3300049591 Bacteria 3043
267 Ga0501075_0191178 3300049591 Bacteria 1561
268 Ga0501076_0035471 3300049592 Bacteria 3902
269 Ga0501076_0090092 3300049592 Bacteria 2466
270 Ga0501076_0120629 3300049592 Bacteria 2123
271 Ga0501076_0410876 3300049592 Bacteria 1113
272 Ga0501076_0909430 3300049592 Bacteria 725
273 Ga0501077_0046667 3300049593 Bacteria 2752
274 Ga0501077_0141642 3300049593 Bacteria 1525
275 Ga0501077_0433813 3300049593 Unclassified 841
276 Ga0501077_0436876 3300049593 Bacteria 838
277 Ga0501235_098922 3300049669 Unclassified 711
278 Ga0501079_0077344 3300049741 Unclassified 2574
279 Ga0501079_0136821 3300049741 Unclassified 1908
280 Ga0501079_0180499 3300049741 Bacteria 1647
281 Ga0501079_0699063 3300049741 Unclassified 798
282 Ga0501080_0031417 3300049742 Bacteria 4948
283 Ga0501080_0113699 3300049742 Bacteria 2510
284 Ga0501080_0972945 3300049742 Bacteria 737
285 Ga0501081_0075585 3300049743 Bacteria 2352
286 Ga0501081_0202033 3300049743 Bacteria 1441
287 Ga0501045_0031081 3300049824 Unclassified 3867
288 Ga0501045_0048663 3300049824 Bacteria 3090
289 Ga0501045_0066293 3300049824 Bacteria 2651
290 Ga0501045_0187259 3300049824 Bacteria 1542
291 nmdc:mga00v17_11175_c1 3300050491 Bacteria 4930
292 nmdc:mga00v17_236763_c1 3300050491 Bacteria 1183
293 nmdc:mga0yw44_281369_c1 3300050492 Bacteria 1112
294 nmdc:mga06z11_26799_c1 3300050494 Bacteria 2748
295 nmdc:mga04h51_124990_c1 3300050495 Bacteria 962
296 nmdc:mga07m45_51085_c1 3300050496 Bacteria 2331
297 nmdc:mga05p37_315105_c1 3300050507 Bacteria 1853
298 nmdc:mga05p37_36576_c1 3300050507 Bacteria 6022
299 nmdc:mga05p37_54629_c1 3300050507 Bacteria 4913
300 nmdc:mga05p37_85762_c1 3300050507 Bacteria 3881
301 nmdc:mga09592_241551_c1 3300050508 Bacteria 1565
302 nmdc:mga09592_5762_c1 3300050508 Bacteria 7813
303 nmdc:mga0qj67_101673_c1 3300050509 Bacteria 2318
304 nmdc:mga0qj67_147031_c1 3300050509 Bacteria 1911
305 nmdc:mga06r32_137018_c1 3300050510 Bacteria 2423
306 nmdc:mga06r32_22480_c1 3300050510 Bacteria 5831
307 nmdc:mga06r32_47568_c1 3300050510 Bacteria 4097
308 nmdc:mga08y16_1175152_c1 3300050511 Bacteria 739
309 nmdc:mga08y16_1393822_c1 3300050511 Bacteria 664
310 nmdc:mga08y16_14263_c1 3300050511 Bacteria 8363
311 nmdc:mga08y16_24054_c1 3300050511 Bacteria 6432
312 nmdc:mga08y16_317211_c1 3300050511 Bacteria 1605
313 nmdc:mga0n895_1935_c1 3300050512 Bacteria 15884
314 nmdc:mga0n895_556776_c1 3300050512 Bacteria 1152
315 nmdc:mga0n895_762506_c1 3300050512 Bacteria 960
316 nmdc:mga0rr50_15073_c1 3300050513 Bacteria 5094
317 nmdc:mga08x19_300678_c1 3300050514 Bacteria 1114
318 nmdc:mga0a205_134505_c1 3300050515 Bacteria 2373
319 nmdc:mga0a205_156865_c1 3300050515 Bacteria 2174
320 nmdc:mga0a205_175507_c1 3300050515 Bacteria 2038
321 nmdc:mga0a205_544212_c1 3300050515 Bacteria 1016
322 nmdc:mga0a205_86872_c1 3300050515 Bacteria 3021
323 Ga0495619_0110884 3300053085 Bacteria 1875
324 Ga0501084_0021014 3300054114 Bacteria 5445
325 Ga0501084_0117231 3300054114 Bacteria 2239
326 Ga0501084_0188257 3300054114 Bacteria 1742
327 Ga0501084_0317293 3300054114 Bacteria 1316
328 Ga0590071_000979 3300059421 Bacteria 7831
329 Ga0590074_016270 3300059423 Bacteria 1265
330 Ga0590075_001268 3300059424 Bacteria 6342
331 Ga0590077_001309 3300059426 Bacteria 5919
332 Ga0501082_0293204 3300060353 Bacteria 1416
333 Ga0501082_0788833 3300060353 Unclassified 831
334 Ga0530510_0297339 3300061734 Bacteria 1208
335 Ga0530510_0401473 3300061734 Bacteria 1033
336 Ga0530510_1170579 3300061734 Bacteria 589
337 Ga0070659_100201374
338 Ga0065712_10069548
339 Ga0065712_10083343
340 Ga0065715_10192021
341 Ga0065715_10239609
342 Ga0065715_10317096
343 Ga0065715_10468531
344 Ga0065707_10090028
345 Ga0070676_10055081
346 Ga0070670_100077847
347 Ga0070670_100101599
348 Ga0070670_100530186
349 Ga0068869_100161517
350 Ga0070666_10057518
351 Ga0070682_100362689
352 Ga0070682_100378280
353 Ga0068868_100072779
354 Ga0070660_100323003
355 Ga0070689_100003930
356 Ga0070661_101099802
357 Ga0070668_100853933
358 Ga0070669_100001008
359 Ga0070669_100039308
360 Ga0070675_100796668
361 Ga0070675_101122348
362 Ga0070671_100031147
363 Ga0070674_100269189
364 Ga0070674_100373814
365 Ga0070673_100000857
366 Ga0070688_100074663
367 Ga0070688_100340161
368 Ga0070659_100117197
369 Ga0070659_100135047
370 Ga0070659_100294854
371 Ga0070667_100261864
372 Ga0070667_100451467
373 Ga0070667_100569714
374 Ga0070703_10045514
375 Ga0070701_10018445
376 Ga0070700_100031374
377 Ga0070700_100186526
378 Ga0070694_100115406
379 Ga0070663_100233213
380 Ga0070678_100094741
381 Ga0070678_100757591
382 Ga0070662_100283318
383 Ga0070681_10074886
384 Ga0070681_10133400
385 Ga0070699_100167714
386 Ga0070699_100556055
387 Ga0070679_100869261
388 Ga0070672_100001846
389 Ga0070695_100131754
390 Ga0070695_100194422
391 Ga0070696_100599100
392 Ga0070693_100086869
393 Ga0070704_100227161
394 Ga0068855_100294630
395 Ga0068855_100301312
396 Ga0070664_100398512
397 Ga0068856_100510588
398 Ga0070702_100013379
399 Ga0068852_100257236
400 Ga0068852_100403132
401 Ga0068859_100288513
402 Ga0068864_100077208
403 Ga0068864_101033708
404 Ga0068864_101092015
405 Ga0068866_10175874
406 Ga0068861_100385000
407 Ga0068863_100160814
408 Ga0068858_100304276
409 Ga0068862_100021759
410 Ga0068862_100080395
411 Ga0068862_100542713
412 Ga0075365_10032682
413 Ga0075363_100091706
414 Ga0075364_10159332
415 Ga0070712_100216312
416 Ga0075367_10002143
417 Ga0075367_10277598
418 Ga0075370_10015003
419 Ga0068871_100195732
420 Ga0075428_100756927
421 Ga0075430_100048968
422 Ga0075430_100067568
423 Ga0075431_100123829
424 Ga0075431_100168325
425 Ga0075433_10052640
426 Ga0075434_100019943
427 Ga0075434_100570339
428 Ga0075434_101455211
429 Ga0075429_100162186
430 Ga0075429_100240614
431 Ga0068865_100528838
432 Ga0097620_100288513
433 Ga0075435_100002897
434 Ga0075435_100257513
435 Ga0075435_100357119
436 Ga0111539_10001903
437 Ga0111539_10203229
438 Ga0111539_10396884
439 Ga0111539_10867741
440 Ga0111539_11022177
441 Ga0111539_11555980
442 Ga0105245_10196670
443 Ga0114129_10005999
444 Ga0114129_10025327
445 Ga0114129_10054644
446 Ga0114129_10111497
447 Ga0114129_10382890
448 Ga0105243_10023867
449 Ga0105241_10238917
450 Ga0105242_10099981
451 Ga0105242_11328067
452 Ga0105248_10030983
453 Ga0105249_10027664
454 Ga0105239_10709338
455 Ga0157370_10713419
456 Ga0157369_10374326
457 Ga0157378_10075666
458 Ga0157372_10282722
459 Ga0157372_10859909
460 Ga0157372_11023585
461 Ga0163163_10190829
462 Ga0157380_10335442
463 Ga0157377_10514151
464 Ga0157377_10695167
465 Ga0157379_10335143
466 Ga0154015_1607857
467 Ga0207673_1011814
468 Ga0207697_10005545
469 Ga0207642_10657551
470 Ga0207688_10011516
471 Ga0207688_10013446
472 Ga0207645_10007919
473 Ga0207645_10419008
474 Ga0207707_10404987
475 Ga0207660_10367999
476 Ga0207662_10003019
477 Ga0207649_10816159
478 Ga0207652_10110263
479 Ga0207652_10604686
480 Ga0207681_10072092
481 Ga0207681_10337470
482 Ga0207650_10076703
483 Ga0207659_10132192
484 Ga0207659_10210174
485 Ga0207659_10415008
486 Ga0207690_10103036
487 Ga0207690_10106445
488 Ga0207690_10438037
489 Ga0207690_10703171
490 Ga0207709_10128360
491 Ga0207670_10055689
492 Ga0207669_10335420
493 Ga0207669_10575842
494 Ga0207704_10600945
495 Ga0207704_10973324
496 Ga0207691_10172453
497 Ga0207711_10041733
498 Ga0207711_10516367
499 Ga0207689_10061088
500 Ga0207712_10011422
501 Ga0207668_10290953
502 Ga0207640_10021800
503 Ga0207658_10584440
504 Ga0207677_10013316
505 Ga0207703_10091016
506 Ga0207678_10459656
507 Ga0207708_10008578
508 Ga0207708_10178664
509 Ga0207702_10178640
510 Ga0207648_10006957
511 Ga0207676_10066049
512 Ga0207676_10207948
513 Ga0207675_100179057
514 Ga0207683_10058319
515 Ga0207683_10138160
516 Ga0207683_10746150
517 Ga0207683_11256090
518 Ga0207698_10250451
519 Ga0207698_11459401
520 Ga0207428_10026158
521 Ga0268266_10748365
522 Ga0268265_10071205
523 Ga0268265_10442913
524 Ga0268265_10511011
525 Ga0307408_101055658
526 Ga0307405_10244056
527 Ga0307410_10022533
528 Ga0307410_10201087
529 Ga0307412_10249125
530 Ga0307412_10427384
531 Ga0307409_100002440
532 Ga0307409_100013348
533 Ga0307409_100253477
534 Ga0307409_100514758
535 Ga0307409_100840829
536 Ga0307416_100010715
537 Ga0307416_100457817
538 Ga0307416_100822922
539 Ga0307414_10260985
540 Ga0307414_10534761
541 Ga0307411_10044515
542 Ga0307411_10851341
543 Ga0307415_100031244
544 Ga0307415_100528577
545 Ga0395905_0540100
546 Ga0395905_1243490
547 Ga0439436_0096240
548 Ga0451789_0779226
549 Ga0451853_0172960
550 Ga0439433_0035880
551 Ga0439433_0057922
552 Ga0439435_0002830
553 Ga0439460_0098921
554 Ga0439440_0028777
555 Ga0451576_0452708
556 Ga0495629_0086699
557 Ga0495613_0084606
558 Ga0496101_0710477
559 Ga0496102_0424700
560 Ga0496103_0515323
561 Ga0496104_0609193
562 Ga0496106_0413368
563 Ga0496110_0183848
564 Ga0496110_0746615
565 Ga0496112_0325012
566 Ga0496112_0499238
567 Ga0496112_0594369
568 Ga0496112_0597128
569 Ga0496112_0714899
570 Ga0501031_0027465
571 Ga0501033_0317673
572 Ga0501033_0796826
573 Ga0501034_0099575
574 Ga0501036_0139394
575 Ga0501036_0606728
576 Ga0501038_0164154
577 Ga0501039_0076874
578 Ga0501039_0170120
579 Ga0501039_0217554
580 Ga0501040_0249647
581 Ga0501041_0090253
582 Ga0501042_0173783
583 Ga0501042_0346759
584 Ga0501042_0809834
585 Ga0501046_0110719
586 Ga0501047_0097928
587 Ga0501048_0112119
588 Ga0501067_0017080
589 Ga0501069_0019913
590 Ga0501069_0444177
591 Ga0501070_0681839
592 Ga0501071_0072220
593 Ga0501071_0140783
594 Ga0501071_0196464
595 Ga0501071_0278838
596 Ga0501072_0076060
597 Ga0501072_0280890
598 Ga0501073_0160961
599 Ga0501074_0021451
600 Ga0501075_0031265
601 Ga0501075_0050445
602 Ga0501075_0053270
603 Ga0501075_0191178
604 Ga0501076_0035471
605 Ga0501076_0090092
606 Ga0501076_0120629
607 Ga0501076_0410876
608 Ga0501076_0909430
609 Ga0501077_0046667
610 Ga0501077_0141642
611 Ga0501077_0433813
612 Ga0501077_0436876
613 Ga0501235_098922
614 Ga0501079_0077344
615 Ga0501079_0136821
616 Ga0501079_0180499
617 Ga0501079_0699063
618 Ga0501080_0031417
619 Ga0501080_0113699
620 Ga0501080_0972945
621 Ga0501081_0075585
622 Ga0501081_0202033
623 Ga0501045_0031081
624 Ga0501045_0048663
625 Ga0501045_0066293
626 Ga0501045_0187259
627 nmdc:mga00v17_11175_c1
628 nmdc:mga00v17_236763_c1
629 nmdc:mga0yw44_281369_c1
630 nmdc:mga06z11_26799_c1
631 nmdc:mga04h51_124990_c1
632 nmdc:mga07m45_51085_c1
633 nmdc:mga05p37_315105_c1
634 nmdc:mga05p37_36576_c1
635 nmdc:mga05p37_54629_c1
636 nmdc:mga05p37_85762_c1
637 nmdc:mga09592_241551_c1
638 nmdc:mga09592_5762_c1
639 nmdc:mga0qj67_101673_c1
640 nmdc:mga0qj67_147031_c1
641 nmdc:mga06r32_137018_c1
642 nmdc:mga06r32_22480_c1
643 nmdc:mga06r32_47568_c1
644 nmdc:mga08y16_1175152_c1
645 nmdc:mga08y16_1393822_c1
646 nmdc:mga08y16_14263_c1
647 nmdc:mga08y16_24054_c1
648 nmdc:mga08y16_317211_c1
649 nmdc:mga0n895_1935_c1
650 nmdc:mga0n895_556776_c1
651 nmdc:mga0n895_762506_c1
652 nmdc:mga0rr50_15073_c1
653 nmdc:mga08x19_300678_c1
654 nmdc:mga0a205_134505_c1
655 nmdc:mga0a205_156865_c1
656 nmdc:mga0a205_175507_c1
657 nmdc:mga0a205_544212_c1
658 nmdc:mga0a205_86872_c1
659 Ga0495619_0110884
660 Ga0501084_0021014
661 Ga0501084_0117231
662 Ga0501084_0188257
663 Ga0501084_0317293
664 Ga0590071_000979
665 Ga0590074_016270
666 Ga0590075_001268
667 Ga0590077_001309
668 Ga0501082_0293204
669 Ga0501082_0788833
670 Ga0530510_0297339
671 Ga0530510_0401473
672 Ga0530510_1170579

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01066

CDP-OH_P_transf

CDP-alcohol phosphatidyltransferase

3

168

0.86

Map