F412461

General Info

Members Datasets Scaffolds Average Seq Length
335 216 301 276

Family's Representative Sequence

Representative Sequence 3300053156|Ga0500622_0004002|Ga0500622_0004002_4376_5353
Length 325
Sequence MDTVAGMPKVSKAPAASRRIAEPSLATPLAIPSAAPVDRALVGVDFTSAPTTRKPIRLAFGRRQGSVLKLERQVGMTSLDAFESWLAEPGPWLGGFDLPFGLPRELIETLGWPTEWAPLIAHYASLSRAEIRDTFAAFCDARPVGGKFAHRACDGPAGSSPSMKWVNPPVAYMLHAGVPRLLRAGVDLPGLHAGDRSRIALEAYPGLLARELIGTRSYKSDDRAKQTPDRLIARKDVIEALEQGRSRLGLRLKLSHAQRDELADDGSGDKLDAVLCLMQAAWADARPDYGLPADLDPLEGWILCAPRTAPAASTLPTSRTRRMTT

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
3 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
4 2643221596 Acidovorax sp. Root70 Isolate Unclassified
5 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
6 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
7 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
8 2643221658 Variovorax sp. Root411 Isolate Unclassified
9 2643221660 Methylibium sp. Root1272 Isolate Unclassified
10 2643221672 Variovorax sp. Root434 Isolate Unclassified
11 2643221683 Variovorax sp. Root473 Isolate Unclassified
12 2738541277 Variovorax sp. GV051 Isolate Unclassified
13 2738541307 Variovorax sp. GV008 Isolate Unclassified
14 2738543019 Variovorax sp. GV040 Isolate Unclassified
15 2818991446 Variovorax sp. 1180 Isolate Unclassified
16 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
17 2831864461 Roseateles noduli HZ7 Isolate Nodule
18 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
19 2842733646 Variovorax sp. R-72446 Isolate Unclassified
20 2842747753 Variovorax sp. R-72060 Isolate Unclassified
21 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
22 2885198086 Variovorax sp. 679 Isolate Unclassified
23 2885211737 Variovorax sp. 553 Isolate Unclassified
24 2899924645 Variovorax sp. 369 Isolate Unclassified
25 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
26 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
27 2928037797 Variovorax sp. 1126 Isolate Unclassified
28 2928044640 Variovorax sp. 1128 Isolate Unclassified
29 2928051484 Variovorax sp. 1133 Isolate Unclassified
30 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
31 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
32 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
33 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
34 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
35 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
36 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
37 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
38 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
39 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
40 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
41 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
42 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
43 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
44 3300003504 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM Metagenome Rhizosphere
45 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
46 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
47 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
48 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
49 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
50 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
51 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
52 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
53 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
54 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
55 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
56 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
57 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
58 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
59 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
60 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
61 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
62 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
63 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
64 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
65 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
77 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
85 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
91 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
94 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
95 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
99 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
101 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
107 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
109 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
112 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
125 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
131 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
134 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
145 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
146 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
147 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
148 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
149 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
150 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
151 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
152 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
153 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
154 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
155 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
156 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
157 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
158 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
159 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
160 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
161 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
162 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
163 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
164 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
165 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
170 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
171 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
172 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
173 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
174 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
175 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
176 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
177 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
178 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
179 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
180 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
183 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
184 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
190 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
191 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
192 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
193 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
194 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
195 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
196 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
197 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
198 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
199 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
200 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
201 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
202 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
203 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
204 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
205 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
206 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
207 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
208 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
209 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
210 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
211 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
212 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
213 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
214 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
215 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
216 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.25
Metatranscriptomes 0.6
Isolates 10.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 39.7
Nodule 1.19
Rhizoplane 1.79
Rhizosphere 40.3
Stem 0
Stem Tuber 0
Unclassified 17.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1001945 3300002773 Bacteria 8224
2 JGI25152J39213_1002156 3300002773 Bacteria 7717
3 JGI25150J39212_1002677 3300002774 Bacteria 4345
4 JGI25159J45721_1001946 3300002987 Bacteria 8224
5 JGI25151J46595_10006122 3300003187 Bacteria 6105
6 JGI25151J46595_10018335 3300003187 Bacteria 3010
7 JGI25153J46596_10006229 3300003215 Bacteria 6105
8 rootH2_10019901 3300003320 Bacteria 2289
9 rootH1_10006141 3300003323 Bacteria 19182
10 rootH1_10013234 3300003323 Bacteria 4711
11 JGI25160J50197_1002666 3300003354 Bacteria 8224
12 JGI25160J50197_1006098 3300003354 Bacteria 4919
13 JGI25161J50226_1001766 3300003374 Bacteria 6101
14 JGI26138J51218_100586 3300003504 Bacteria 1402
15 Ga0006562J51391_1010057 3300003578 Bacteria 14357
16 Ga0006562J51391_1015350 3300003578 Bacteria 2480
17 Ga0055525_1000004 3300003759 Bacteria 888039
18 Ga0055527_1011649 3300003760 Bacteria 1004
19 Ga0055535_1000380 3300003761 Bacteria 42008
20 Ga0055542_1000062 3300003762 Bacteria 161494
21 Ga0055526_1002708 3300003771 Bacteria 11776
22 Ga0055526_1006802 3300003771 Bacteria 6105
23 Ga0055526_1006863 3300003771 Bacteria 6070
24 Ga0055537_1000550 3300003773 Bacteria 21428
25 Ga0055537_1002506 3300003773 Bacteria 6105
26 Ga0055537_1005807 3300003773 Bacteria 3238
27 Ga0055524_1000624 3300003775 Bacteria 25410
28 Ga0055524_1004870 3300003775 Bacteria 6105
29 Ga0055524_1004908 3300003775 Bacteria 6070
30 Ga0055524_1007033 3300003775 Bacteria 4832
31 Ga0055536_1004758 3300003781 Bacteria 6813
32 Ga0055536_1006164 3300003781 Bacteria 5666
33 Ga0055536_1014016 3300003781 Bacteria 2844
34 Ga0055534_1002628 3300003784 Bacteria 6105
35 Ga0055534_1002657 3300003784 Bacteria 6060
36 Ga0055528_1005215 3300003790 Bacteria 6105
37 Ga0055528_1012761 3300003790 Bacteria 3238
38 Ga0055530_10002499 3300003791 Bacteria 11772
39 Ga0055530_10002623 3300003791 Bacteria 11288
40 Ga0055530_10004408 3300003791 Bacteria 7255
41 Ga0055540_1003710 3300003792 Bacteria 7229
42 Ga0055540_1003828 3300003792 Bacteria 7076
43 Ga0055540_1004055 3300003792 Bacteria 6805
44 Ga0055540_1008094 3300003792 Bacteria 3839
45 Ga0055540_1024224 3300003792 Bacteria 1510
46 Ga0055531_10002552 3300003794 Bacteria 12116
47 Ga0055531_10002742 3300003794 Bacteria 11576
48 Ga0055531_10007057 3300003794 Bacteria 6215
49 Ga0055531_10007106 3300003794 Bacteria 6184
50 Ga0055543_1000989 3300004625 Bacteria 12816
51 Ga0055543_1001878 3300004625 Bacteria 7636
52 Ga0055543_1003616 3300004625 Bacteria 4471
53 Ga0065165_1000129 3300005262 Bacteria 129359
54 Ga0065165_1000344 3300005262 Bacteria 76165
55 Ga0065165_1004528 3300005262 Bacteria 8520
56 Ga0065165_1010737 3300005262 Bacteria 3913
57 Ga0070661_100011952 3300005344 Bacteria 6064
58 Ga0070661_100153249 3300005344 Bacteria 1743
59 Ga0070671_100012286 3300005355 Bacteria 6892
60 Ga0070659_100002665 3300005366 Bacteria 12692
61 Ga0070659_100047192 3300005366 Bacteria 3378
62 Ga0070663_100318151 3300005455 Bacteria 1251
63 Ga0070662_100004015 3300005457 Bacteria 9229
64 Ga0070662_100022288 3300005457 Bacteria 4334
65 Ga0070662_100117765 3300005457 Bacteria 2032
66 Ga0070662_100181353 3300005457 Bacteria 1660
67 Ga0068853_100190433 3300005539 Bacteria 1863
68 Ga0068855_100226216 3300005563 Bacteria 2096
69 Ga0070664_100042036 3300005564 Bacteria 3859
70 Ga0068864_100286979 3300005618 Bacteria 1537
71 Ga0068851_10030593 3300005834 Bacteria 2670
72 Ga0068860_100050041 3300005843 Bacteria 3979
73 Ga0075432_10002702 3300006058 Bacteria 5931
74 Ga0075369_10017183 3300006186 Bacteria 2929
75 Ga0075366_10032956 3300006195 Bacteria 3051
76 Ga0075366_10305800 3300006195 Bacteria 973
77 Ga0075370_10005920 3300006353 Bacteria 6117
78 Ga0075370_10016644 3300006353 Bacteria 3958
79 Ga0099823_1000038 3300006944 Bacteria 61505
80 Ga0105244_10003426 3300009036 Bacteria 11307
81 Ga0105240_10082717 3300009093 Bacteria 3942
82 Ga0105240_10581509 3300009093 Bacteria 1235
83 Ga0105245_10359532 3300009098 Bacteria 1445
84 Ga0105243_10004593 3300009148 Bacteria 10885
85 Ga0105243_10004693 3300009148 Bacteria 10757
86 Ga0105243_10028330 3300009148 Bacteria 4299
87 Ga0105248_10001747 3300009177 Bacteria 24182
88 Ga0105238_10092567 3300009551 Bacteria 3011
89 Ga0105239_10643745 3300010375 Bacteria 1210
90 Ga0157317_1000239 3300012475 Bacteria 2026
91 Ga0157319_1000003 3300012497 Bacteria 397199
92 Ga0157371_10008532 3300013102 Bacteria 8157
93 Ga0157371_10308459 3300013102 Bacteria 1146
94 Ga0157380_10415613 3300014326 Bacteria 1281
95 Ga0182008_10001756 3300014497 Bacteria 14210
96 Ga0182008_10136744 3300014497 Bacteria 1224
97 Ga0157379_10065073 3300014968 Bacteria 3259
98 Ga0182006_1000705 3300015261 Bacteria 23167
99 Ga0182006_1033676 3300015261 Bacteria 2053
100 Ga0182007_10000957 3300015262 Bacteria 15855
101 Ga0163161_10042530 3300017792 Bacteria 3268
102 Ga0213872_10001026 3300021361 Bacteria 19491
103 Ga0209436_110461 3300025208 Bacteria 1696
104 Ga0209672_101806 3300025228 Bacteria 6543
105 Ga0209563_100013 3300025230 Bacteria 941463
106 Ga0209258_100154 3300025242 Bacteria 158235
107 Ga0207425_1001372 3300025245 Bacteria 10313
108 Ga0207425_1011150 3300025245 Bacteria 2155
109 Ga0209148_1000145 3300025254 Bacteria 161352
110 Ga0209129_1000054 3300025258 Bacteria 261997
111 Ga0209129_1004503 3300025258 Bacteria 5405
112 Ga0209565_1000185 3300025263 Bacteria 76451
113 Ga0209565_1001534 3300025263 Bacteria 9949
114 Ga0209673_1000172 3300025273 Bacteria 133472
115 Ga0209673_1003839 3300025273 Bacteria 8491
116 Ga0209673_1004159 3300025273 Bacteria 7912
117 Ga0209673_1009381 3300025273 Bacteria 4246
118 Ga0209130_1001009 3300025284 Bacteria 21838
119 Ga0209130_1001241 3300025284 Bacteria 17909
120 Ga0209675_1001255 3300025291 Bacteria 15212
121 Ga0209675_1004900 3300025291 Bacteria 5779
122 Ga0209676_1000103 3300025292 Bacteria 226908
123 Ga0209676_1003243 3300025292 Bacteria 10256
124 Ga0209676_1004667 3300025292 Bacteria 7524
125 Ga0209676_1004823 3300025292 Bacteria 7323
126 Ga0209025_1000310 3300025294 Bacteria 108186
127 Ga0209025_1000474 3300025294 Bacteria 78060
128 Ga0209025_1010766 3300025294 Bacteria 6146
129 Ga0209564_1000003 3300025295 Bacteria 1585848
130 Ga0209564_1000241 3300025295 Bacteria 118237
131 Ga0209564_1001015 3300025295 Bacteria 34625
132 Ga0209758_1000034 3300025297 Bacteria 467637
133 Ga0209758_1009936 3300025297 Bacteria 5798
134 Ga0209050_1000012 3300025298 Bacteria 813717
135 Ga0209050_1000143 3300025298 Bacteria 171806
136 Ga0209050_1000294 3300025298 Bacteria 105705
137 Ga0209050_1002640 3300025298 Bacteria 14708
138 Ga0209256_1000103 3300025299 Bacteria 193900
139 Ga0209256_1000150 3300025299 Bacteria 146086
140 Ga0209256_1000165 3300025299 Bacteria 135104
141 Ga0209256_1000521 3300025299 Bacteria 56291
142 Ga0207426_1000058 3300025302 Bacteria 363857
143 Ga0207426_1000067 3300025302 Bacteria 342108
144 Ga0209051_1000019 3300025303 Bacteria 511268
145 Ga0209051_1000876 3300025303 Bacteria 30404
146 Ga0209051_1001048 3300025303 Bacteria 26073
147 Ga0209051_1003164 3300025303 Bacteria 11037
148 Ga0209051_1010246 3300025303 Bacteria 4756
149 Ga0209257_1000024 3300025304 Bacteria 726068
150 Ga0209257_1000057 3300025304 Bacteria 396985
151 Ga0209257_1000803 3300025304 Bacteria 45706
152 Ga0209257_1002264 3300025304 Bacteria 19650
153 Ga0209257_1003704 3300025304 Bacteria 12716
154 Ga0207656_10006718 3300025321 Bacteria 4156
155 Ga0207655_1005464 3300025728 Bacteria 8630
156 Ga0207649_10015753 3300025920 Bacteria 4249
157 Ga0207649_10215074 3300025920 Bacteria 1366
158 Ga0207694_10064045 3300025924 Bacteria 2865
159 Ga0207690_10006208 3300025932 Bacteria 7076
160 Ga0207690_10152027 3300025932 Bacteria 1717
161 Ga0207706_10001637 3300025933 Bacteria 22174
162 Ga0207706_10005566 3300025933 Bacteria 11745
163 Ga0207706_10151346 3300025933 Bacteria 2041
164 Ga0207706_10162136 3300025933 Bacteria 1965
165 Ga0207709_10000215 3300025935 Bacteria 73474
166 Ga0207709_10001162 3300025935 Bacteria 19142
167 Ga0207679_10005996 3300025945 Bacteria 7643
168 Ga0207679_10304672 3300025945 Bacteria 1374
169 Ga0207639_10237550 3300026041 Bacteria 1583
170 Ga0207648_10056883 3300026089 Bacteria 3413
171 Ga0209389_1008572 3300027296 Bacteria 9108
172 Ga0209968_1005144 3300027526 Bacteria 1962
173 Ga0209970_1000655 3300027614 Bacteria 6006
174 Ga0209971_1009480 3300027682 Bacteria 2306
175 Ga0209966_1000628 3300027695 Bacteria 8059
176 Ga0209974_10012638 3300027876 Bacteria 2821
177 Ga0316177_1118953 3300030731 Bacteria 1612
178 Ga0307513_10080341 3300031456 Bacteria 3364
179 Ga0307408_100042947 3300031548 Bacteria 3214
180 Ga0307514_10000762 3300031649 Bacteria 53648
181 Ga0307516_10004908 3300031730 Bacteria 16269
182 Ga0307516_10159272 3300031730 Bacteria 2009
183 Ga0307405_10004410 3300031731 Bacteria 6651
184 Ga0307416_100026022 3300032002 Bacteria 4304
185 Ga0307416_100308154 3300032002 Bacteria 1578
186 Ga0307411_10105026 3300032005 Bacteria 2007
187 Ga0307510_10267844 3300033180 Bacteria 1186
188 Ga0395899_0157334 3300037312 Bacteria 1607
189 Ga0395900_0000050 3300037418 Bacteria 224616
190 Ga0395898_0002499 3300037466 Bacteria 21625
191 Ga0395905_0006888 3300037471 Bacteria 11365
192 Ga0395905_0043157 3300037471 Bacteria 4231
193 Ga0395901_0134250 3300038443 Bacteria 2601
194 Ga0436361_0794259 3300039447 Bacteria 17377
195 Ga0439436_0000671 3300041404 Bacteria 9170
196 Ga0439465_0081579 3300041413 Bacteria 1097
197 Ga0451791_0466228 3300041451 Bacteria 1692
198 Ga0451791_1551273 3300041451 Bacteria 1123
199 Ga0439431_0008312 3300041997 Bacteria 2331
200 Ga0439449_0030165 3300042007 Bacteria 2021
201 Ga0439449_0045622 3300042007 Bacteria 1624
202 Ga0439455_0011227 3300042012 Bacteria 1985
203 Ga0439457_007441 3300042014 Bacteria 2627
204 Ga0439462_0054895 3300042015 Bacteria 1074
205 Ga0450898_008262 3300042134 Bacteria 1638
206 Ga0439459_0000312 3300042438 Bacteria 5886
207 Ga0451577_0000190 3300042876 Bacteria 130692
208 Ga0451577_0000895 3300042876 Bacteria 44166
209 Ga0451577_0205743 3300042876 Bacteria 1777
210 Ga0466969_0000093 3300044656 Bacteria 46242
211 Ga0466969_0059691 3300044656 Bacteria 1854
212 Ga0466972_0006276 3300044658 Bacteria 5970
213 Ga0466965_0062364 3300044683 Bacteria 1865
214 Ga0466965_0130661 3300044683 Bacteria 1302
215 Ga0466966_0115121 3300044684 Bacteria 1655
216 Ga0466961_0002099 3300044693 Bacteria 12406
217 Ga0466961_0105711 3300044693 Bacteria 1772
218 Ga0466963_0009172 3300044694 Bacteria 5950
219 Ga0466963_0084776 3300044694 Bacteria 2150
220 Ga0466964_0011526 3300044706 Bacteria 3341
221 Ga0466964_0104203 3300044706 Bacteria 1255
222 Ga0453684_0000618 3300044712 Bacteria 129995
223 Ga0453684_0271851 3300044712 Bacteria 1936
224 Ga0466970_0009375 3300044765 Bacteria 4947
225 Ga0466970_0028479 3300044765 Bacteria 2935
226 Ga0466957_0067060 3300044842 Bacteria 2213
227 Ga0466959_0000027 3300045049 Bacteria 114262
228 Ga0466959_0115169 3300045049 Bacteria 1915
229 Ga0451576_0001628 3300045051 Bacteria 37621
230 Ga0451576_0006575 3300045051 Bacteria 14219
231 Ga0466967_0006228 3300045976 Bacteria 8412
232 Ga0495627_005576 3300046453 Bacteria 5043
233 Ga0495590_0030475 3300046457 Bacteria 1890
234 Ga0495638_0036626 3300046460 Bacteria 3124
235 Ga0495650_0030577 3300046471 Bacteria 2437
236 Ga0495605_0041655 3300046474 Bacteria 2287
237 Ga0495610_0101098 3300046512 Bacteria 1291
238 Ga0495616_0002528 3300046513 Bacteria 12090
239 Ga0495620_0020644 3300046515 Bacteria 3215
240 Ga0495631_0000553 3300046518 Bacteria 25076
241 Ga0495654_0008030 3300046530 Bacteria 5857
242 Ga0495625_0121423 3300046660 Bacteria 1777
243 Ga0495635_0287633 3300046663 Bacteria 1103
244 Ga0495658_0048933 3300046683 Bacteria 2386
245 Ga0495670_0022068 3300046691 Bacteria 3143
246 Ga0495687_013635 3300047443 Bacteria 4226
247 Ga0495593_0059313 3300047673 Bacteria 2005
248 Ga0496105_0419655 3300048908 Bacteria 1059
249 Ga0496111_0190672 3300048914 Bacteria 1524
250 Ga0496112_0007636 3300048915 Bacteria 9615
251 Ga0496113_0003190 3300048916 Bacteria 9771
252 Ga0496116_0015944 3300048919 Bacteria 5909
253 Ga0496117_0021939 3300048920 Bacteria 5140
254 Ga0496117_0023639 3300048920 Bacteria 4889
255 Ga0496118_0005839 3300048921 Bacteria 13800
256 Ga0496118_0096684 3300048921 Bacteria 2012
257 Ga0496118_0098633 3300048921 Bacteria 1983
258 Ga0496121_0016431 3300048924 Bacteria 7645
259 Ga0496121_0066885 3300048924 Bacteria 2915
260 Ga0496122_0000204 3300048925 Bacteria 132123
261 Ga0496122_0073005 3300048925 Bacteria 2436
262 Ga0496122_0170585 3300048925 Bacteria 1312
263 Ga0496123_0001226 3300048926 Bacteria 37377
264 Ga0496123_0048326 3300048926 Bacteria 2863
265 Ga0496123_0059852 3300048926 Bacteria 2459
266 Ga0496123_0174333 3300048926 Bacteria 1131
267 Ga0496124_0000138 3300048927 Bacteria 150311
268 Ga0496124_0008218 3300048927 Bacteria 10946
269 Ga0496124_0011865 3300048927 Bacteria 8676
270 Ga0496124_0031874 3300048927 Bacteria 4661
271 Ga0496125_0005833 3300048928 Bacteria 13526
272 Ga0496125_0052465 3300048928 Bacteria 3353
273 Ga0496126_0233182 3300048929 Bacteria 1541
274 Ga0496126_0278187 3300048929 Bacteria 1387
275 nmdc:mga03n38_219443_c1 3300050490 Bacteria 992
276 nmdc:mga0yw44_657_c1 3300050492 Bacteria 12590
277 nmdc:mga0k408_129179_c1 3300050493 Bacteria 1500
278 nmdc:mga07m45_14640_c1 3300050496 Bacteria 4183
279 nmdc:mga07m45_193614_c1 3300050496 Bacteria 1183
280 nmdc:mga07m45_26917_c1 3300050496 Bacteria 3163
281 Ga0500651_0000137 3300053093 Bacteria 45846
282 Ga0500651_0040578 3300053093 Bacteria 2932
283 Ga0500560_048912 3300053107 Bacteria 1352
284 Ga0500571_000067 3300053110 Bacteria 32699
285 Ga0500593_000318 3300053117 Bacteria 19357
286 Ga0500594_0001202 3300053118 Bacteria 5591
287 Ga0500594_0052207 3300053118 Bacteria 1155
288 Ga0500607_052565 3300053121 Bacteria 2162
289 Ga0500608_059903 3300053122 Bacteria 1821
290 Ga0500618_024559 3300053125 Bacteria 1451
291 Ga0500655_002350 3300053133 Bacteria 3467
292 Ga0500658_0000836 3300053134 Bacteria 12678
293 Ga0500658_0001025 3300053134 Bacteria 11402
294 Ga0500559_0001487 3300053136 Bacteria 13220
295 Ga0500559_0001525 3300053136 Bacteria 12983
296 Ga0500559_0002957 3300053136 Bacteria 8540
297 Ga0500568_0004221 3300053139 Bacteria 7737
298 Ga0500568_0008403 3300053139 Bacteria 4975
299 Ga0500616_0038378 3300053153 Bacteria 2587
300 Ga0500622_0004002 3300053156 Bacteria 9498
301 Ga0500634_0002032 3300053161 Bacteria 8314

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009148 Ga0105243_10028330 Ga0105243_100283302 246
2 3300006058 Ga0075432_10002702 Ga0075432_100027028 256
3 3300005344 Ga0070661_100011952 Ga0070661_1000119522 261
4 3300005564 Ga0070664_100042036 Ga0070664_1000420364 261
5 3300025920 Ga0207649_10015753 Ga0207649_100157534 261
6 3300025945 Ga0207679_10005996 Ga0207679_100059962 261
7 3300005366 Ga0070659_100002665 Ga0070659_1000026653 262
8 3300005457 Ga0070662_100117765 Ga0070662_1001177652 262
9 3300005843 Ga0068860_100050041 Ga0068860_1000500415 262
10 3300014968 Ga0157379_10065073 Ga0157379_100650733 262
11 3300025932 Ga0207690_10006208 Ga0207690_100062083 262
12 3300025933 Ga0207706_10151346 Ga0207706_101513462 262
13 3300042876 Ga0451577_0000895 Ga0451577_0000895_12445_13305 263
14 3300042134 Ga0450898_008262 Ga0450898_008262_73_879 265
15 3300003759 Ga0055525_1000004 Ga0055525_1000004555 266
16 3300025230 Ga0209563_100013 Ga0209563_100013555 266
17 3300033180 Ga0307510_10267844 Ga0307510_102678441 266
18 3300042012 Ga0439455_0011227 Ga0439455_0011227_506_1312 266
19 3300003323 rootH1_10006141 rootH1_100061413 267
20 3300003771 Ga0055526_1002708 Ga0055526_10027089 267
21 3300003775 Ga0055524_1000624 Ga0055524_10006246 267
22 3300003775 Ga0055524_1007033 Ga0055524_10070333 267
23 3300003792 Ga0055540_1024224 Ga0055540_10242242 267
24 3300003794 Ga0055531_10002742 Ga0055531_100027424 267
25 3300004625 Ga0055543_1003616 Ga0055543_10036162 267
26 3300005262 Ga0065165_1000129 Ga0065165_100012923 267
27 3300005262 Ga0065165_1000344 Ga0065165_100034450 267
28 3300005455 Ga0070663_100318151 Ga0070663_1003181512 267
29 3300005457 Ga0070662_100022288 Ga0070662_1000222882 267
30 3300006195 Ga0075366_10032956 Ga0075366_100329563 267
31 3300006944 Ga0099823_1000038 Ga0099823_100003832 267
32 3300012475 Ga0157317_1000239 Ga0157317_10002392 267
33 3300012497 Ga0157319_1000003 Ga0157319_1000003161 267
34 3300014326 Ga0157380_10415613 Ga0157380_104156132 267
35 3300021361 Ga0213872_10001026 Ga0213872_100010268 267
36 3300025273 Ga0209673_1004159 Ga0209673_10041597 267
37 3300025273 Ga0209673_1009381 Ga0209673_10093813 267
38 3300025295 Ga0209564_1000003 Ga0209564_1000003167 267
39 3300025298 Ga0209050_1000143 Ga0209050_1000143108 267
40 3300025299 Ga0209256_1000150 Ga0209256_1000150115 267
41 3300025299 Ga0209256_1000521 Ga0209256_100052134 267
42 3300025303 Ga0209051_1000876 Ga0209051_100087623 267
43 3300025304 Ga0209257_1000803 Ga0209257_100080313 267
44 3300025304 Ga0209257_1002264 Ga0209257_100226410 267
45 3300025933 Ga0207706_10001637 Ga0207706_1000163714 267
46 3300025945 Ga0207679_10304672 Ga0207679_103046721 267
47 3300026089 Ga0207648_10056883 Ga0207648_100568833 267
48 3300027296 Ga0209389_1008572 Ga0209389_10085724 267
49 3300027526 Ga0209968_1005144 Ga0209968_10051442 267
50 3300027695 Ga0209966_1000628 Ga0209966_10006284 267
51 3300031649 Ga0307514_10000762 Ga0307514_1000076231 267
52 3300031730 Ga0307516_10004908 Ga0307516_100049085 267
53 3300031730 Ga0307516_10159272 Ga0307516_101592722 267
54 3300032002 Ga0307416_100308154 Ga0307416_1003081541 267
55 3300037418 Ga0395900_0000050 Ga0395900_0000050_191221_192039 267
56 3300037466 Ga0395898_0002499 Ga0395898_0002499_4576_5394 267
57 3300037471 Ga0395905_0043157 Ga0395905_0043157_441_1262 267
58 3300039447 Ga0436361_0794259 Ga0436361_0794259_4596_5441 267
59 3300041451 Ga0451791_1551273 Ga0451791_1551273_260_1096 267
60 3300041997 Ga0439431_0008312 Ga0439431_0008312_140_988 267
61 3300042007 Ga0439449_0030165 Ga0439449_0030165_1021_1830 267
62 3300042007 Ga0439449_0045622 Ga0439449_0045622_322_1170 267
63 3300042014 Ga0439457_007441 Ga0439457_007441_304_1152 267
64 3300042015 Ga0439462_0054895 Ga0439462_0054895_47_895 267
65 3300042438 Ga0439459_0000312 Ga0439459_0000312_3824_4648 267
66 3300042876 Ga0451577_0205743 Ga0451577_0205743_608_1468 267
67 3300044656 Ga0466969_0000093 Ga0466969_0000093_24377_25258 267
68 3300044656 Ga0466969_0059691 Ga0466969_0059691_131_994 267
69 3300044658 Ga0466972_0006276 Ga0466972_0006276_3879_4700 267
70 3300044683 Ga0466965_0062364 Ga0466965_0062364_486_1298 267
71 3300044683 Ga0466965_0130661 Ga0466965_0130661_135_998 267
72 3300044684 Ga0466966_0115121 Ga0466966_0115121_709_1590 267
73 3300044693 Ga0466961_0002099 Ga0466961_0002099_5045_5908 267
74 3300044693 Ga0466961_0105711 Ga0466961_0105711_277_1158 267
75 3300044694 Ga0466963_0009172 Ga0466963_0009172_1649_2512 267
76 3300044694 Ga0466963_0084776 Ga0466963_0084776_794_1636 267
77 3300044706 Ga0466964_0011526 Ga0466964_0011526_414_1277 267
78 3300044706 Ga0466964_0104203 Ga0466964_0104203_376_1197 267
79 3300044712 Ga0453684_0271851 Ga0453684_0271851_672_1487 267
80 3300044765 Ga0466970_0009375 Ga0466970_0009375_1509_2321 267
81 3300044765 Ga0466970_0028479 Ga0466970_0028479_1865_2728 267
82 3300044842 Ga0466957_0067060 Ga0466957_0067060_44_907 267
83 3300045049 Ga0466959_0000027 Ga0466959_0000027_108962_109825 267
84 3300045049 Ga0466959_0115169 Ga0466959_0115169_992_1873 267
85 3300045051 Ga0451576_0006575 Ga0451576_0006575_2476_3291 267
86 3300045976 Ga0466967_0006228 Ga0466967_0006228_1825_2688 267
87 3300046457 Ga0495590_0030475 Ga0495590_0030475_328_1203 267
88 3300046474 Ga0495605_0041655 Ga0495605_0041655_1311_2186 267
89 3300046691 Ga0495670_0022068 Ga0495670_0022068_1280_2257 267
90 3300047443 Ga0495687_013635 Ga0495687_013635_1978_2853 267
91 3300048921 Ga0496118_0096684 Ga0496118_0096684_813_1634 267
92 3300048924 Ga0496121_0016431 Ga0496121_0016431_3688_4509 267
93 3300048927 Ga0496124_0000138 Ga0496124_0000138_91174_91998 267
94 3300048927 Ga0496124_0008218 Ga0496124_0008218_2102_2986 267
95 3300048928 Ga0496125_0005833 Ga0496125_0005833_1948_2772 267
96 3300048929 Ga0496126_0233182 Ga0496126_0233182_57_881 267
97 3300050490 nmdc:mga03n38_219443_c1 nmdc:mga03n38_219443_c1_91_963 267
98 3300050493 nmdc:mga0k408_129179_c1 nmdc:mga0k408_129179_c1_61_942 267
99 3300050496 nmdc:mga07m45_193614_c1 nmdc:mga07m45_193614_c1_282_1163 267
100 3300050496 nmdc:mga07m45_26917_c1 nmdc:mga07m45_26917_c1_718_1536 267
101 3300053117 Ga0500593_000318 Ga0500593_000318_12750_13562 267
102 3300053136 Ga0500559_0002957 Ga0500559_0002957_7524_8351 267
103 3300053139 Ga0500568_0008403 Ga0500568_0008403_2979_3809 267
104 3300053156 Ga0500622_0004002 Ga0500622_0004002_4376_5353 267
105 iso_pu_bacteria 2588253510 2588290955 267
106 iso_pu_bacteria 2643221592 2643972106 267
107 iso_pu_bacteria 2643221625 2644142306 267
108 iso_pu_bacteria 2643221648 2644275999 267
109 iso_pu_bacteria 2643221654 2644301454 267
110 iso_pu_bacteria 2643221660 2644340453 267
111 iso_pu_bacteria 2831864461 2831865937 267
112 3300005355 Ga0070671_100012286 Ga0070671_1000122862 268
113 3300005618 Ga0068864_100286979 Ga0068864_1002869792 268
114 3300009177 Ga0105248_10001747 Ga0105248_1000174715 268
115 3300037471 Ga0395905_0006888 Ga0395905_0006888_3743_4549 268
116 3300048908 Ga0496105_0419655 Ga0496105_0419655_76_939 268
117 3300048914 Ga0496111_0190672 Ga0496111_0190672_252_1115 268
118 3300048915 Ga0496112_0007636 Ga0496112_0007636_4210_5073 268
119 3300048916 Ga0496113_0003190 Ga0496113_0003190_1215_2078 268
120 3300050492 nmdc:mga0yw44_657_c1 nmdc:mga0yw44_657_c1_4553_5377 268
121 iso_pu_bacteria 2928115317 2928120694 268
122 3300031456 Ga0307513_10080341 Ga0307513_100803415 269
123 3300037312 Ga0395899_0157334 Ga0395899_0157334_583_1401 269
124 3300038443 Ga0395901_0134250 Ga0395901_0134250_194_1108 269
125 iso_pu_bacteria 2643221672 2644399251 269
126 iso_pu_bacteria 2643221683 2644467067 269
127 iso_pu_bacteria 2885192300 2885196908 269
128 3300042876 Ga0451577_0000190 Ga0451577_0000190_8517_9368 270
129 3300044712 Ga0453684_0000618 Ga0453684_0000618_120946_121797 270
130 3300045051 Ga0451576_0001628 Ga0451576_0001628_28480_29331 270
131 iso_pu_bacteria 2513020051 2513231059 270
132 iso_pu_bacteria 2643221658 2644325527 270
133 iso_pu_bacteria 2738541277 2738718224 270
134 iso_pu_bacteria 2738541307 2738880386 270
135 iso_pu_bacteria 2738543019 2739281411 270
136 iso_pu_bacteria 2818991446 2819600542 270
137 iso_pu_bacteria 2831265667 2831267732 270
138 iso_pu_bacteria 2838054893 2838061540 270
139 iso_pu_bacteria 2842733646 2842736334 270
140 iso_pu_bacteria 2842747753 2842748843 270
141 iso_pu_bacteria 2885198086 2885198798 270
142 iso_pu_bacteria 2885211737 2885211822 270
143 iso_pu_bacteria 2899924645 2899928311 270
144 iso_pu_bacteria 2928037797 2928041263 270
145 iso_pu_bacteria 2928044640 2928048105 270
146 iso_pu_bacteria 2928051484 2928055946 270
147 iso_pu_bacteria 2928064002 2928066573 270
148 iso_pu_bacteria 2928084124 2928087574 270
149 iso_pu_bacteria 2954767861 2954768800 270
150 3300003504 JGI26138J51218_100586 JGI26138J51218_1005862 271
151 3300027614 Ga0209970_1000655 Ga0209970_10006553 271
152 3300053136 Ga0500559_0001487 Ga0500559_0001487_7513_8337 271
153 iso_pu_bacteria 2919704043 2919707164 271
154 3300027682 Ga0209971_1009480 Ga0209971_10094803 272
155 3300041451 Ga0451791_0466228 Ga0451791_0466228_65_889 272
156 3300048925 Ga0496122_0000204 Ga0496122_0000204_110911_111741 272
157 3300048926 Ga0496123_0001226 Ga0496123_0001226_16739_17569 272
158 3300048929 Ga0496126_0278187 Ga0496126_0278187_57_887 272
159 3300053093 Ga0500651_0040578 Ga0500651_0040578_1738_2559 272
160 3300053118 Ga0500594_0052207 Ga0500594_0052207_76_903 272
161 3300053125 Ga0500618_024559 Ga0500618_024559_128_955 272
162 iso_pu_bacteria 2643221596 2643991665 272
163 3300003781 Ga0055536_1004758 Ga0055536_10047588 273
164 3300003781 Ga0055536_1006164 Ga0055536_10061649 273
165 3300003791 Ga0055530_10004408 Ga0055530_100044085 273
166 3300003792 Ga0055540_1003828 Ga0055540_10038289 273
167 3300003792 Ga0055540_1004055 Ga0055540_10040554 273
168 3300003794 Ga0055531_10002552 Ga0055531_1000255214 273
169 3300005344 Ga0070661_100153249 Ga0070661_1001532492 273
170 3300005366 Ga0070659_100047192 Ga0070659_1000471923 273
171 3300005457 Ga0070662_100004015 Ga0070662_10000401512 273
172 3300005457 Ga0070662_100181353 Ga0070662_1001813531 273
173 3300005563 Ga0068855_100226216 Ga0068855_1002262162 273
174 3300006195 Ga0075366_10305800 Ga0075366_103058002 273
175 3300009093 Ga0105240_10082717 Ga0105240_100827175 273
176 3300009148 Ga0105243_10004593 Ga0105243_1000459312 273
177 3300014497 Ga0182008_10136744 Ga0182008_101367442 273
178 3300025292 Ga0209676_1003243 Ga0209676_10032438 273
179 3300025292 Ga0209676_1004667 Ga0209676_100466710 273
180 3300025298 Ga0209050_1002640 Ga0209050_10026407 273
181 3300025303 Ga0209051_1001048 Ga0209051_100104826 273
182 3300025303 Ga0209051_1003164 Ga0209051_100316412 273
183 3300025304 Ga0209257_1000057 Ga0209257_1000057260 273
184 3300025920 Ga0207649_10215074 Ga0207649_102150742 273
185 3300025935 Ga0207709_10000215 Ga0207709_1000021518 273
186 3300027876 Ga0209974_10012638 Ga0209974_100126384 273
187 3300030731 Ga0316177_1118953 Ga0316177_11189531 273
188 3300031731 Ga0307405_10004410 Ga0307405_100044107 273
189 3300032002 Ga0307416_100026022 Ga0307416_1000260227 273
190 3300032005 Ga0307411_10105026 Ga0307411_101050262 273
191 3300041404 Ga0439436_0000671 Ga0439436_0000671_158_985 273
192 3300041413 Ga0439465_0081579 Ga0439465_0081579_156_983 273
193 3300046471 Ga0495650_0030577 Ga0495650_0030577_1253_2083 273
194 3300048926 Ga0496123_0174333 Ga0496123_0174333_151_993 273
195 3300053121 Ga0500607_052565 Ga0500607_052565_1149_1970 273
196 3300002773 JGI25152J39213_1001945 JGI25152J39213_10019459 274
197 3300002773 JGI25152J39213_1002156 JGI25152J39213_10021567 274
198 3300002774 JGI25150J39212_1002677 JGI25150J39212_10026772 274
199 3300002987 JGI25159J45721_1001946 JGI25159J45721_10019465 274
200 3300003187 JGI25151J46595_10006122 JGI25151J46595_100061222 274
201 3300003187 JGI25151J46595_10018335 JGI25151J46595_100183354 274
202 3300003215 JGI25153J46596_10006229 JGI25153J46596_100062292 274
203 3300003320 rootH2_10019901 rootH2_100199012 274
204 3300003323 rootH1_10013234 rootH1_100132341 274
205 3300003354 JGI25160J50197_1002666 JGI25160J50197_10026665 274
206 3300003354 JGI25160J50197_1006098 JGI25160J50197_10060984 274
207 3300003374 JGI25161J50226_1001766 JGI25161J50226_10017669 274
208 3300003578 Ga0006562J51391_1010057 Ga0006562J51391_101005717 274
209 3300003578 Ga0006562J51391_1015350 Ga0006562J51391_10153502 274
210 3300003760 Ga0055527_1011649 Ga0055527_10116491 274
211 3300003761 Ga0055535_1000380 Ga0055535_100038024 274
212 3300003762 Ga0055542_1000062 Ga0055542_1000062144 274
213 3300003771 Ga0055526_1006802 Ga0055526_10068022 274
214 3300003771 Ga0055526_1006863 Ga0055526_10068632 274
215 3300003773 Ga0055537_1000550 Ga0055537_100055021 274
216 3300003773 Ga0055537_1002506 Ga0055537_10025062 274
217 3300003773 Ga0055537_1005807 Ga0055537_10058075 274
218 3300003775 Ga0055524_1004870 Ga0055524_10048702 274
219 3300003775 Ga0055524_1004908 Ga0055524_10049089 274
220 3300003781 Ga0055536_1014016 Ga0055536_10140164 274
221 3300003784 Ga0055534_1002628 Ga0055534_10026282 274
222 3300003784 Ga0055534_1002657 Ga0055534_100265710 274
223 3300003790 Ga0055528_1005215 Ga0055528_10052152 274
224 3300003790 Ga0055528_1012761 Ga0055528_10127615 274
225 3300003791 Ga0055530_10002499 Ga0055530_1000249914 274
226 3300003791 Ga0055530_10002623 Ga0055530_100026237 274
227 3300003792 Ga0055540_1003710 Ga0055540_10037109 274
228 3300003792 Ga0055540_1008094 Ga0055540_10080945 274
229 3300003794 Ga0055531_10007057 Ga0055531_100070579 274
230 3300003794 Ga0055531_10007106 Ga0055531_100071069 274
231 3300004625 Ga0055543_1000989 Ga0055543_10009895 274
232 3300004625 Ga0055543_1001878 Ga0055543_10018789 274
233 3300005262 Ga0065165_1004528 Ga0065165_10045289 274
234 3300005262 Ga0065165_1010737 Ga0065165_10107376 274
235 3300005539 Ga0068853_100190433 Ga0068853_1001904331 274
236 3300005834 Ga0068851_10030593 Ga0068851_100305933 274
237 3300006186 Ga0075369_10017183 Ga0075369_100171832 274
238 3300006353 Ga0075370_10005920 Ga0075370_100059205 274
239 3300006353 Ga0075370_10016644 Ga0075370_100166446 274
240 3300009036 Ga0105244_10003426 Ga0105244_1000342614 274
241 3300009093 Ga0105240_10581509 Ga0105240_105815092 274
242 3300009098 Ga0105245_10359532 Ga0105245_103595323 274
243 3300009148 Ga0105243_10004693 Ga0105243_100046934 274
244 3300009551 Ga0105238_10092567 Ga0105238_100925674 274
245 3300010375 Ga0105239_10643745 Ga0105239_106437452 274
246 3300013102 Ga0157371_10008532 Ga0157371_100085329 274
247 3300013102 Ga0157371_10308459 Ga0157371_103084592 274
248 3300014497 Ga0182008_10001756 Ga0182008_1000175614 274
249 3300015261 Ga0182006_1000705 Ga0182006_10007057 274
250 3300015261 Ga0182006_1033676 Ga0182006_10336761 274
251 3300015262 Ga0182007_10000957 Ga0182007_1000095715 274
252 3300017792 Ga0163161_10042530 Ga0163161_100425304 274
253 3300025208 Ga0209436_110461 Ga0209436_1104612 274
254 3300025228 Ga0209672_101806 Ga0209672_1018065 274
255 3300025242 Ga0209258_100154 Ga0209258_10015431 274
256 3300025245 Ga0207425_1001372 Ga0207425_10013729 274
257 3300025245 Ga0207425_1011150 Ga0207425_10111502 274
258 3300025254 Ga0209148_1000145 Ga0209148_100014531 274
259 3300025258 Ga0209129_1000054 Ga0209129_100005470 274
260 3300025258 Ga0209129_1004503 Ga0209129_10045035 274
261 3300025263 Ga0209565_1000185 Ga0209565_10001855 274
262 3300025263 Ga0209565_1001534 Ga0209565_10015345 274
263 3300025273 Ga0209673_1000172 Ga0209673_100017276 274
264 3300025273 Ga0209673_1003839 Ga0209673_10038399 274
265 3300025284 Ga0209130_1001009 Ga0209130_100100918 274
266 3300025284 Ga0209130_1001241 Ga0209130_100124114 274
267 3300025291 Ga0209675_1001255 Ga0209675_100125514 274
268 3300025291 Ga0209675_1004900 Ga0209675_10049005 274
269 3300025292 Ga0209676_1000103 Ga0209676_100010317 274
270 3300025292 Ga0209676_1004823 Ga0209676_10048239 274
271 3300025294 Ga0209025_1000310 Ga0209025_100031020 274
272 3300025294 Ga0209025_1000474 Ga0209025_10004747 274
273 3300025294 Ga0209025_1010766 Ga0209025_10107665 274
274 3300025295 Ga0209564_1000241 Ga0209564_100024166 274
275 3300025295 Ga0209564_1001015 Ga0209564_100101526 274
276 3300025297 Ga0209758_1000034 Ga0209758_1000034368 274
277 3300025297 Ga0209758_1009936 Ga0209758_10099366 274
278 3300025298 Ga0209050_1000012 Ga0209050_1000012402 274
279 3300025298 Ga0209050_1000294 Ga0209050_100029470 274
280 3300025299 Ga0209256_1000103 Ga0209256_100010372 274
281 3300025299 Ga0209256_1000165 Ga0209256_100016583 274
282 3300025302 Ga0207426_1000058 Ga0207426_1000058200 274
283 3300025302 Ga0207426_1000067 Ga0207426_1000067257 274
284 3300025303 Ga0209051_1000019 Ga0209051_1000019321 274
285 3300025303 Ga0209051_1010246 Ga0209051_10102464 274
286 3300025304 Ga0209257_1000024 Ga0209257_1000024348 274
287 3300025304 Ga0209257_1003704 Ga0209257_100370414 274
288 3300025321 Ga0207656_10006718 Ga0207656_100067185 274
289 3300025728 Ga0207655_1005464 Ga0207655_100546410 274
290 3300025924 Ga0207694_10064045 Ga0207694_100640452 274
291 3300025932 Ga0207690_10152027 Ga0207690_101520272 274
292 3300025933 Ga0207706_10005566 Ga0207706_100055669 274
293 3300025933 Ga0207706_10162136 Ga0207706_101621361 274
294 3300025935 Ga0207709_10001162 Ga0207709_100011626 274
295 3300026041 Ga0207639_10237550 Ga0207639_102375501 274
296 3300031548 Ga0307408_100042947 Ga0307408_1000429472 274
297 3300046453 Ga0495627_005576 Ga0495627_005576_3517_4341 274
298 3300046460 Ga0495638_0036626 Ga0495638_0036626_651_1475 274
299 3300046512 Ga0495610_0101098 Ga0495610_0101098_238_1062 274
300 3300046513 Ga0495616_0002528 Ga0495616_0002528_6198_7022 274
301 3300046515 Ga0495620_0020644 Ga0495620_0020644_902_1726 274
302 3300046518 Ga0495631_0000553 Ga0495631_0000553_15930_16754 274
303 3300046530 Ga0495654_0008030 Ga0495654_0008030_4915_5739 274
304 3300046660 Ga0495625_0121423 Ga0495625_0121423_519_1343 274
305 3300046663 Ga0495635_0287633 Ga0495635_0287633_226_1050 274
306 3300046683 Ga0495658_0048933 Ga0495658_0048933_242_1066 274
307 3300047673 Ga0495593_0059313 Ga0495593_0059313_245_1069 274
308 3300048919 Ga0496116_0015944 Ga0496116_0015944_1623_2447 274
309 3300048920 Ga0496117_0021939 Ga0496117_0021939_1305_2129 274
310 3300048920 Ga0496117_0023639 Ga0496117_0023639_1656_2480 274
311 3300048921 Ga0496118_0005839 Ga0496118_0005839_9501_10325 274
312 3300048921 Ga0496118_0098633 Ga0496118_0098633_46_870 274
313 3300048924 Ga0496121_0066885 Ga0496121_0066885_65_889 274
314 3300048925 Ga0496122_0073005 Ga0496122_0073005_708_1532 274
315 3300048925 Ga0496122_0170585 Ga0496122_0170585_45_869 274
316 3300048926 Ga0496123_0048326 Ga0496123_0048326_1716_2540 274
317 3300048926 Ga0496123_0059852 Ga0496123_0059852_38_862 274
318 3300048927 Ga0496124_0011865 Ga0496124_0011865_6191_7015 274
319 3300048927 Ga0496124_0031874 Ga0496124_0031874_1631_2455 274
320 3300048928 Ga0496125_0052465 Ga0496125_0052465_1580_2404 274
321 3300050496 nmdc:mga07m45_14640_c1 nmdc:mga07m45_14640_c1_2798_3622 274
322 3300053093 Ga0500651_0000137 Ga0500651_0000137_19167_19991 274
323 3300053107 Ga0500560_048912 Ga0500560_048912_298_1122 274
324 3300053110 Ga0500571_000067 Ga0500571_000067_16224_17048 274
325 3300053118 Ga0500594_0001202 Ga0500594_0001202_701_1525 274
326 3300053122 Ga0500608_059903 Ga0500608_059903_718_1542 274
327 3300053133 Ga0500655_002350 Ga0500655_002350_1845_2669 274
328 3300053134 Ga0500658_0000836 Ga0500658_0000836_1322_2146 274
329 3300053134 Ga0500658_0001025 Ga0500658_0001025_1322_2146 274
330 3300053136 Ga0500559_0001525 Ga0500559_0001525_8659_9483 274
331 3300053139 Ga0500568_0004221 Ga0500568_0004221_1757_2581 274
332 3300053153 Ga0500616_0038378 Ga0500616_0038378_392_1216 274
333 3300053161 Ga0500634_0002032 Ga0500634_0002032_6318_7142 274
334 iso_pu_bacteria 2904541872 2904545097 274
335 iso_pu_bacteria 2929160207 2929165275 274

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ewp-assembly1.cif.gz_A mus musculus cep120 third c2 domain (c2c) 0.7186 15 40
6wts-assembly1.cif.gz_C cryoem structure of the c. sordellii lethal toxin tcsl in complex with sema6a 0.6171 2 36
6kxt-assembly1.cif.gz_A bon1-c2b 0.603 16 44
4y1s-assembly1.cif.gz_A structural basis for ca2+-mediated interaction of the perforin c2 domain with lipid membranes 0.5647 13 40
6l0w-assembly2.cif.gz_C structure of rld2 brx domain bound to lzy3 ccl motif 0.5629 19 48
ID Description Score Start End Superfamily
af_A1ZBD6_215_358_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.6749 16 40 2.60.40.150
af_M9PE32_646_779_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.6384 17 47 2.60.40.150
af_Q12466_382_517_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.6279 16 40 2.60.40.150
af_C0HDP4_212_345_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.6239 15 40 2.60.40.150
af_A0A0R0FP05_243_329_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.6168 1 49 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A1H7ES98-F1-model_v4 DUF429 domain-containing protein 0.9674 29 274
AF-A0A1H7ES98-F1-model_v4 DUF429 domain-containing protein 0.9598 29 274
AF-A0A1G6NZB0-F1-model_v4 DUF429 domain-containing protein 0.9578 2 274
AF-A0A1H0LBU2-F1-model_v4 DUF429 domain-containing protein 0.9566 2 274
AF-A0A2Z2LIF8-F1-model_v4 deleted 0.9556 1 274

Feature Viewer

pLDDT pTM Quality
92.08 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map