F412461
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 335 | 216 | 301 | 276 |
Family's Representative Sequence
| Representative Sequence | 3300053156|Ga0500622_0004002|Ga0500622_0004002_4376_5353 |
| Length | 325 |
| Sequence | MDTVAGMPKVSKAPAASRRIAEPSLATPLAIPSAAPVDRALVGVDFTSAPTTRKPIRLAFGRRQGSVLKLERQVGMTSLDAFESWLAEPGPWLGGFDLPFGLPRELIETLGWPTEWAPLIAHYASLSRAEIRDTFAAFCDARPVGGKFAHRACDGPAGSSPSMKWVNPPVAYMLHAGVPRLLRAGVDLPGLHAGDRSRIALEAYPGLLARELIGTRSYKSDDRAKQTPDRLIARKDVIEALEQGRSRLGLRLKLSHAQRDELADDGSGDKLDAVLCLMQAAWADARPDYGLPADLDPLEGWILCAPRTAPAASTLPTSRTRRMTT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 2 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 3 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 4 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 5 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 6 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 7 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 8 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 9 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 10 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 11 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 12 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 13 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 14 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 15 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 16 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 17 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 18 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 19 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 20 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 21 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 22 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 23 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 24 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 25 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 26 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 27 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 28 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 29 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 30 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 31 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 32 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 33 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 34 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 35 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 36 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 37 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 38 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 39 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 40 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 41 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 42 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 43 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 44 | 3300003504 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM | Metagenome | Rhizosphere |
| 45 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 46 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 47 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 48 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 49 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 50 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 51 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 52 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 53 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 54 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 55 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 56 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 57 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 58 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 59 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 60 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 61 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 73 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 74 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 75 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 76 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 77 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 85 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 86 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 89 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 91 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 92 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 94 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 99 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 102 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 103 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 125 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 131 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 132 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 133 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 134 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 135 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 136 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 137 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 138 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 139 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 140 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 141 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 142 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 143 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 144 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 145 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 146 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 147 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 148 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 149 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 150 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 151 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 152 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 153 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 154 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 155 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 156 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 157 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 158 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 159 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 160 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 161 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 162 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 163 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 164 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 165 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 166 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 167 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 168 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 169 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 186 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 187 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 188 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 189 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 190 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 191 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 192 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 193 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 194 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 195 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 196 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 197 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 198 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 199 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 200 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 201 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 202 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 203 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 204 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 205 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 206 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 207 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 208 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 209 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 210 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 211 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 212 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 213 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 214 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 215 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 216 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.25 |
| Metatranscriptomes | 0.6 |
| Isolates | 10.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 39.7 |
| Nodule | 1.19 |
| Rhizoplane | 1.79 |
| Rhizosphere | 40.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 17.01 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25152J39213_1001945 | 3300002773 | Bacteria | 8224 |
| 2 | JGI25152J39213_1002156 | 3300002773 | Bacteria | 7717 |
| 3 | JGI25150J39212_1002677 | 3300002774 | Bacteria | 4345 |
| 4 | JGI25159J45721_1001946 | 3300002987 | Bacteria | 8224 |
| 5 | JGI25151J46595_10006122 | 3300003187 | Bacteria | 6105 |
| 6 | JGI25151J46595_10018335 | 3300003187 | Bacteria | 3010 |
| 7 | JGI25153J46596_10006229 | 3300003215 | Bacteria | 6105 |
| 8 | rootH2_10019901 | 3300003320 | Bacteria | 2289 |
| 9 | rootH1_10006141 | 3300003323 | Bacteria | 19182 |
| 10 | rootH1_10013234 | 3300003323 | Bacteria | 4711 |
| 11 | JGI25160J50197_1002666 | 3300003354 | Bacteria | 8224 |
| 12 | JGI25160J50197_1006098 | 3300003354 | Bacteria | 4919 |
| 13 | JGI25161J50226_1001766 | 3300003374 | Bacteria | 6101 |
| 14 | JGI26138J51218_100586 | 3300003504 | Bacteria | 1402 |
| 15 | Ga0006562J51391_1010057 | 3300003578 | Bacteria | 14357 |
| 16 | Ga0006562J51391_1015350 | 3300003578 | Bacteria | 2480 |
| 17 | Ga0055525_1000004 | 3300003759 | Bacteria | 888039 |
| 18 | Ga0055527_1011649 | 3300003760 | Bacteria | 1004 |
| 19 | Ga0055535_1000380 | 3300003761 | Bacteria | 42008 |
| 20 | Ga0055542_1000062 | 3300003762 | Bacteria | 161494 |
| 21 | Ga0055526_1002708 | 3300003771 | Bacteria | 11776 |
| 22 | Ga0055526_1006802 | 3300003771 | Bacteria | 6105 |
| 23 | Ga0055526_1006863 | 3300003771 | Bacteria | 6070 |
| 24 | Ga0055537_1000550 | 3300003773 | Bacteria | 21428 |
| 25 | Ga0055537_1002506 | 3300003773 | Bacteria | 6105 |
| 26 | Ga0055537_1005807 | 3300003773 | Bacteria | 3238 |
| 27 | Ga0055524_1000624 | 3300003775 | Bacteria | 25410 |
| 28 | Ga0055524_1004870 | 3300003775 | Bacteria | 6105 |
| 29 | Ga0055524_1004908 | 3300003775 | Bacteria | 6070 |
| 30 | Ga0055524_1007033 | 3300003775 | Bacteria | 4832 |
| 31 | Ga0055536_1004758 | 3300003781 | Bacteria | 6813 |
| 32 | Ga0055536_1006164 | 3300003781 | Bacteria | 5666 |
| 33 | Ga0055536_1014016 | 3300003781 | Bacteria | 2844 |
| 34 | Ga0055534_1002628 | 3300003784 | Bacteria | 6105 |
| 35 | Ga0055534_1002657 | 3300003784 | Bacteria | 6060 |
| 36 | Ga0055528_1005215 | 3300003790 | Bacteria | 6105 |
| 37 | Ga0055528_1012761 | 3300003790 | Bacteria | 3238 |
| 38 | Ga0055530_10002499 | 3300003791 | Bacteria | 11772 |
| 39 | Ga0055530_10002623 | 3300003791 | Bacteria | 11288 |
| 40 | Ga0055530_10004408 | 3300003791 | Bacteria | 7255 |
| 41 | Ga0055540_1003710 | 3300003792 | Bacteria | 7229 |
| 42 | Ga0055540_1003828 | 3300003792 | Bacteria | 7076 |
| 43 | Ga0055540_1004055 | 3300003792 | Bacteria | 6805 |
| 44 | Ga0055540_1008094 | 3300003792 | Bacteria | 3839 |
| 45 | Ga0055540_1024224 | 3300003792 | Bacteria | 1510 |
| 46 | Ga0055531_10002552 | 3300003794 | Bacteria | 12116 |
| 47 | Ga0055531_10002742 | 3300003794 | Bacteria | 11576 |
| 48 | Ga0055531_10007057 | 3300003794 | Bacteria | 6215 |
| 49 | Ga0055531_10007106 | 3300003794 | Bacteria | 6184 |
| 50 | Ga0055543_1000989 | 3300004625 | Bacteria | 12816 |
| 51 | Ga0055543_1001878 | 3300004625 | Bacteria | 7636 |
| 52 | Ga0055543_1003616 | 3300004625 | Bacteria | 4471 |
| 53 | Ga0065165_1000129 | 3300005262 | Bacteria | 129359 |
| 54 | Ga0065165_1000344 | 3300005262 | Bacteria | 76165 |
| 55 | Ga0065165_1004528 | 3300005262 | Bacteria | 8520 |
| 56 | Ga0065165_1010737 | 3300005262 | Bacteria | 3913 |
| 57 | Ga0070661_100011952 | 3300005344 | Bacteria | 6064 |
| 58 | Ga0070661_100153249 | 3300005344 | Bacteria | 1743 |
| 59 | Ga0070671_100012286 | 3300005355 | Bacteria | 6892 |
| 60 | Ga0070659_100002665 | 3300005366 | Bacteria | 12692 |
| 61 | Ga0070659_100047192 | 3300005366 | Bacteria | 3378 |
| 62 | Ga0070663_100318151 | 3300005455 | Bacteria | 1251 |
| 63 | Ga0070662_100004015 | 3300005457 | Bacteria | 9229 |
| 64 | Ga0070662_100022288 | 3300005457 | Bacteria | 4334 |
| 65 | Ga0070662_100117765 | 3300005457 | Bacteria | 2032 |
| 66 | Ga0070662_100181353 | 3300005457 | Bacteria | 1660 |
| 67 | Ga0068853_100190433 | 3300005539 | Bacteria | 1863 |
| 68 | Ga0068855_100226216 | 3300005563 | Bacteria | 2096 |
| 69 | Ga0070664_100042036 | 3300005564 | Bacteria | 3859 |
| 70 | Ga0068864_100286979 | 3300005618 | Bacteria | 1537 |
| 71 | Ga0068851_10030593 | 3300005834 | Bacteria | 2670 |
| 72 | Ga0068860_100050041 | 3300005843 | Bacteria | 3979 |
| 73 | Ga0075432_10002702 | 3300006058 | Bacteria | 5931 |
| 74 | Ga0075369_10017183 | 3300006186 | Bacteria | 2929 |
| 75 | Ga0075366_10032956 | 3300006195 | Bacteria | 3051 |
| 76 | Ga0075366_10305800 | 3300006195 | Bacteria | 973 |
| 77 | Ga0075370_10005920 | 3300006353 | Bacteria | 6117 |
| 78 | Ga0075370_10016644 | 3300006353 | Bacteria | 3958 |
| 79 | Ga0099823_1000038 | 3300006944 | Bacteria | 61505 |
| 80 | Ga0105244_10003426 | 3300009036 | Bacteria | 11307 |
| 81 | Ga0105240_10082717 | 3300009093 | Bacteria | 3942 |
| 82 | Ga0105240_10581509 | 3300009093 | Bacteria | 1235 |
| 83 | Ga0105245_10359532 | 3300009098 | Bacteria | 1445 |
| 84 | Ga0105243_10004593 | 3300009148 | Bacteria | 10885 |
| 85 | Ga0105243_10004693 | 3300009148 | Bacteria | 10757 |
| 86 | Ga0105243_10028330 | 3300009148 | Bacteria | 4299 |
| 87 | Ga0105248_10001747 | 3300009177 | Bacteria | 24182 |
| 88 | Ga0105238_10092567 | 3300009551 | Bacteria | 3011 |
| 89 | Ga0105239_10643745 | 3300010375 | Bacteria | 1210 |
| 90 | Ga0157317_1000239 | 3300012475 | Bacteria | 2026 |
| 91 | Ga0157319_1000003 | 3300012497 | Bacteria | 397199 |
| 92 | Ga0157371_10008532 | 3300013102 | Bacteria | 8157 |
| 93 | Ga0157371_10308459 | 3300013102 | Bacteria | 1146 |
| 94 | Ga0157380_10415613 | 3300014326 | Bacteria | 1281 |
| 95 | Ga0182008_10001756 | 3300014497 | Bacteria | 14210 |
| 96 | Ga0182008_10136744 | 3300014497 | Bacteria | 1224 |
| 97 | Ga0157379_10065073 | 3300014968 | Bacteria | 3259 |
| 98 | Ga0182006_1000705 | 3300015261 | Bacteria | 23167 |
| 99 | Ga0182006_1033676 | 3300015261 | Bacteria | 2053 |
| 100 | Ga0182007_10000957 | 3300015262 | Bacteria | 15855 |
| 101 | Ga0163161_10042530 | 3300017792 | Bacteria | 3268 |
| 102 | Ga0213872_10001026 | 3300021361 | Bacteria | 19491 |
| 103 | Ga0209436_110461 | 3300025208 | Bacteria | 1696 |
| 104 | Ga0209672_101806 | 3300025228 | Bacteria | 6543 |
| 105 | Ga0209563_100013 | 3300025230 | Bacteria | 941463 |
| 106 | Ga0209258_100154 | 3300025242 | Bacteria | 158235 |
| 107 | Ga0207425_1001372 | 3300025245 | Bacteria | 10313 |
| 108 | Ga0207425_1011150 | 3300025245 | Bacteria | 2155 |
| 109 | Ga0209148_1000145 | 3300025254 | Bacteria | 161352 |
| 110 | Ga0209129_1000054 | 3300025258 | Bacteria | 261997 |
| 111 | Ga0209129_1004503 | 3300025258 | Bacteria | 5405 |
| 112 | Ga0209565_1000185 | 3300025263 | Bacteria | 76451 |
| 113 | Ga0209565_1001534 | 3300025263 | Bacteria | 9949 |
| 114 | Ga0209673_1000172 | 3300025273 | Bacteria | 133472 |
| 115 | Ga0209673_1003839 | 3300025273 | Bacteria | 8491 |
| 116 | Ga0209673_1004159 | 3300025273 | Bacteria | 7912 |
| 117 | Ga0209673_1009381 | 3300025273 | Bacteria | 4246 |
| 118 | Ga0209130_1001009 | 3300025284 | Bacteria | 21838 |
| 119 | Ga0209130_1001241 | 3300025284 | Bacteria | 17909 |
| 120 | Ga0209675_1001255 | 3300025291 | Bacteria | 15212 |
| 121 | Ga0209675_1004900 | 3300025291 | Bacteria | 5779 |
| 122 | Ga0209676_1000103 | 3300025292 | Bacteria | 226908 |
| 123 | Ga0209676_1003243 | 3300025292 | Bacteria | 10256 |
| 124 | Ga0209676_1004667 | 3300025292 | Bacteria | 7524 |
| 125 | Ga0209676_1004823 | 3300025292 | Bacteria | 7323 |
| 126 | Ga0209025_1000310 | 3300025294 | Bacteria | 108186 |
| 127 | Ga0209025_1000474 | 3300025294 | Bacteria | 78060 |
| 128 | Ga0209025_1010766 | 3300025294 | Bacteria | 6146 |
| 129 | Ga0209564_1000003 | 3300025295 | Bacteria | 1585848 |
| 130 | Ga0209564_1000241 | 3300025295 | Bacteria | 118237 |
| 131 | Ga0209564_1001015 | 3300025295 | Bacteria | 34625 |
| 132 | Ga0209758_1000034 | 3300025297 | Bacteria | 467637 |
| 133 | Ga0209758_1009936 | 3300025297 | Bacteria | 5798 |
| 134 | Ga0209050_1000012 | 3300025298 | Bacteria | 813717 |
| 135 | Ga0209050_1000143 | 3300025298 | Bacteria | 171806 |
| 136 | Ga0209050_1000294 | 3300025298 | Bacteria | 105705 |
| 137 | Ga0209050_1002640 | 3300025298 | Bacteria | 14708 |
| 138 | Ga0209256_1000103 | 3300025299 | Bacteria | 193900 |
| 139 | Ga0209256_1000150 | 3300025299 | Bacteria | 146086 |
| 140 | Ga0209256_1000165 | 3300025299 | Bacteria | 135104 |
| 141 | Ga0209256_1000521 | 3300025299 | Bacteria | 56291 |
| 142 | Ga0207426_1000058 | 3300025302 | Bacteria | 363857 |
| 143 | Ga0207426_1000067 | 3300025302 | Bacteria | 342108 |
| 144 | Ga0209051_1000019 | 3300025303 | Bacteria | 511268 |
| 145 | Ga0209051_1000876 | 3300025303 | Bacteria | 30404 |
| 146 | Ga0209051_1001048 | 3300025303 | Bacteria | 26073 |
| 147 | Ga0209051_1003164 | 3300025303 | Bacteria | 11037 |
| 148 | Ga0209051_1010246 | 3300025303 | Bacteria | 4756 |
| 149 | Ga0209257_1000024 | 3300025304 | Bacteria | 726068 |
| 150 | Ga0209257_1000057 | 3300025304 | Bacteria | 396985 |
| 151 | Ga0209257_1000803 | 3300025304 | Bacteria | 45706 |
| 152 | Ga0209257_1002264 | 3300025304 | Bacteria | 19650 |
| 153 | Ga0209257_1003704 | 3300025304 | Bacteria | 12716 |
| 154 | Ga0207656_10006718 | 3300025321 | Bacteria | 4156 |
| 155 | Ga0207655_1005464 | 3300025728 | Bacteria | 8630 |
| 156 | Ga0207649_10015753 | 3300025920 | Bacteria | 4249 |
| 157 | Ga0207649_10215074 | 3300025920 | Bacteria | 1366 |
| 158 | Ga0207694_10064045 | 3300025924 | Bacteria | 2865 |
| 159 | Ga0207690_10006208 | 3300025932 | Bacteria | 7076 |
| 160 | Ga0207690_10152027 | 3300025932 | Bacteria | 1717 |
| 161 | Ga0207706_10001637 | 3300025933 | Bacteria | 22174 |
| 162 | Ga0207706_10005566 | 3300025933 | Bacteria | 11745 |
| 163 | Ga0207706_10151346 | 3300025933 | Bacteria | 2041 |
| 164 | Ga0207706_10162136 | 3300025933 | Bacteria | 1965 |
| 165 | Ga0207709_10000215 | 3300025935 | Bacteria | 73474 |
| 166 | Ga0207709_10001162 | 3300025935 | Bacteria | 19142 |
| 167 | Ga0207679_10005996 | 3300025945 | Bacteria | 7643 |
| 168 | Ga0207679_10304672 | 3300025945 | Bacteria | 1374 |
| 169 | Ga0207639_10237550 | 3300026041 | Bacteria | 1583 |
| 170 | Ga0207648_10056883 | 3300026089 | Bacteria | 3413 |
| 171 | Ga0209389_1008572 | 3300027296 | Bacteria | 9108 |
| 172 | Ga0209968_1005144 | 3300027526 | Bacteria | 1962 |
| 173 | Ga0209970_1000655 | 3300027614 | Bacteria | 6006 |
| 174 | Ga0209971_1009480 | 3300027682 | Bacteria | 2306 |
| 175 | Ga0209966_1000628 | 3300027695 | Bacteria | 8059 |
| 176 | Ga0209974_10012638 | 3300027876 | Bacteria | 2821 |
| 177 | Ga0316177_1118953 | 3300030731 | Bacteria | 1612 |
| 178 | Ga0307513_10080341 | 3300031456 | Bacteria | 3364 |
| 179 | Ga0307408_100042947 | 3300031548 | Bacteria | 3214 |
| 180 | Ga0307514_10000762 | 3300031649 | Bacteria | 53648 |
| 181 | Ga0307516_10004908 | 3300031730 | Bacteria | 16269 |
| 182 | Ga0307516_10159272 | 3300031730 | Bacteria | 2009 |
| 183 | Ga0307405_10004410 | 3300031731 | Bacteria | 6651 |
| 184 | Ga0307416_100026022 | 3300032002 | Bacteria | 4304 |
| 185 | Ga0307416_100308154 | 3300032002 | Bacteria | 1578 |
| 186 | Ga0307411_10105026 | 3300032005 | Bacteria | 2007 |
| 187 | Ga0307510_10267844 | 3300033180 | Bacteria | 1186 |
| 188 | Ga0395899_0157334 | 3300037312 | Bacteria | 1607 |
| 189 | Ga0395900_0000050 | 3300037418 | Bacteria | 224616 |
| 190 | Ga0395898_0002499 | 3300037466 | Bacteria | 21625 |
| 191 | Ga0395905_0006888 | 3300037471 | Bacteria | 11365 |
| 192 | Ga0395905_0043157 | 3300037471 | Bacteria | 4231 |
| 193 | Ga0395901_0134250 | 3300038443 | Bacteria | 2601 |
| 194 | Ga0436361_0794259 | 3300039447 | Bacteria | 17377 |
| 195 | Ga0439436_0000671 | 3300041404 | Bacteria | 9170 |
| 196 | Ga0439465_0081579 | 3300041413 | Bacteria | 1097 |
| 197 | Ga0451791_0466228 | 3300041451 | Bacteria | 1692 |
| 198 | Ga0451791_1551273 | 3300041451 | Bacteria | 1123 |
| 199 | Ga0439431_0008312 | 3300041997 | Bacteria | 2331 |
| 200 | Ga0439449_0030165 | 3300042007 | Bacteria | 2021 |
| 201 | Ga0439449_0045622 | 3300042007 | Bacteria | 1624 |
| 202 | Ga0439455_0011227 | 3300042012 | Bacteria | 1985 |
| 203 | Ga0439457_007441 | 3300042014 | Bacteria | 2627 |
| 204 | Ga0439462_0054895 | 3300042015 | Bacteria | 1074 |
| 205 | Ga0450898_008262 | 3300042134 | Bacteria | 1638 |
| 206 | Ga0439459_0000312 | 3300042438 | Bacteria | 5886 |
| 207 | Ga0451577_0000190 | 3300042876 | Bacteria | 130692 |
| 208 | Ga0451577_0000895 | 3300042876 | Bacteria | 44166 |
| 209 | Ga0451577_0205743 | 3300042876 | Bacteria | 1777 |
| 210 | Ga0466969_0000093 | 3300044656 | Bacteria | 46242 |
| 211 | Ga0466969_0059691 | 3300044656 | Bacteria | 1854 |
| 212 | Ga0466972_0006276 | 3300044658 | Bacteria | 5970 |
| 213 | Ga0466965_0062364 | 3300044683 | Bacteria | 1865 |
| 214 | Ga0466965_0130661 | 3300044683 | Bacteria | 1302 |
| 215 | Ga0466966_0115121 | 3300044684 | Bacteria | 1655 |
| 216 | Ga0466961_0002099 | 3300044693 | Bacteria | 12406 |
| 217 | Ga0466961_0105711 | 3300044693 | Bacteria | 1772 |
| 218 | Ga0466963_0009172 | 3300044694 | Bacteria | 5950 |
| 219 | Ga0466963_0084776 | 3300044694 | Bacteria | 2150 |
| 220 | Ga0466964_0011526 | 3300044706 | Bacteria | 3341 |
| 221 | Ga0466964_0104203 | 3300044706 | Bacteria | 1255 |
| 222 | Ga0453684_0000618 | 3300044712 | Bacteria | 129995 |
| 223 | Ga0453684_0271851 | 3300044712 | Bacteria | 1936 |
| 224 | Ga0466970_0009375 | 3300044765 | Bacteria | 4947 |
| 225 | Ga0466970_0028479 | 3300044765 | Bacteria | 2935 |
| 226 | Ga0466957_0067060 | 3300044842 | Bacteria | 2213 |
| 227 | Ga0466959_0000027 | 3300045049 | Bacteria | 114262 |
| 228 | Ga0466959_0115169 | 3300045049 | Bacteria | 1915 |
| 229 | Ga0451576_0001628 | 3300045051 | Bacteria | 37621 |
| 230 | Ga0451576_0006575 | 3300045051 | Bacteria | 14219 |
| 231 | Ga0466967_0006228 | 3300045976 | Bacteria | 8412 |
| 232 | Ga0495627_005576 | 3300046453 | Bacteria | 5043 |
| 233 | Ga0495590_0030475 | 3300046457 | Bacteria | 1890 |
| 234 | Ga0495638_0036626 | 3300046460 | Bacteria | 3124 |
| 235 | Ga0495650_0030577 | 3300046471 | Bacteria | 2437 |
| 236 | Ga0495605_0041655 | 3300046474 | Bacteria | 2287 |
| 237 | Ga0495610_0101098 | 3300046512 | Bacteria | 1291 |
| 238 | Ga0495616_0002528 | 3300046513 | Bacteria | 12090 |
| 239 | Ga0495620_0020644 | 3300046515 | Bacteria | 3215 |
| 240 | Ga0495631_0000553 | 3300046518 | Bacteria | 25076 |
| 241 | Ga0495654_0008030 | 3300046530 | Bacteria | 5857 |
| 242 | Ga0495625_0121423 | 3300046660 | Bacteria | 1777 |
| 243 | Ga0495635_0287633 | 3300046663 | Bacteria | 1103 |
| 244 | Ga0495658_0048933 | 3300046683 | Bacteria | 2386 |
| 245 | Ga0495670_0022068 | 3300046691 | Bacteria | 3143 |
| 246 | Ga0495687_013635 | 3300047443 | Bacteria | 4226 |
| 247 | Ga0495593_0059313 | 3300047673 | Bacteria | 2005 |
| 248 | Ga0496105_0419655 | 3300048908 | Bacteria | 1059 |
| 249 | Ga0496111_0190672 | 3300048914 | Bacteria | 1524 |
| 250 | Ga0496112_0007636 | 3300048915 | Bacteria | 9615 |
| 251 | Ga0496113_0003190 | 3300048916 | Bacteria | 9771 |
| 252 | Ga0496116_0015944 | 3300048919 | Bacteria | 5909 |
| 253 | Ga0496117_0021939 | 3300048920 | Bacteria | 5140 |
| 254 | Ga0496117_0023639 | 3300048920 | Bacteria | 4889 |
| 255 | Ga0496118_0005839 | 3300048921 | Bacteria | 13800 |
| 256 | Ga0496118_0096684 | 3300048921 | Bacteria | 2012 |
| 257 | Ga0496118_0098633 | 3300048921 | Bacteria | 1983 |
| 258 | Ga0496121_0016431 | 3300048924 | Bacteria | 7645 |
| 259 | Ga0496121_0066885 | 3300048924 | Bacteria | 2915 |
| 260 | Ga0496122_0000204 | 3300048925 | Bacteria | 132123 |
| 261 | Ga0496122_0073005 | 3300048925 | Bacteria | 2436 |
| 262 | Ga0496122_0170585 | 3300048925 | Bacteria | 1312 |
| 263 | Ga0496123_0001226 | 3300048926 | Bacteria | 37377 |
| 264 | Ga0496123_0048326 | 3300048926 | Bacteria | 2863 |
| 265 | Ga0496123_0059852 | 3300048926 | Bacteria | 2459 |
| 266 | Ga0496123_0174333 | 3300048926 | Bacteria | 1131 |
| 267 | Ga0496124_0000138 | 3300048927 | Bacteria | 150311 |
| 268 | Ga0496124_0008218 | 3300048927 | Bacteria | 10946 |
| 269 | Ga0496124_0011865 | 3300048927 | Bacteria | 8676 |
| 270 | Ga0496124_0031874 | 3300048927 | Bacteria | 4661 |
| 271 | Ga0496125_0005833 | 3300048928 | Bacteria | 13526 |
| 272 | Ga0496125_0052465 | 3300048928 | Bacteria | 3353 |
| 273 | Ga0496126_0233182 | 3300048929 | Bacteria | 1541 |
| 274 | Ga0496126_0278187 | 3300048929 | Bacteria | 1387 |
| 275 | nmdc:mga03n38_219443_c1 | 3300050490 | Bacteria | 992 |
| 276 | nmdc:mga0yw44_657_c1 | 3300050492 | Bacteria | 12590 |
| 277 | nmdc:mga0k408_129179_c1 | 3300050493 | Bacteria | 1500 |
| 278 | nmdc:mga07m45_14640_c1 | 3300050496 | Bacteria | 4183 |
| 279 | nmdc:mga07m45_193614_c1 | 3300050496 | Bacteria | 1183 |
| 280 | nmdc:mga07m45_26917_c1 | 3300050496 | Bacteria | 3163 |
| 281 | Ga0500651_0000137 | 3300053093 | Bacteria | 45846 |
| 282 | Ga0500651_0040578 | 3300053093 | Bacteria | 2932 |
| 283 | Ga0500560_048912 | 3300053107 | Bacteria | 1352 |
| 284 | Ga0500571_000067 | 3300053110 | Bacteria | 32699 |
| 285 | Ga0500593_000318 | 3300053117 | Bacteria | 19357 |
| 286 | Ga0500594_0001202 | 3300053118 | Bacteria | 5591 |
| 287 | Ga0500594_0052207 | 3300053118 | Bacteria | 1155 |
| 288 | Ga0500607_052565 | 3300053121 | Bacteria | 2162 |
| 289 | Ga0500608_059903 | 3300053122 | Bacteria | 1821 |
| 290 | Ga0500618_024559 | 3300053125 | Bacteria | 1451 |
| 291 | Ga0500655_002350 | 3300053133 | Bacteria | 3467 |
| 292 | Ga0500658_0000836 | 3300053134 | Bacteria | 12678 |
| 293 | Ga0500658_0001025 | 3300053134 | Bacteria | 11402 |
| 294 | Ga0500559_0001487 | 3300053136 | Bacteria | 13220 |
| 295 | Ga0500559_0001525 | 3300053136 | Bacteria | 12983 |
| 296 | Ga0500559_0002957 | 3300053136 | Bacteria | 8540 |
| 297 | Ga0500568_0004221 | 3300053139 | Bacteria | 7737 |
| 298 | Ga0500568_0008403 | 3300053139 | Bacteria | 4975 |
| 299 | Ga0500616_0038378 | 3300053153 | Bacteria | 2587 |
| 300 | Ga0500622_0004002 | 3300053156 | Bacteria | 9498 |
| 301 | Ga0500634_0002032 | 3300053161 | Bacteria | 8314 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009148 | Ga0105243_10028330 | Ga0105243_100283302 | 246 |
| 2 | 3300006058 | Ga0075432_10002702 | Ga0075432_100027028 | 256 |
| 3 | 3300005344 | Ga0070661_100011952 | Ga0070661_1000119522 | 261 |
| 4 | 3300005564 | Ga0070664_100042036 | Ga0070664_1000420364 | 261 |
| 5 | 3300025920 | Ga0207649_10015753 | Ga0207649_100157534 | 261 |
| 6 | 3300025945 | Ga0207679_10005996 | Ga0207679_100059962 | 261 |
| 7 | 3300005366 | Ga0070659_100002665 | Ga0070659_1000026653 | 262 |
| 8 | 3300005457 | Ga0070662_100117765 | Ga0070662_1001177652 | 262 |
| 9 | 3300005843 | Ga0068860_100050041 | Ga0068860_1000500415 | 262 |
| 10 | 3300014968 | Ga0157379_10065073 | Ga0157379_100650733 | 262 |
| 11 | 3300025932 | Ga0207690_10006208 | Ga0207690_100062083 | 262 |
| 12 | 3300025933 | Ga0207706_10151346 | Ga0207706_101513462 | 262 |
| 13 | 3300042876 | Ga0451577_0000895 | Ga0451577_0000895_12445_13305 | 263 |
| 14 | 3300042134 | Ga0450898_008262 | Ga0450898_008262_73_879 | 265 |
| 15 | 3300003759 | Ga0055525_1000004 | Ga0055525_1000004555 | 266 |
| 16 | 3300025230 | Ga0209563_100013 | Ga0209563_100013555 | 266 |
| 17 | 3300033180 | Ga0307510_10267844 | Ga0307510_102678441 | 266 |
| 18 | 3300042012 | Ga0439455_0011227 | Ga0439455_0011227_506_1312 | 266 |
| 19 | 3300003323 | rootH1_10006141 | rootH1_100061413 | 267 |
| 20 | 3300003771 | Ga0055526_1002708 | Ga0055526_10027089 | 267 |
| 21 | 3300003775 | Ga0055524_1000624 | Ga0055524_10006246 | 267 |
| 22 | 3300003775 | Ga0055524_1007033 | Ga0055524_10070333 | 267 |
| 23 | 3300003792 | Ga0055540_1024224 | Ga0055540_10242242 | 267 |
| 24 | 3300003794 | Ga0055531_10002742 | Ga0055531_100027424 | 267 |
| 25 | 3300004625 | Ga0055543_1003616 | Ga0055543_10036162 | 267 |
| 26 | 3300005262 | Ga0065165_1000129 | Ga0065165_100012923 | 267 |
| 27 | 3300005262 | Ga0065165_1000344 | Ga0065165_100034450 | 267 |
| 28 | 3300005455 | Ga0070663_100318151 | Ga0070663_1003181512 | 267 |
| 29 | 3300005457 | Ga0070662_100022288 | Ga0070662_1000222882 | 267 |
| 30 | 3300006195 | Ga0075366_10032956 | Ga0075366_100329563 | 267 |
| 31 | 3300006944 | Ga0099823_1000038 | Ga0099823_100003832 | 267 |
| 32 | 3300012475 | Ga0157317_1000239 | Ga0157317_10002392 | 267 |
| 33 | 3300012497 | Ga0157319_1000003 | Ga0157319_1000003161 | 267 |
| 34 | 3300014326 | Ga0157380_10415613 | Ga0157380_104156132 | 267 |
| 35 | 3300021361 | Ga0213872_10001026 | Ga0213872_100010268 | 267 |
| 36 | 3300025273 | Ga0209673_1004159 | Ga0209673_10041597 | 267 |
| 37 | 3300025273 | Ga0209673_1009381 | Ga0209673_10093813 | 267 |
| 38 | 3300025295 | Ga0209564_1000003 | Ga0209564_1000003167 | 267 |
| 39 | 3300025298 | Ga0209050_1000143 | Ga0209050_1000143108 | 267 |
| 40 | 3300025299 | Ga0209256_1000150 | Ga0209256_1000150115 | 267 |
| 41 | 3300025299 | Ga0209256_1000521 | Ga0209256_100052134 | 267 |
| 42 | 3300025303 | Ga0209051_1000876 | Ga0209051_100087623 | 267 |
| 43 | 3300025304 | Ga0209257_1000803 | Ga0209257_100080313 | 267 |
| 44 | 3300025304 | Ga0209257_1002264 | Ga0209257_100226410 | 267 |
| 45 | 3300025933 | Ga0207706_10001637 | Ga0207706_1000163714 | 267 |
| 46 | 3300025945 | Ga0207679_10304672 | Ga0207679_103046721 | 267 |
| 47 | 3300026089 | Ga0207648_10056883 | Ga0207648_100568833 | 267 |
| 48 | 3300027296 | Ga0209389_1008572 | Ga0209389_10085724 | 267 |
| 49 | 3300027526 | Ga0209968_1005144 | Ga0209968_10051442 | 267 |
| 50 | 3300027695 | Ga0209966_1000628 | Ga0209966_10006284 | 267 |
| 51 | 3300031649 | Ga0307514_10000762 | Ga0307514_1000076231 | 267 |
| 52 | 3300031730 | Ga0307516_10004908 | Ga0307516_100049085 | 267 |
| 53 | 3300031730 | Ga0307516_10159272 | Ga0307516_101592722 | 267 |
| 54 | 3300032002 | Ga0307416_100308154 | Ga0307416_1003081541 | 267 |
| 55 | 3300037418 | Ga0395900_0000050 | Ga0395900_0000050_191221_192039 | 267 |
| 56 | 3300037466 | Ga0395898_0002499 | Ga0395898_0002499_4576_5394 | 267 |
| 57 | 3300037471 | Ga0395905_0043157 | Ga0395905_0043157_441_1262 | 267 |
| 58 | 3300039447 | Ga0436361_0794259 | Ga0436361_0794259_4596_5441 | 267 |
| 59 | 3300041451 | Ga0451791_1551273 | Ga0451791_1551273_260_1096 | 267 |
| 60 | 3300041997 | Ga0439431_0008312 | Ga0439431_0008312_140_988 | 267 |
| 61 | 3300042007 | Ga0439449_0030165 | Ga0439449_0030165_1021_1830 | 267 |
| 62 | 3300042007 | Ga0439449_0045622 | Ga0439449_0045622_322_1170 | 267 |
| 63 | 3300042014 | Ga0439457_007441 | Ga0439457_007441_304_1152 | 267 |
| 64 | 3300042015 | Ga0439462_0054895 | Ga0439462_0054895_47_895 | 267 |
| 65 | 3300042438 | Ga0439459_0000312 | Ga0439459_0000312_3824_4648 | 267 |
| 66 | 3300042876 | Ga0451577_0205743 | Ga0451577_0205743_608_1468 | 267 |
| 67 | 3300044656 | Ga0466969_0000093 | Ga0466969_0000093_24377_25258 | 267 |
| 68 | 3300044656 | Ga0466969_0059691 | Ga0466969_0059691_131_994 | 267 |
| 69 | 3300044658 | Ga0466972_0006276 | Ga0466972_0006276_3879_4700 | 267 |
| 70 | 3300044683 | Ga0466965_0062364 | Ga0466965_0062364_486_1298 | 267 |
| 71 | 3300044683 | Ga0466965_0130661 | Ga0466965_0130661_135_998 | 267 |
| 72 | 3300044684 | Ga0466966_0115121 | Ga0466966_0115121_709_1590 | 267 |
| 73 | 3300044693 | Ga0466961_0002099 | Ga0466961_0002099_5045_5908 | 267 |
| 74 | 3300044693 | Ga0466961_0105711 | Ga0466961_0105711_277_1158 | 267 |
| 75 | 3300044694 | Ga0466963_0009172 | Ga0466963_0009172_1649_2512 | 267 |
| 76 | 3300044694 | Ga0466963_0084776 | Ga0466963_0084776_794_1636 | 267 |
| 77 | 3300044706 | Ga0466964_0011526 | Ga0466964_0011526_414_1277 | 267 |
| 78 | 3300044706 | Ga0466964_0104203 | Ga0466964_0104203_376_1197 | 267 |
| 79 | 3300044712 | Ga0453684_0271851 | Ga0453684_0271851_672_1487 | 267 |
| 80 | 3300044765 | Ga0466970_0009375 | Ga0466970_0009375_1509_2321 | 267 |
| 81 | 3300044765 | Ga0466970_0028479 | Ga0466970_0028479_1865_2728 | 267 |
| 82 | 3300044842 | Ga0466957_0067060 | Ga0466957_0067060_44_907 | 267 |
| 83 | 3300045049 | Ga0466959_0000027 | Ga0466959_0000027_108962_109825 | 267 |
| 84 | 3300045049 | Ga0466959_0115169 | Ga0466959_0115169_992_1873 | 267 |
| 85 | 3300045051 | Ga0451576_0006575 | Ga0451576_0006575_2476_3291 | 267 |
| 86 | 3300045976 | Ga0466967_0006228 | Ga0466967_0006228_1825_2688 | 267 |
| 87 | 3300046457 | Ga0495590_0030475 | Ga0495590_0030475_328_1203 | 267 |
| 88 | 3300046474 | Ga0495605_0041655 | Ga0495605_0041655_1311_2186 | 267 |
| 89 | 3300046691 | Ga0495670_0022068 | Ga0495670_0022068_1280_2257 | 267 |
| 90 | 3300047443 | Ga0495687_013635 | Ga0495687_013635_1978_2853 | 267 |
| 91 | 3300048921 | Ga0496118_0096684 | Ga0496118_0096684_813_1634 | 267 |
| 92 | 3300048924 | Ga0496121_0016431 | Ga0496121_0016431_3688_4509 | 267 |
| 93 | 3300048927 | Ga0496124_0000138 | Ga0496124_0000138_91174_91998 | 267 |
| 94 | 3300048927 | Ga0496124_0008218 | Ga0496124_0008218_2102_2986 | 267 |
| 95 | 3300048928 | Ga0496125_0005833 | Ga0496125_0005833_1948_2772 | 267 |
| 96 | 3300048929 | Ga0496126_0233182 | Ga0496126_0233182_57_881 | 267 |
| 97 | 3300050490 | nmdc:mga03n38_219443_c1 | nmdc:mga03n38_219443_c1_91_963 | 267 |
| 98 | 3300050493 | nmdc:mga0k408_129179_c1 | nmdc:mga0k408_129179_c1_61_942 | 267 |
| 99 | 3300050496 | nmdc:mga07m45_193614_c1 | nmdc:mga07m45_193614_c1_282_1163 | 267 |
| 100 | 3300050496 | nmdc:mga07m45_26917_c1 | nmdc:mga07m45_26917_c1_718_1536 | 267 |
| 101 | 3300053117 | Ga0500593_000318 | Ga0500593_000318_12750_13562 | 267 |
| 102 | 3300053136 | Ga0500559_0002957 | Ga0500559_0002957_7524_8351 | 267 |
| 103 | 3300053139 | Ga0500568_0008403 | Ga0500568_0008403_2979_3809 | 267 |
| 104 | 3300053156 | Ga0500622_0004002 | Ga0500622_0004002_4376_5353 | 267 |
| 105 | iso_pu_bacteria | 2588253510 | 2588290955 | 267 |
| 106 | iso_pu_bacteria | 2643221592 | 2643972106 | 267 |
| 107 | iso_pu_bacteria | 2643221625 | 2644142306 | 267 |
| 108 | iso_pu_bacteria | 2643221648 | 2644275999 | 267 |
| 109 | iso_pu_bacteria | 2643221654 | 2644301454 | 267 |
| 110 | iso_pu_bacteria | 2643221660 | 2644340453 | 267 |
| 111 | iso_pu_bacteria | 2831864461 | 2831865937 | 267 |
| 112 | 3300005355 | Ga0070671_100012286 | Ga0070671_1000122862 | 268 |
| 113 | 3300005618 | Ga0068864_100286979 | Ga0068864_1002869792 | 268 |
| 114 | 3300009177 | Ga0105248_10001747 | Ga0105248_1000174715 | 268 |
| 115 | 3300037471 | Ga0395905_0006888 | Ga0395905_0006888_3743_4549 | 268 |
| 116 | 3300048908 | Ga0496105_0419655 | Ga0496105_0419655_76_939 | 268 |
| 117 | 3300048914 | Ga0496111_0190672 | Ga0496111_0190672_252_1115 | 268 |
| 118 | 3300048915 | Ga0496112_0007636 | Ga0496112_0007636_4210_5073 | 268 |
| 119 | 3300048916 | Ga0496113_0003190 | Ga0496113_0003190_1215_2078 | 268 |
| 120 | 3300050492 | nmdc:mga0yw44_657_c1 | nmdc:mga0yw44_657_c1_4553_5377 | 268 |
| 121 | iso_pu_bacteria | 2928115317 | 2928120694 | 268 |
| 122 | 3300031456 | Ga0307513_10080341 | Ga0307513_100803415 | 269 |
| 123 | 3300037312 | Ga0395899_0157334 | Ga0395899_0157334_583_1401 | 269 |
| 124 | 3300038443 | Ga0395901_0134250 | Ga0395901_0134250_194_1108 | 269 |
| 125 | iso_pu_bacteria | 2643221672 | 2644399251 | 269 |
| 126 | iso_pu_bacteria | 2643221683 | 2644467067 | 269 |
| 127 | iso_pu_bacteria | 2885192300 | 2885196908 | 269 |
| 128 | 3300042876 | Ga0451577_0000190 | Ga0451577_0000190_8517_9368 | 270 |
| 129 | 3300044712 | Ga0453684_0000618 | Ga0453684_0000618_120946_121797 | 270 |
| 130 | 3300045051 | Ga0451576_0001628 | Ga0451576_0001628_28480_29331 | 270 |
| 131 | iso_pu_bacteria | 2513020051 | 2513231059 | 270 |
| 132 | iso_pu_bacteria | 2643221658 | 2644325527 | 270 |
| 133 | iso_pu_bacteria | 2738541277 | 2738718224 | 270 |
| 134 | iso_pu_bacteria | 2738541307 | 2738880386 | 270 |
| 135 | iso_pu_bacteria | 2738543019 | 2739281411 | 270 |
| 136 | iso_pu_bacteria | 2818991446 | 2819600542 | 270 |
| 137 | iso_pu_bacteria | 2831265667 | 2831267732 | 270 |
| 138 | iso_pu_bacteria | 2838054893 | 2838061540 | 270 |
| 139 | iso_pu_bacteria | 2842733646 | 2842736334 | 270 |
| 140 | iso_pu_bacteria | 2842747753 | 2842748843 | 270 |
| 141 | iso_pu_bacteria | 2885198086 | 2885198798 | 270 |
| 142 | iso_pu_bacteria | 2885211737 | 2885211822 | 270 |
| 143 | iso_pu_bacteria | 2899924645 | 2899928311 | 270 |
| 144 | iso_pu_bacteria | 2928037797 | 2928041263 | 270 |
| 145 | iso_pu_bacteria | 2928044640 | 2928048105 | 270 |
| 146 | iso_pu_bacteria | 2928051484 | 2928055946 | 270 |
| 147 | iso_pu_bacteria | 2928064002 | 2928066573 | 270 |
| 148 | iso_pu_bacteria | 2928084124 | 2928087574 | 270 |
| 149 | iso_pu_bacteria | 2954767861 | 2954768800 | 270 |
| 150 | 3300003504 | JGI26138J51218_100586 | JGI26138J51218_1005862 | 271 |
| 151 | 3300027614 | Ga0209970_1000655 | Ga0209970_10006553 | 271 |
| 152 | 3300053136 | Ga0500559_0001487 | Ga0500559_0001487_7513_8337 | 271 |
| 153 | iso_pu_bacteria | 2919704043 | 2919707164 | 271 |
| 154 | 3300027682 | Ga0209971_1009480 | Ga0209971_10094803 | 272 |
| 155 | 3300041451 | Ga0451791_0466228 | Ga0451791_0466228_65_889 | 272 |
| 156 | 3300048925 | Ga0496122_0000204 | Ga0496122_0000204_110911_111741 | 272 |
| 157 | 3300048926 | Ga0496123_0001226 | Ga0496123_0001226_16739_17569 | 272 |
| 158 | 3300048929 | Ga0496126_0278187 | Ga0496126_0278187_57_887 | 272 |
| 159 | 3300053093 | Ga0500651_0040578 | Ga0500651_0040578_1738_2559 | 272 |
| 160 | 3300053118 | Ga0500594_0052207 | Ga0500594_0052207_76_903 | 272 |
| 161 | 3300053125 | Ga0500618_024559 | Ga0500618_024559_128_955 | 272 |
| 162 | iso_pu_bacteria | 2643221596 | 2643991665 | 272 |
| 163 | 3300003781 | Ga0055536_1004758 | Ga0055536_10047588 | 273 |
| 164 | 3300003781 | Ga0055536_1006164 | Ga0055536_10061649 | 273 |
| 165 | 3300003791 | Ga0055530_10004408 | Ga0055530_100044085 | 273 |
| 166 | 3300003792 | Ga0055540_1003828 | Ga0055540_10038289 | 273 |
| 167 | 3300003792 | Ga0055540_1004055 | Ga0055540_10040554 | 273 |
| 168 | 3300003794 | Ga0055531_10002552 | Ga0055531_1000255214 | 273 |
| 169 | 3300005344 | Ga0070661_100153249 | Ga0070661_1001532492 | 273 |
| 170 | 3300005366 | Ga0070659_100047192 | Ga0070659_1000471923 | 273 |
| 171 | 3300005457 | Ga0070662_100004015 | Ga0070662_10000401512 | 273 |
| 172 | 3300005457 | Ga0070662_100181353 | Ga0070662_1001813531 | 273 |
| 173 | 3300005563 | Ga0068855_100226216 | Ga0068855_1002262162 | 273 |
| 174 | 3300006195 | Ga0075366_10305800 | Ga0075366_103058002 | 273 |
| 175 | 3300009093 | Ga0105240_10082717 | Ga0105240_100827175 | 273 |
| 176 | 3300009148 | Ga0105243_10004593 | Ga0105243_1000459312 | 273 |
| 177 | 3300014497 | Ga0182008_10136744 | Ga0182008_101367442 | 273 |
| 178 | 3300025292 | Ga0209676_1003243 | Ga0209676_10032438 | 273 |
| 179 | 3300025292 | Ga0209676_1004667 | Ga0209676_100466710 | 273 |
| 180 | 3300025298 | Ga0209050_1002640 | Ga0209050_10026407 | 273 |
| 181 | 3300025303 | Ga0209051_1001048 | Ga0209051_100104826 | 273 |
| 182 | 3300025303 | Ga0209051_1003164 | Ga0209051_100316412 | 273 |
| 183 | 3300025304 | Ga0209257_1000057 | Ga0209257_1000057260 | 273 |
| 184 | 3300025920 | Ga0207649_10215074 | Ga0207649_102150742 | 273 |
| 185 | 3300025935 | Ga0207709_10000215 | Ga0207709_1000021518 | 273 |
| 186 | 3300027876 | Ga0209974_10012638 | Ga0209974_100126384 | 273 |
| 187 | 3300030731 | Ga0316177_1118953 | Ga0316177_11189531 | 273 |
| 188 | 3300031731 | Ga0307405_10004410 | Ga0307405_100044107 | 273 |
| 189 | 3300032002 | Ga0307416_100026022 | Ga0307416_1000260227 | 273 |
| 190 | 3300032005 | Ga0307411_10105026 | Ga0307411_101050262 | 273 |
| 191 | 3300041404 | Ga0439436_0000671 | Ga0439436_0000671_158_985 | 273 |
| 192 | 3300041413 | Ga0439465_0081579 | Ga0439465_0081579_156_983 | 273 |
| 193 | 3300046471 | Ga0495650_0030577 | Ga0495650_0030577_1253_2083 | 273 |
| 194 | 3300048926 | Ga0496123_0174333 | Ga0496123_0174333_151_993 | 273 |
| 195 | 3300053121 | Ga0500607_052565 | Ga0500607_052565_1149_1970 | 273 |
| 196 | 3300002773 | JGI25152J39213_1001945 | JGI25152J39213_10019459 | 274 |
| 197 | 3300002773 | JGI25152J39213_1002156 | JGI25152J39213_10021567 | 274 |
| 198 | 3300002774 | JGI25150J39212_1002677 | JGI25150J39212_10026772 | 274 |
| 199 | 3300002987 | JGI25159J45721_1001946 | JGI25159J45721_10019465 | 274 |
| 200 | 3300003187 | JGI25151J46595_10006122 | JGI25151J46595_100061222 | 274 |
| 201 | 3300003187 | JGI25151J46595_10018335 | JGI25151J46595_100183354 | 274 |
| 202 | 3300003215 | JGI25153J46596_10006229 | JGI25153J46596_100062292 | 274 |
| 203 | 3300003320 | rootH2_10019901 | rootH2_100199012 | 274 |
| 204 | 3300003323 | rootH1_10013234 | rootH1_100132341 | 274 |
| 205 | 3300003354 | JGI25160J50197_1002666 | JGI25160J50197_10026665 | 274 |
| 206 | 3300003354 | JGI25160J50197_1006098 | JGI25160J50197_10060984 | 274 |
| 207 | 3300003374 | JGI25161J50226_1001766 | JGI25161J50226_10017669 | 274 |
| 208 | 3300003578 | Ga0006562J51391_1010057 | Ga0006562J51391_101005717 | 274 |
| 209 | 3300003578 | Ga0006562J51391_1015350 | Ga0006562J51391_10153502 | 274 |
| 210 | 3300003760 | Ga0055527_1011649 | Ga0055527_10116491 | 274 |
| 211 | 3300003761 | Ga0055535_1000380 | Ga0055535_100038024 | 274 |
| 212 | 3300003762 | Ga0055542_1000062 | Ga0055542_1000062144 | 274 |
| 213 | 3300003771 | Ga0055526_1006802 | Ga0055526_10068022 | 274 |
| 214 | 3300003771 | Ga0055526_1006863 | Ga0055526_10068632 | 274 |
| 215 | 3300003773 | Ga0055537_1000550 | Ga0055537_100055021 | 274 |
| 216 | 3300003773 | Ga0055537_1002506 | Ga0055537_10025062 | 274 |
| 217 | 3300003773 | Ga0055537_1005807 | Ga0055537_10058075 | 274 |
| 218 | 3300003775 | Ga0055524_1004870 | Ga0055524_10048702 | 274 |
| 219 | 3300003775 | Ga0055524_1004908 | Ga0055524_10049089 | 274 |
| 220 | 3300003781 | Ga0055536_1014016 | Ga0055536_10140164 | 274 |
| 221 | 3300003784 | Ga0055534_1002628 | Ga0055534_10026282 | 274 |
| 222 | 3300003784 | Ga0055534_1002657 | Ga0055534_100265710 | 274 |
| 223 | 3300003790 | Ga0055528_1005215 | Ga0055528_10052152 | 274 |
| 224 | 3300003790 | Ga0055528_1012761 | Ga0055528_10127615 | 274 |
| 225 | 3300003791 | Ga0055530_10002499 | Ga0055530_1000249914 | 274 |
| 226 | 3300003791 | Ga0055530_10002623 | Ga0055530_100026237 | 274 |
| 227 | 3300003792 | Ga0055540_1003710 | Ga0055540_10037109 | 274 |
| 228 | 3300003792 | Ga0055540_1008094 | Ga0055540_10080945 | 274 |
| 229 | 3300003794 | Ga0055531_10007057 | Ga0055531_100070579 | 274 |
| 230 | 3300003794 | Ga0055531_10007106 | Ga0055531_100071069 | 274 |
| 231 | 3300004625 | Ga0055543_1000989 | Ga0055543_10009895 | 274 |
| 232 | 3300004625 | Ga0055543_1001878 | Ga0055543_10018789 | 274 |
| 233 | 3300005262 | Ga0065165_1004528 | Ga0065165_10045289 | 274 |
| 234 | 3300005262 | Ga0065165_1010737 | Ga0065165_10107376 | 274 |
| 235 | 3300005539 | Ga0068853_100190433 | Ga0068853_1001904331 | 274 |
| 236 | 3300005834 | Ga0068851_10030593 | Ga0068851_100305933 | 274 |
| 237 | 3300006186 | Ga0075369_10017183 | Ga0075369_100171832 | 274 |
| 238 | 3300006353 | Ga0075370_10005920 | Ga0075370_100059205 | 274 |
| 239 | 3300006353 | Ga0075370_10016644 | Ga0075370_100166446 | 274 |
| 240 | 3300009036 | Ga0105244_10003426 | Ga0105244_1000342614 | 274 |
| 241 | 3300009093 | Ga0105240_10581509 | Ga0105240_105815092 | 274 |
| 242 | 3300009098 | Ga0105245_10359532 | Ga0105245_103595323 | 274 |
| 243 | 3300009148 | Ga0105243_10004693 | Ga0105243_100046934 | 274 |
| 244 | 3300009551 | Ga0105238_10092567 | Ga0105238_100925674 | 274 |
| 245 | 3300010375 | Ga0105239_10643745 | Ga0105239_106437452 | 274 |
| 246 | 3300013102 | Ga0157371_10008532 | Ga0157371_100085329 | 274 |
| 247 | 3300013102 | Ga0157371_10308459 | Ga0157371_103084592 | 274 |
| 248 | 3300014497 | Ga0182008_10001756 | Ga0182008_1000175614 | 274 |
| 249 | 3300015261 | Ga0182006_1000705 | Ga0182006_10007057 | 274 |
| 250 | 3300015261 | Ga0182006_1033676 | Ga0182006_10336761 | 274 |
| 251 | 3300015262 | Ga0182007_10000957 | Ga0182007_1000095715 | 274 |
| 252 | 3300017792 | Ga0163161_10042530 | Ga0163161_100425304 | 274 |
| 253 | 3300025208 | Ga0209436_110461 | Ga0209436_1104612 | 274 |
| 254 | 3300025228 | Ga0209672_101806 | Ga0209672_1018065 | 274 |
| 255 | 3300025242 | Ga0209258_100154 | Ga0209258_10015431 | 274 |
| 256 | 3300025245 | Ga0207425_1001372 | Ga0207425_10013729 | 274 |
| 257 | 3300025245 | Ga0207425_1011150 | Ga0207425_10111502 | 274 |
| 258 | 3300025254 | Ga0209148_1000145 | Ga0209148_100014531 | 274 |
| 259 | 3300025258 | Ga0209129_1000054 | Ga0209129_100005470 | 274 |
| 260 | 3300025258 | Ga0209129_1004503 | Ga0209129_10045035 | 274 |
| 261 | 3300025263 | Ga0209565_1000185 | Ga0209565_10001855 | 274 |
| 262 | 3300025263 | Ga0209565_1001534 | Ga0209565_10015345 | 274 |
| 263 | 3300025273 | Ga0209673_1000172 | Ga0209673_100017276 | 274 |
| 264 | 3300025273 | Ga0209673_1003839 | Ga0209673_10038399 | 274 |
| 265 | 3300025284 | Ga0209130_1001009 | Ga0209130_100100918 | 274 |
| 266 | 3300025284 | Ga0209130_1001241 | Ga0209130_100124114 | 274 |
| 267 | 3300025291 | Ga0209675_1001255 | Ga0209675_100125514 | 274 |
| 268 | 3300025291 | Ga0209675_1004900 | Ga0209675_10049005 | 274 |
| 269 | 3300025292 | Ga0209676_1000103 | Ga0209676_100010317 | 274 |
| 270 | 3300025292 | Ga0209676_1004823 | Ga0209676_10048239 | 274 |
| 271 | 3300025294 | Ga0209025_1000310 | Ga0209025_100031020 | 274 |
| 272 | 3300025294 | Ga0209025_1000474 | Ga0209025_10004747 | 274 |
| 273 | 3300025294 | Ga0209025_1010766 | Ga0209025_10107665 | 274 |
| 274 | 3300025295 | Ga0209564_1000241 | Ga0209564_100024166 | 274 |
| 275 | 3300025295 | Ga0209564_1001015 | Ga0209564_100101526 | 274 |
| 276 | 3300025297 | Ga0209758_1000034 | Ga0209758_1000034368 | 274 |
| 277 | 3300025297 | Ga0209758_1009936 | Ga0209758_10099366 | 274 |
| 278 | 3300025298 | Ga0209050_1000012 | Ga0209050_1000012402 | 274 |
| 279 | 3300025298 | Ga0209050_1000294 | Ga0209050_100029470 | 274 |
| 280 | 3300025299 | Ga0209256_1000103 | Ga0209256_100010372 | 274 |
| 281 | 3300025299 | Ga0209256_1000165 | Ga0209256_100016583 | 274 |
| 282 | 3300025302 | Ga0207426_1000058 | Ga0207426_1000058200 | 274 |
| 283 | 3300025302 | Ga0207426_1000067 | Ga0207426_1000067257 | 274 |
| 284 | 3300025303 | Ga0209051_1000019 | Ga0209051_1000019321 | 274 |
| 285 | 3300025303 | Ga0209051_1010246 | Ga0209051_10102464 | 274 |
| 286 | 3300025304 | Ga0209257_1000024 | Ga0209257_1000024348 | 274 |
| 287 | 3300025304 | Ga0209257_1003704 | Ga0209257_100370414 | 274 |
| 288 | 3300025321 | Ga0207656_10006718 | Ga0207656_100067185 | 274 |
| 289 | 3300025728 | Ga0207655_1005464 | Ga0207655_100546410 | 274 |
| 290 | 3300025924 | Ga0207694_10064045 | Ga0207694_100640452 | 274 |
| 291 | 3300025932 | Ga0207690_10152027 | Ga0207690_101520272 | 274 |
| 292 | 3300025933 | Ga0207706_10005566 | Ga0207706_100055669 | 274 |
| 293 | 3300025933 | Ga0207706_10162136 | Ga0207706_101621361 | 274 |
| 294 | 3300025935 | Ga0207709_10001162 | Ga0207709_100011626 | 274 |
| 295 | 3300026041 | Ga0207639_10237550 | Ga0207639_102375501 | 274 |
| 296 | 3300031548 | Ga0307408_100042947 | Ga0307408_1000429472 | 274 |
| 297 | 3300046453 | Ga0495627_005576 | Ga0495627_005576_3517_4341 | 274 |
| 298 | 3300046460 | Ga0495638_0036626 | Ga0495638_0036626_651_1475 | 274 |
| 299 | 3300046512 | Ga0495610_0101098 | Ga0495610_0101098_238_1062 | 274 |
| 300 | 3300046513 | Ga0495616_0002528 | Ga0495616_0002528_6198_7022 | 274 |
| 301 | 3300046515 | Ga0495620_0020644 | Ga0495620_0020644_902_1726 | 274 |
| 302 | 3300046518 | Ga0495631_0000553 | Ga0495631_0000553_15930_16754 | 274 |
| 303 | 3300046530 | Ga0495654_0008030 | Ga0495654_0008030_4915_5739 | 274 |
| 304 | 3300046660 | Ga0495625_0121423 | Ga0495625_0121423_519_1343 | 274 |
| 305 | 3300046663 | Ga0495635_0287633 | Ga0495635_0287633_226_1050 | 274 |
| 306 | 3300046683 | Ga0495658_0048933 | Ga0495658_0048933_242_1066 | 274 |
| 307 | 3300047673 | Ga0495593_0059313 | Ga0495593_0059313_245_1069 | 274 |
| 308 | 3300048919 | Ga0496116_0015944 | Ga0496116_0015944_1623_2447 | 274 |
| 309 | 3300048920 | Ga0496117_0021939 | Ga0496117_0021939_1305_2129 | 274 |
| 310 | 3300048920 | Ga0496117_0023639 | Ga0496117_0023639_1656_2480 | 274 |
| 311 | 3300048921 | Ga0496118_0005839 | Ga0496118_0005839_9501_10325 | 274 |
| 312 | 3300048921 | Ga0496118_0098633 | Ga0496118_0098633_46_870 | 274 |
| 313 | 3300048924 | Ga0496121_0066885 | Ga0496121_0066885_65_889 | 274 |
| 314 | 3300048925 | Ga0496122_0073005 | Ga0496122_0073005_708_1532 | 274 |
| 315 | 3300048925 | Ga0496122_0170585 | Ga0496122_0170585_45_869 | 274 |
| 316 | 3300048926 | Ga0496123_0048326 | Ga0496123_0048326_1716_2540 | 274 |
| 317 | 3300048926 | Ga0496123_0059852 | Ga0496123_0059852_38_862 | 274 |
| 318 | 3300048927 | Ga0496124_0011865 | Ga0496124_0011865_6191_7015 | 274 |
| 319 | 3300048927 | Ga0496124_0031874 | Ga0496124_0031874_1631_2455 | 274 |
| 320 | 3300048928 | Ga0496125_0052465 | Ga0496125_0052465_1580_2404 | 274 |
| 321 | 3300050496 | nmdc:mga07m45_14640_c1 | nmdc:mga07m45_14640_c1_2798_3622 | 274 |
| 322 | 3300053093 | Ga0500651_0000137 | Ga0500651_0000137_19167_19991 | 274 |
| 323 | 3300053107 | Ga0500560_048912 | Ga0500560_048912_298_1122 | 274 |
| 324 | 3300053110 | Ga0500571_000067 | Ga0500571_000067_16224_17048 | 274 |
| 325 | 3300053118 | Ga0500594_0001202 | Ga0500594_0001202_701_1525 | 274 |
| 326 | 3300053122 | Ga0500608_059903 | Ga0500608_059903_718_1542 | 274 |
| 327 | 3300053133 | Ga0500655_002350 | Ga0500655_002350_1845_2669 | 274 |
| 328 | 3300053134 | Ga0500658_0000836 | Ga0500658_0000836_1322_2146 | 274 |
| 329 | 3300053134 | Ga0500658_0001025 | Ga0500658_0001025_1322_2146 | 274 |
| 330 | 3300053136 | Ga0500559_0001525 | Ga0500559_0001525_8659_9483 | 274 |
| 331 | 3300053139 | Ga0500568_0004221 | Ga0500568_0004221_1757_2581 | 274 |
| 332 | 3300053153 | Ga0500616_0038378 | Ga0500616_0038378_392_1216 | 274 |
| 333 | 3300053161 | Ga0500634_0002032 | Ga0500634_0002032_6318_7142 | 274 |
| 334 | iso_pu_bacteria | 2904541872 | 2904545097 | 274 |
| 335 | iso_pu_bacteria | 2929160207 | 2929165275 | 274 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ewp-assembly1.cif.gz_A | mus musculus cep120 third c2 domain (c2c) | 0.7186 | 15 | 40 |
| 6wts-assembly1.cif.gz_C | cryoem structure of the c. sordellii lethal toxin tcsl in complex with sema6a | 0.6171 | 2 | 36 |
| 6kxt-assembly1.cif.gz_A | bon1-c2b | 0.603 | 16 | 44 |
| 4y1s-assembly1.cif.gz_A | structural basis for ca2+-mediated interaction of the perforin c2 domain with lipid membranes | 0.5647 | 13 | 40 |
| 6l0w-assembly2.cif.gz_C | structure of rld2 brx domain bound to lzy3 ccl motif | 0.5629 | 19 | 48 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A1ZBD6_215_358_2.60.40.150 | Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain | 0.6749 | 16 | 40 | 2.60.40.150 |
| af_M9PE32_646_779_2.60.40.150 | Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain | 0.6384 | 17 | 47 | 2.60.40.150 |
| af_Q12466_382_517_2.60.40.150 | Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain | 0.6279 | 16 | 40 | 2.60.40.150 |
| af_C0HDP4_212_345_2.60.40.150 | Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain | 0.6239 | 15 | 40 | 2.60.40.150 |
| af_A0A0R0FP05_243_329_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.6168 | 1 | 49 | 3.30.420.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H7ES98-F1-model_v4 | DUF429 domain-containing protein | 0.9674 | 29 | 274 |
|
| AF-A0A1H7ES98-F1-model_v4 | DUF429 domain-containing protein | 0.9598 | 29 | 274 |
|
| AF-A0A1G6NZB0-F1-model_v4 | DUF429 domain-containing protein | 0.9578 | 2 | 274 |
|
| AF-A0A1H0LBU2-F1-model_v4 | DUF429 domain-containing protein | 0.9566 | 2 | 274 |
|
| AF-A0A2Z2LIF8-F1-model_v4 | deleted | 0.9556 | 1 | 274 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar