F412511

General Info

Members Datasets Scaffolds Average Seq Length
336 174 672 184

Family's Representative Sequence

Representative Sequence 3300003203|JGI25406J46586_10004999|JGI25406J46586_100049994
Length 196
Sequence MGTRRFSASVLLLAGVLCGSSVMAQSSQSSPKYGVGRAPTAEEIRALDISIGPDGAELPPGQGSAKEGAQLFQSKGCAGCHGKTGTGGAAPELKAKPAASNLDTWDRGRVLPVRSPFATTVWDYINRAMPLGKEGTLTADDVYALTAFLLYINDVIPEDTVLDAQSLPKVRMPIGDAYASLPDWKPKTRRLKGYPF

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
64 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
121 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
122 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
123 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
124 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
125 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
126 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
127 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
128 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
129 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
130 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
131 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
132 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
136 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
137 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
138 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
139 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
140 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
143 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
144 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
145 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
146 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
147 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
148 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
149 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
150 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
151 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
152 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
153 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
154 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
155 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
161 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
163 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
164 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
165 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
166 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
172 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
173 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
174 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0.6
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.68
Rhizosphere 96.43
Stem 0
Stem Tuber 0
Unclassified 26.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10004999 3300003203 Bacteria 6156
2 JGI25406J46586_10000355 3300003203 Bacteria 20797
3 JGI25406J46586_10044973 3300003203 Bacteria 1524
4 Ga0058858_1399074 3300004785 Unclassified 767
5 Ga0058859_10019606 3300004798 Bacteria 1269
6 Ga0065712_10028245 3300005290 Bacteria 1784
7 Ga0065712_10330905 3300005290 Bacteria 814
8 Ga0065707_10012071 3300005295 Bacteria 1921
9 Ga0065707_10411787 3300005295 Unclassified 840
10 Ga0065707_10719205 3300005295 Unclassified 631
11 Ga0070676_10180623 3300005328 Bacteria 1371
12 Ga0070676_10231084 3300005328 Bacteria 1226
13 Ga0070690_100033292 3300005330 Bacteria 3225
14 Ga0070670_100007839 3300005331 Bacteria 9086
15 Ga0070670_101009571 3300005331 Unclassified 757
16 Ga0070670_101081188 3300005331 Unclassified 731
17 Ga0070666_10025587 3300005335 Unclassified 3848
18 Ga0070680_100154858 3300005336 Bacteria 1925
19 Ga0070689_100069698 3300005340 Unclassified 2744
20 Ga0070691_10029023 3300005341 Bacteria 2587
21 Ga0070691_10317431 3300005341 Unclassified 856
22 Ga0070661_100084595 3300005344 Bacteria 2343
23 Ga0070692_10021651 3300005345 Bacteria 3130
24 Ga0070669_100034954 3300005353 Bacteria 3639
25 Ga0070669_100351400 3300005353 Bacteria 1197
26 Ga0070675_100616618 3300005354 Bacteria 985
27 Ga0070675_100808505 3300005354 Bacteria 857
28 Ga0070671_100026507 3300005355 Bacteria 4764
29 Ga0070671_100033416 3300005355 Bacteria 4253
30 Ga0070671_100111355 3300005355 Bacteria 2299
31 Ga0070674_100928794 3300005356 Bacteria 759
32 Ga0070674_101395641 3300005356 Bacteria 627
33 Ga0070688_101084082 3300005365 Bacteria 640
34 Ga0070659_100580842 3300005366 Bacteria 961
35 Ga0070667_100245545 3300005367 Unclassified 1599
36 Ga0070667_100476134 3300005367 Unclassified 1143
37 Ga0070701_10078062 3300005438 Bacteria 1786
38 Ga0070701_10347250 3300005438 Bacteria 926
39 Ga0070705_100001491 3300005440 Bacteria 12351
40 Ga0070700_100053229 3300005441 Bacteria 2525
41 Ga0070694_100000534 3300005444 Bacteria 20931
42 Ga0070694_100306215 3300005444 Bacteria 1219
43 Ga0070694_100740827 3300005444 Unclassified 802
44 Ga0070708_100112332 3300005445 Bacteria 2505
45 Ga0070678_100065883 3300005456 Bacteria 2691
46 Ga0070662_100224375 3300005457 Unclassified 1501
47 Ga0070662_100824891 3300005457 Unclassified 789
48 Ga0068867_101639321 3300005459 Unclassified 602
49 Ga0070706_100371435 3300005467 Bacteria 1332
50 Ga0070706_100439993 3300005467 Bacteria 1213
51 Ga0070707_100475060 3300005468 Bacteria 1211
52 Ga0070698_100042843 3300005471 Bacteria 4643
53 Ga0070698_100160165 3300005471 Bacteria 2195
54 Ga0070698_100178087 3300005471 Unclassified 2065
55 Ga0070698_100273129 3300005471 Bacteria 1622
56 Ga0070699_100091537 3300005518 Bacteria 2659
57 Ga0070699_100106721 3300005518 Unclassified 2457
58 Ga0070699_100200029 3300005518 Bacteria 1776
59 Ga0070699_100506909 3300005518 Bacteria 1096
60 Ga0070697_100943997 3300005536 Unclassified 766
61 Ga0070672_100039512 3300005543 Unclassified 3615
62 Ga0070695_100006202 3300005545 Bacteria 7061
63 Ga0070695_100408131 3300005545 Unclassified 1031
64 Ga0070696_100000561 3300005546 Bacteria 23632
65 Ga0070696_100046346 3300005546 Bacteria 3014
66 Ga0070696_100335245 3300005546 Bacteria 1168
67 Ga0070696_100447186 3300005546 Bacteria 1019
68 Ga0070704_100197194 3300005549 Bacteria 1622
69 Ga0070704_100563499 3300005549 Unclassified 997
70 Ga0068855_100274982 3300005563 Bacteria 1872
71 Ga0070664_100017820 3300005564 Bacteria 5831
72 Ga0070702_100107952 3300005615 Bacteria 1720
73 Ga0068859_100352238 3300005617 Bacteria 1567
74 Ga0068859_101674211 3300005617 Unclassified 703
75 Ga0068864_100008418 3300005618 Bacteria 8511
76 Ga0068864_100060894 3300005618 Unclassified 3269
77 Ga0068864_100131388 3300005618 Bacteria 2249
78 Ga0068864_100177285 3300005618 Bacteria 1946
79 Ga0068870_10066160 3300005840 Bacteria 1957
80 Ga0068863_100035925 3300005841 Bacteria 4719
81 Ga0068863_100085541 3300005841 Bacteria 2988
82 Ga0068863_100461254 3300005841 Bacteria 1248
83 Ga0068863_100738456 3300005841 Unclassified 980
84 Ga0068858_100073632 3300005842 Bacteria 3170
85 Ga0068858_101483686 3300005842 Unclassified 669
86 Ga0068860_100172984 3300005843 Bacteria 2086
87 Ga0081538_10223237 3300005981 Bacteria 744
88 Ga0081539_10000065 3300005985 Bacteria 246571
89 Ga0081539_10000334 3300005985 Bacteria 104401
90 Ga0081539_10007351 3300005985 Bacteria 10086
91 Ga0070717_10289964 3300006028 Bacteria 1453
92 Ga0075432_10129660 3300006058 Unclassified 954
93 Ga0097621_100300451 3300006237 Unclassified 1418
94 Ga0097621_101030711 3300006237 Unclassified 770
95 Ga0068871_100052712 3300006358 Bacteria 3296
96 Ga0075428_100004190 3300006844 Bacteria 15877
97 Ga0075428_100021439 3300006844 Bacteria 7152
98 Ga0075428_100244630 3300006844 Bacteria 1935
99 Ga0075428_101529507 3300006844 Unclassified 699
100 Ga0075431_100009755 3300006847 Bacteria 9643
101 Ga0075433_10217796 3300006852 Bacteria 1696
102 Ga0075433_10219722 3300006852 Bacteria 1688
103 Ga0075433_10255154 3300006852 Bacteria 1555
104 Ga0075434_100244198 3300006871 Bacteria 1815
105 Ga0075434_100320490 3300006871 Bacteria 1571
106 Ga0075434_100484372 3300006871 Bacteria 1258
107 Ga0075434_101263745 3300006871 Bacteria 749
108 Ga0075429_100013267 3300006880 Bacteria 7146
109 Ga0075429_100383993 3300006880 Bacteria 1230
110 Ga0068865_100596831 3300006881 Bacteria 933
111 Ga0075436_100011973 3300006914 Bacteria 5949
112 Ga0075436_100026476 3300006914 Unclassified 3993
113 Ga0075436_100078694 3300006914 Bacteria 2284
114 Ga0075436_100124661 3300006914 Bacteria 1804
115 Ga0075436_100577871 3300006914 Bacteria 827
116 Ga0097620_100352244 3300006931 Bacteria 1567
117 Ga0097620_101674205 3300006931 Unclassified 703
118 Ga0075435_100020551 3300007076 Bacteria 5062
119 Ga0075435_100117426 3300007076 Unclassified 2217
120 Ga0075435_100492258 3300007076 Bacteria 1060
121 Ga0099794_10028034 3300007265 Bacteria 2616
122 Ga0105250_10301227 3300009092 Bacteria 693
123 Ga0105250_10305768 3300009092 Bacteria 688
124 Ga0105240_10108976 3300009093 Bacteria 3354
125 Ga0111539_10000924 3300009094 Bacteria 38393
126 Ga0111539_10007580 3300009094 Bacteria 13867
127 Ga0111539_10086544 3300009094 Bacteria 3683
128 Ga0111539_10090793 3300009094 Bacteria 3590
129 Ga0111539_10507049 3300009094 Bacteria 1405
130 Ga0114129_10026250 3300009147 Bacteria 8250
131 Ga0114129_10035145 3300009147 Bacteria 7081
132 Ga0114129_10082427 3300009147 Bacteria 4469
133 Ga0114129_10120131 3300009147 Bacteria 3619
134 Ga0114129_10127830 3300009147 Bacteria 3493
135 Ga0114129_10376380 3300009147 Unclassified 1876
136 Ga0114129_10417119 3300009147 Bacteria 1766
137 Ga0114129_10536603 3300009147 Bacteria 1523
138 Ga0114129_10668140 3300009147 Bacteria 1339
139 Ga0114129_10797297 3300009147 Bacteria 1205
140 Ga0114129_11950549 3300009147 Bacteria 711
141 Ga0105243_10072117 3300009148 Bacteria 2794
142 Ga0105243_10307115 3300009148 Bacteria 1440
143 Ga0105243_10664607 3300009148 Bacteria 1011
144 Ga0105243_10980071 3300009148 Unclassified 846
145 Ga0105242_10199455 3300009176 Bacteria 1777
146 Ga0105248_10009386 3300009177 Bacteria 10771
147 Ga0105248_10118667 3300009177 Bacteria 2984
148 Ga0105238_10203137 3300009551 Bacteria 1958
149 Ga0105238_11717896 3300009551 Bacteria 659
150 Ga0105249_10014413 3300009553 Bacteria 6988
151 Ga0105249_10360956 3300009553 Unclassified 1474
152 Ga0105249_10735621 3300009553 Bacteria 1048
153 Ga0105249_11211176 3300009553 Bacteria 826
154 Ga0099796_10116649 3300010159 Unclassified 1022
155 Ga0105239_12064051 3300010375 Unclassified 662
156 Ga0157374_11401785 3300013296 Unclassified 722
157 Ga0163162_10033002 3300013306 Bacteria 5142
158 Ga0163162_10200625 3300013306 Bacteria 2123
159 Ga0163162_12288352 3300013306 Unclassified 621
160 Ga0157375_10010218 3300013308 Bacteria 8258
161 Ga0157375_10159832 3300013308 Bacteria 2394
162 Ga0163163_10009517 3300014325 Bacteria 8679
163 Ga0157380_10015332 3300014326 Bacteria 5632
164 Ga0157380_10023025 3300014326 Bacteria 4697
165 Ga0157380_10043105 3300014326 Bacteria 3531
166 Ga0157380_10404245 3300014326 Bacteria 1297
167 Ga0157380_10604466 3300014326 Bacteria 1086
168 Ga0157380_10628816 3300014326 Bacteria 1067
169 Ga0157377_10199551 3300014745 Unclassified 1269
170 Ga0157376_10219724 3300014969 Unclassified 1759
171 Ga0157376_10235153 3300014969 Bacteria 1704
172 Ga0207697_10037996 3300025315 Bacteria 1974
173 Ga0207680_10200246 3300025903 Unclassified 1360
174 Ga0207643_10093079 3300025908 Bacteria 1759
175 Ga0207643_10408458 3300025908 Bacteria 859
176 Ga0207684_10285750 3300025910 Bacteria 1422
177 Ga0207684_10741008 3300025910 Unclassified 833
178 Ga0207695_10922136 3300025913 Unclassified 753
179 Ga0207660_10200144 3300025917 Bacteria 1560
180 Ga0207662_10001891 3300025918 Bacteria 10320
181 Ga0207662_10101863 3300025918 Bacteria 1780
182 Ga0207649_10406006 3300025920 Bacteria 1020
183 Ga0207646_10342531 3300025922 Bacteria 1351
184 Ga0207681_10032246 3300025923 Unclassified 3429
185 Ga0207681_10525147 3300025923 Unclassified 972
186 Ga0207650_10006018 3300025925 Bacteria 8276
187 Ga0207650_10951565 3300025925 Unclassified 730
188 Ga0207659_10003268 3300025926 Bacteria 9713
189 Ga0207659_10128458 3300025926 Bacteria 1952
190 Ga0207644_10264980 3300025931 Bacteria 1375
191 Ga0207706_10070697 3300025933 Bacteria 3070
192 Ga0207706_10792731 3300025933 Unclassified 805
193 Ga0207709_10043969 3300025935 Bacteria 2696
194 Ga0207669_10062780 3300025937 Unclassified 2290
195 Ga0207665_10564005 3300025939 Unclassified 886
196 Ga0207691_10048822 3300025940 Unclassified 3879
197 Ga0207711_10005344 3300025941 Bacteria 10890
198 Ga0207711_10454205 3300025941 Bacteria 1193
199 Ga0207711_10949956 3300025941 Unclassified 798
200 Ga0207679_10013579 3300025945 Bacteria 5338
201 Ga0207667_10410181 3300025949 Bacteria 1379
202 Ga0207651_11053301 3300025960 Unclassified 728
203 Ga0207658_10227198 3300025986 Unclassified 1573
204 Ga0207677_10096565 3300026023 Bacteria 2162
205 Ga0207703_10476924 3300026035 Unclassified 1168
206 Ga0207703_10876355 3300026035 Unclassified 859
207 Ga0207703_11042345 3300026035 Bacteria 785
208 Ga0207678_10469514 3300026067 Bacteria 1095
209 Ga0207708_10061828 3300026075 Bacteria 2860
210 Ga0207708_10324654 3300026075 Unclassified 1257
211 Ga0207641_10006715 3300026088 Bacteria 9640
212 Ga0207641_10103880 3300026088 Bacteria 2507
213 Ga0207641_10610897 3300026088 Unclassified 1068
214 Ga0207676_10026777 3300026095 Unclassified 4289
215 Ga0207676_10040701 3300026095 Bacteria 3562
216 Ga0207676_10061606 3300026095 Bacteria 2971
217 Ga0207676_10284223 3300026095 Bacteria 1503
218 Ga0207675_100107801 3300026118 Bacteria 2627
219 Ga0207675_100202064 3300026118 Bacteria 1909
220 Ga0207683_10058163 3300026121 Bacteria 3394
221 Ga0209968_1049129 3300027526 Unclassified 731
222 Ga0207428_10008831 3300027907 Bacteria 9085
223 Ga0207428_10044374 3300027907 Bacteria 3587
224 Ga0207428_10054740 3300027907 Bacteria 3176
225 Ga0207428_10226438 3300027907 Bacteria 1400
226 Ga0268266_10203581 3300028379 Bacteria 1812
227 Ga0268265_10774572 3300028380 Unclassified 933
228 Ga0268264_10165926 3300028381 Bacteria 1993
229 Ga0307416_100868659 3300032002 Bacteria 1001
230 Ga0307416_101241660 3300032002 Unclassified 851
231 Ga0307414_10267923 3300032004 Bacteria 1429
232 Ga0373950_0000687 3300034818 Bacteria 4182
233 Ga0373959_0004978 3300034820 Bacteria 2167
234 Ga0373928_0025394 3300035084 Unclassified 1277
235 Ga0373929_0001193 3300035085 Bacteria 5031
236 Ga0373940_0002515 3300035088 Bacteria 3582
237 Ga0373949_0000466 3300035090 Bacteria 13893
238 Ga0373951_0000525 3300035091 Bacteria 10791
239 Ga0373932_0000438 3300035112 Bacteria 12733
240 Ga0373941_0194523 3300035115 Bacteria 768
241 Ga0373960_0000336 3300035121 Bacteria 8991
242 Ga0373942_0001715 3300035207 Bacteria 5567
243 Ga0373961_0000566 3300035241 Bacteria 13958
244 Ga0373962_0003039 3300035242 Unclassified 4019
245 Ga0373962_0020598 3300035242 Bacteria 1733
246 Ga0373931_0000500 3300035691 Bacteria 15976
247 Ga0373931_0249779 3300035691 Bacteria 1078
248 Ga0373937_0719501 3300036401 Bacteria 945
249 Ga0439453_0018793 3300041408 Bacteria 1225
250 Ga0451853_2726457 3300041512 Unclassified 2277
251 Ga0450923_115679 3300042125 Bacteria 629
252 Ga0439435_0006451 3300042436 Bacteria 2638
253 Ga0439444_0036535 3300042437 Unclassified 947
254 Ga0453683_0293265 3300044673 Bacteria 1040
255 Ga0451576_0002824 3300045051 Bacteria 24981
256 Ga0495580_0365024 3300046472 Bacteria 977
257 Ga0495584_0032491 3300046491 Bacteria 2641
258 Ga0495584_0077368 3300046491 Unclassified 1673
259 Ga0495598_0018116 3300046537 Bacteria 1826
260 Ga0495598_0036359 3300046537 Unclassified 1415
261 Ga0495621_0021448 3300046539 Bacteria 2129
262 Ga0495621_0079619 3300046539 Bacteria 1220
263 Ga0495621_0109598 3300046539 Unclassified 1057
264 Ga0495621_0128758 3300046539 Unclassified 983
265 Ga0495633_0246196 3300046558 Unclassified 816
266 Ga0495635_0426081 3300046663 Unclassified 879
267 Ga0495659_0025553 3300046664 Bacteria 2022
268 Ga0495659_0110427 3300046664 Bacteria 1073
269 Ga0495658_0059508 3300046683 Bacteria 2188
270 Ga0495669_0072500 3300046684 Bacteria 1572
271 Ga0495670_0036049 3300046691 Bacteria 2464
272 Ga0495670_0242501 3300046691 Bacteria 960
273 Ga0495671_0171812 3300046692 Unclassified 1054
274 Ga0495636_0020415 3300047318 Bacteria 2670
275 Ga0495636_0157518 3300047318 Unclassified 1022
276 Ga0495636_0184484 3300047318 Unclassified 948
277 Ga0495685_028779 3300047447 Unclassified 1911
278 Ga0496107_0581302 3300048910 Unclassified 829
279 Ga0496107_0757831 3300048910 Unclassified 712
280 Ga0496108_0033414 3300048911 Bacteria 4274
281 Ga0496109_0320796 3300048912 Unclassified 1462
282 Ga0496110_0296957 3300048913 Bacteria 1472
283 Ga0496110_1084865 3300048913 Unclassified 709
284 Ga0496112_0068774 3300048915 Bacteria 3497
285 Ga0496113_0160875 3300048916 Bacteria 1775
286 Ga0496113_0590170 3300048916 Unclassified 890
287 Ga0501041_0213926 3300049577 Bacteria 1209
288 Ga0501069_0092658 3300049585 Bacteria 1709
289 Ga0501075_0323703 3300049591 Bacteria 1175
290 Ga0501076_0110060 3300049592 Bacteria 2227
291 Ga0501076_0732475 3300049592 Unclassified 816
292 Ga0501076_0742253 3300049592 Bacteria 810
293 Ga0501274_008797 3300049771 Bacteria 911
294 Ga0501045_0237879 3300049824 Bacteria 1356
295 nmdc:mga05p37_132616_c1 3300050507 Bacteria 3056
296 nmdc:mga05p37_140170_c1 3300050507 Bacteria 2963
297 nmdc:mga05p37_1665491_c1 3300050507 Unclassified 624
298 nmdc:mga05p37_17163_c1 3300050507 Bacteria 8733
299 nmdc:mga05p37_217823_c1 3300050507 Bacteria 2305
300 nmdc:mga05p37_331143_c1 3300050507 Bacteria 1799
301 nmdc:mga05p37_42595_c1 3300050507 Bacteria 5579
302 nmdc:mga05p37_57480_c1 3300050507 Bacteria 4791
303 nmdc:mga05p37_615311_c1 3300050507 Unclassified 1223
304 nmdc:mga05p37_645662_c1 3300050507 Bacteria 1186
305 nmdc:mga05p37_6729_c1 3300050507 Bacteria 13548
306 nmdc:mga05p37_782589_c1 3300050507 Bacteria 1047
307 nmdc:mga05p37_962961_c1 3300050507 Bacteria 912
308 nmdc:mga09592_183786_c1 3300050508 Bacteria 1809
309 nmdc:mga09592_278048_c1 3300050508 Unclassified 1452
310 nmdc:mga09592_86410_c1 3300050508 Bacteria 2676
311 nmdc:mga06r32_1549012_c1 3300050510 Bacteria 602
312 nmdc:mga06r32_91913_c1 3300050510 Bacteria 2966
313 nmdc:mga08y16_103773_c1 3300050511 Bacteria 2960
314 nmdc:mga08y16_109245_c1 3300050511 Bacteria 2880
315 nmdc:mga08y16_21192_c1 3300050511 Bacteria 6863
316 nmdc:mga08y16_642800_c1 3300050511 Bacteria 1066
317 nmdc:mga08y16_843340_c1 3300050511 Unclassified 906
318 nmdc:mga08y16_9199_c1 3300050511 Bacteria 10368
319 nmdc:mga0n895_13338_c1 3300050512 Bacteria 7410
320 nmdc:mga0n895_147127_c1 3300050512 Bacteria 2386
321 nmdc:mga0n895_203239_c1 3300050512 Bacteria 2012
322 nmdc:mga0n895_275394_c1 3300050512 Bacteria 1707
323 nmdc:mga0n895_278347_c1 3300050512 Bacteria 1697
324 nmdc:mga0n895_69_c1 3300050512 Bacteria 59717
325 nmdc:mga0n895_70008_c1 3300050512 Bacteria 3476
326 nmdc:mga0rr50_266_c1 3300050513 Bacteria 28365
327 nmdc:mga0rr50_27459_c1 3300050513 Bacteria 3986
328 nmdc:mga0rr50_349683_c1 3300050513 Bacteria 1243
329 nmdc:mga08x19_1136_c1 3300050514 Bacteria 16609
330 nmdc:mga08x19_30032_c1 3300050514 Unclassified 3412
331 nmdc:mga08x19_468398_c1 3300050514 Unclassified 888
332 nmdc:mga08x19_51109_c1 3300050514 Bacteria 2654
333 nmdc:mga08x19_63139_c1 3300050514 Unclassified 2403
334 nmdc:mga0a205_33098_c1 3300050515 Bacteria 4958
335 nmdc:mga0a205_48643_c1 3300050515 Bacteria 4093
336 nmdc:mga0a205_52521_c1 3300050515 Bacteria 3933
337 JGI25406J46586_10004999
338 JGI25406J46586_10000355
339 JGI25406J46586_10044973
340 Ga0058858_1399074
341 Ga0058859_10019606
342 Ga0065712_10028245
343 Ga0065712_10330905
344 Ga0065707_10012071
345 Ga0065707_10411787
346 Ga0065707_10719205
347 Ga0070676_10180623
348 Ga0070676_10231084
349 Ga0070690_100033292
350 Ga0070670_100007839
351 Ga0070670_101009571
352 Ga0070670_101081188
353 Ga0070666_10025587
354 Ga0070680_100154858
355 Ga0070689_100069698
356 Ga0070691_10029023
357 Ga0070691_10317431
358 Ga0070661_100084595
359 Ga0070692_10021651
360 Ga0070669_100034954
361 Ga0070669_100351400
362 Ga0070675_100616618
363 Ga0070675_100808505
364 Ga0070671_100026507
365 Ga0070671_100033416
366 Ga0070671_100111355
367 Ga0070674_100928794
368 Ga0070674_101395641
369 Ga0070688_101084082
370 Ga0070659_100580842
371 Ga0070667_100245545
372 Ga0070667_100476134
373 Ga0070701_10078062
374 Ga0070701_10347250
375 Ga0070705_100001491
376 Ga0070700_100053229
377 Ga0070694_100000534
378 Ga0070694_100306215
379 Ga0070694_100740827
380 Ga0070708_100112332
381 Ga0070678_100065883
382 Ga0070662_100224375
383 Ga0070662_100824891
384 Ga0068867_101639321
385 Ga0070706_100371435
386 Ga0070706_100439993
387 Ga0070707_100475060
388 Ga0070698_100042843
389 Ga0070698_100160165
390 Ga0070698_100178087
391 Ga0070698_100273129
392 Ga0070699_100091537
393 Ga0070699_100106721
394 Ga0070699_100200029
395 Ga0070699_100506909
396 Ga0070697_100943997
397 Ga0070672_100039512
398 Ga0070695_100006202
399 Ga0070695_100408131
400 Ga0070696_100000561
401 Ga0070696_100046346
402 Ga0070696_100335245
403 Ga0070696_100447186
404 Ga0070704_100197194
405 Ga0070704_100563499
406 Ga0068855_100274982
407 Ga0070664_100017820
408 Ga0070702_100107952
409 Ga0068859_100352238
410 Ga0068859_101674211
411 Ga0068864_100008418
412 Ga0068864_100060894
413 Ga0068864_100131388
414 Ga0068864_100177285
415 Ga0068870_10066160
416 Ga0068863_100035925
417 Ga0068863_100085541
418 Ga0068863_100461254
419 Ga0068863_100738456
420 Ga0068858_100073632
421 Ga0068858_101483686
422 Ga0068860_100172984
423 Ga0081538_10223237
424 Ga0081539_10000065
425 Ga0081539_10000334
426 Ga0081539_10007351
427 Ga0070717_10289964
428 Ga0075432_10129660
429 Ga0097621_100300451
430 Ga0097621_101030711
431 Ga0068871_100052712
432 Ga0075428_100004190
433 Ga0075428_100021439
434 Ga0075428_100244630
435 Ga0075428_101529507
436 Ga0075431_100009755
437 Ga0075433_10217796
438 Ga0075433_10219722
439 Ga0075433_10255154
440 Ga0075434_100244198
441 Ga0075434_100320490
442 Ga0075434_100484372
443 Ga0075434_101263745
444 Ga0075429_100013267
445 Ga0075429_100383993
446 Ga0068865_100596831
447 Ga0075436_100011973
448 Ga0075436_100026476
449 Ga0075436_100078694
450 Ga0075436_100124661
451 Ga0075436_100577871
452 Ga0097620_100352244
453 Ga0097620_101674205
454 Ga0075435_100020551
455 Ga0075435_100117426
456 Ga0075435_100492258
457 Ga0099794_10028034
458 Ga0105250_10301227
459 Ga0105250_10305768
460 Ga0105240_10108976
461 Ga0111539_10000924
462 Ga0111539_10007580
463 Ga0111539_10086544
464 Ga0111539_10090793
465 Ga0111539_10507049
466 Ga0114129_10026250
467 Ga0114129_10035145
468 Ga0114129_10082427
469 Ga0114129_10120131
470 Ga0114129_10127830
471 Ga0114129_10376380
472 Ga0114129_10417119
473 Ga0114129_10536603
474 Ga0114129_10668140
475 Ga0114129_10797297
476 Ga0114129_11950549
477 Ga0105243_10072117
478 Ga0105243_10307115
479 Ga0105243_10664607
480 Ga0105243_10980071
481 Ga0105242_10199455
482 Ga0105248_10009386
483 Ga0105248_10118667
484 Ga0105238_10203137
485 Ga0105238_11717896
486 Ga0105249_10014413
487 Ga0105249_10360956
488 Ga0105249_10735621
489 Ga0105249_11211176
490 Ga0099796_10116649
491 Ga0105239_12064051
492 Ga0157374_11401785
493 Ga0163162_10033002
494 Ga0163162_10200625
495 Ga0163162_12288352
496 Ga0157375_10010218
497 Ga0157375_10159832
498 Ga0163163_10009517
499 Ga0157380_10015332
500 Ga0157380_10023025
501 Ga0157380_10043105
502 Ga0157380_10404245
503 Ga0157380_10604466
504 Ga0157380_10628816
505 Ga0157377_10199551
506 Ga0157376_10219724
507 Ga0157376_10235153
508 Ga0207697_10037996
509 Ga0207680_10200246
510 Ga0207643_10093079
511 Ga0207643_10408458
512 Ga0207684_10285750
513 Ga0207684_10741008
514 Ga0207695_10922136
515 Ga0207660_10200144
516 Ga0207662_10001891
517 Ga0207662_10101863
518 Ga0207649_10406006
519 Ga0207646_10342531
520 Ga0207681_10032246
521 Ga0207681_10525147
522 Ga0207650_10006018
523 Ga0207650_10951565
524 Ga0207659_10003268
525 Ga0207659_10128458
526 Ga0207644_10264980
527 Ga0207706_10070697
528 Ga0207706_10792731
529 Ga0207709_10043969
530 Ga0207669_10062780
531 Ga0207665_10564005
532 Ga0207691_10048822
533 Ga0207711_10005344
534 Ga0207711_10454205
535 Ga0207711_10949956
536 Ga0207679_10013579
537 Ga0207667_10410181
538 Ga0207651_11053301
539 Ga0207658_10227198
540 Ga0207677_10096565
541 Ga0207703_10476924
542 Ga0207703_10876355
543 Ga0207703_11042345
544 Ga0207678_10469514
545 Ga0207708_10061828
546 Ga0207708_10324654
547 Ga0207641_10006715
548 Ga0207641_10103880
549 Ga0207641_10610897
550 Ga0207676_10026777
551 Ga0207676_10040701
552 Ga0207676_10061606
553 Ga0207676_10284223
554 Ga0207675_100107801
555 Ga0207675_100202064
556 Ga0207683_10058163
557 Ga0209968_1049129
558 Ga0207428_10008831
559 Ga0207428_10044374
560 Ga0207428_10054740
561 Ga0207428_10226438
562 Ga0268266_10203581
563 Ga0268265_10774572
564 Ga0268264_10165926
565 Ga0307416_100868659
566 Ga0307416_101241660
567 Ga0307414_10267923
568 Ga0373950_0000687
569 Ga0373959_0004978
570 Ga0373928_0025394
571 Ga0373929_0001193
572 Ga0373940_0002515
573 Ga0373949_0000466
574 Ga0373951_0000525
575 Ga0373932_0000438
576 Ga0373941_0194523
577 Ga0373960_0000336
578 Ga0373942_0001715
579 Ga0373961_0000566
580 Ga0373962_0003039
581 Ga0373962_0020598
582 Ga0373931_0000500
583 Ga0373931_0249779
584 Ga0373937_0719501
585 Ga0439453_0018793
586 Ga0451853_2726457
587 Ga0450923_115679
588 Ga0439435_0006451
589 Ga0439444_0036535
590 Ga0453683_0293265
591 Ga0451576_0002824
592 Ga0495580_0365024
593 Ga0495584_0032491
594 Ga0495584_0077368
595 Ga0495598_0018116
596 Ga0495598_0036359
597 Ga0495621_0021448
598 Ga0495621_0079619
599 Ga0495621_0109598
600 Ga0495621_0128758
601 Ga0495633_0246196
602 Ga0495635_0426081
603 Ga0495659_0025553
604 Ga0495659_0110427
605 Ga0495658_0059508
606 Ga0495669_0072500
607 Ga0495670_0036049
608 Ga0495670_0242501
609 Ga0495671_0171812
610 Ga0495636_0020415
611 Ga0495636_0157518
612 Ga0495636_0184484
613 Ga0495685_028779
614 Ga0496107_0581302
615 Ga0496107_0757831
616 Ga0496108_0033414
617 Ga0496109_0320796
618 Ga0496110_0296957
619 Ga0496110_1084865
620 Ga0496112_0068774
621 Ga0496113_0160875
622 Ga0496113_0590170
623 Ga0501041_0213926
624 Ga0501069_0092658
625 Ga0501075_0323703
626 Ga0501076_0110060
627 Ga0501076_0732475
628 Ga0501076_0742253
629 Ga0501274_008797
630 Ga0501045_0237879
631 nmdc:mga05p37_132616_c1
632 nmdc:mga05p37_140170_c1
633 nmdc:mga05p37_1665491_c1
634 nmdc:mga05p37_17163_c1
635 nmdc:mga05p37_217823_c1
636 nmdc:mga05p37_331143_c1
637 nmdc:mga05p37_42595_c1
638 nmdc:mga05p37_57480_c1
639 nmdc:mga05p37_615311_c1
640 nmdc:mga05p37_645662_c1
641 nmdc:mga05p37_6729_c1
642 nmdc:mga05p37_782589_c1
643 nmdc:mga05p37_962961_c1
644 nmdc:mga09592_183786_c1
645 nmdc:mga09592_278048_c1
646 nmdc:mga09592_86410_c1
647 nmdc:mga06r32_1549012_c1
648 nmdc:mga06r32_91913_c1
649 nmdc:mga08y16_103773_c1
650 nmdc:mga08y16_109245_c1
651 nmdc:mga08y16_21192_c1
652 nmdc:mga08y16_642800_c1
653 nmdc:mga08y16_843340_c1
654 nmdc:mga08y16_9199_c1
655 nmdc:mga0n895_13338_c1
656 nmdc:mga0n895_147127_c1
657 nmdc:mga0n895_203239_c1
658 nmdc:mga0n895_275394_c1
659 nmdc:mga0n895_278347_c1
660 nmdc:mga0n895_69_c1
661 nmdc:mga0n895_70008_c1
662 nmdc:mga0rr50_266_c1
663 nmdc:mga0rr50_27459_c1
664 nmdc:mga0rr50_349683_c1
665 nmdc:mga08x19_1136_c1
666 nmdc:mga08x19_30032_c1
667 nmdc:mga08x19_468398_c1
668 nmdc:mga08x19_51109_c1
669 nmdc:mga08x19_63139_c1
670 nmdc:mga0a205_33098_c1
671 nmdc:mga0a205_48643_c1
672 nmdc:mga0a205_52521_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00034

Cytochrom_C

Cytochrome c

65

153

0.8

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

63

149

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xts-assembly1.cif.gz_B crystal structure of the sulfane dehydrogenase soxcd from paracoccus pantotrophus 0.7288 28 179
5lo9-assembly1.cif.gz_B "thiosulfate dehydrogenase (tsdba) from marichromatium purpuratum - ""as isolated"" form" 0.6866 59 146
4wqb-assembly1.cif.gz_A thiosulfate dehydrogenase (tsda) from allochromatium vinosum - bisulfite soak 0.5904 59 149
4v2k-assembly1.cif.gz_A-2 crystal structure of the thiosulfate dehydrogenase tsda in complex with thiosulfate 0.5902 59 146
4wq7-assembly1.cif.gz_A "thiosulfate dehydrogenase (tsda) from allochromatium vinosum - ""as isolated"" form" 0.5807 60 149
ID Description Score Start End Superfamily
2xtsD01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7766 36 169 1.10.760.10
2xtsD01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7458 36 169 1.10.760.10
1hzvA01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.5567 62 146 1.10.760.10
1hj3A01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.5447 61 153 1.10.760.10
af_P54653_101_162_1.10.238.10 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.515 50 73 1.10.238.10
ID Description Score Start End GO Terms
AF-A0A2V8DP02-F1-model_v4 Cytochrome c domain-containing protein 0.9047 63 172 GO:0009055
GO:0020037
GO:0046872
AF-A0A2V8DP02-F1-model_v4 Cytochrome c domain-containing protein 0.8893 63 172 GO:0009055
GO:0020037
GO:0046872
AF-A0A2E8E3H5-F1-model_v4 Cytochrome c domain-containing protein 0.8636 48 181 GO:0009055
GO:0020037
GO:0046872
AF-A0A6N8LVX5-F1-model_v4 C-type cytochrome 0.8475 45 169 GO:0009055
GO:0020037
GO:0046872
AF-A0A3D5RS05-F1-model_v4 Cytochrome C 0.8371 105 178 GO:0009055
GO:0020037

Map