F412411

General Info

Members Datasets Scaffolds Average Seq Length
335 209 670 142

Family's Representative Sequence

Representative Sequence 3300048917|Ga0496114_0386947|Ga0496114_0386947_39_527
Length 162
Sequence LVIGVRSIHAASRSAGQDGGMTGLIATASTVVDADKKTVWQAITDPAEVKQWFFGTDLATDWTPGSPITWSGEWEGKPYQDKGEVVAVDEPNRLEVTHFSPLTGQEDVPENYHTLVYALDADEEGTKVTITQDNNGDQDEADRNAATWAQMLESLKGHLAGG

Samples

Sample ID Description Type Environment
1 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
64 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
65 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
66 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
67 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
68 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
83 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
84 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
85 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
135 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
136 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
137 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
138 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
139 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
140 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
141 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
142 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
143 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
144 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
145 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
146 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
147 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
148 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
149 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
150 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
151 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
152 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
153 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
154 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
155 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
156 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
157 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
158 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
159 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
160 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
161 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
162 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
163 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
164 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
165 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
166 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
167 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
168 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
169 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
170 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
171 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
172 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
173 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
174 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
190 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
191 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
192 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
193 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
198 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
199 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
200 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
203 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
208 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
209 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.51
Metatranscriptomes 0.9
Isolates 0.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.79
Nodule 0
Rhizoplane 10.15
Rhizosphere 86.87
Stem 0
Stem Tuber 0
Unclassified 21.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496114_0386947 3300048917 Unclassified 1238
2 JGI25152J39213_1000086 3300002773 Bacteria 64446
3 JGI25151J46595_10022108 3300003187 Bacteria 2647
4 JGI25406J46586_10029055 3300003203 Unclassified 2098
5 JGI25407J50210_10048159 3300003373 Unclassified 1082
6 JGI25405J52794_10051324 3300003911 Bacteria 884
7 JGI25405J52794_10057289 3300003911 Unclassified 840
8 Ga0070658_10361096 3300005327 Bacteria 1244
9 Ga0070676_10655983 3300005328 Bacteria 762
10 Ga0070683_100390625 3300005329 Bacteria 1326
11 Ga0070683_100562463 3300005329 Bacteria 1090
12 Ga0068869_100160832 3300005334 Bacteria 1748
13 Ga0068869_101520664 3300005334 Bacteria 595
14 Ga0070682_100311537 3300005337 Bacteria 1159
15 Ga0068868_100309216 3300005338 Archaea 1344
16 Ga0068868_100702937 3300005338 Bacteria 904
17 Ga0070660_100507023 3300005339 Unclassified 1004
18 Ga0070668_100048075 3300005347 Unclassified 3281
19 Ga0070668_100285484 3300005347 Bacteria 1380
20 Ga0070669_100137755 3300005353 Unclassified 1879
21 Ga0070671_100335562 3300005355 Bacteria 1289
22 Ga0070671_101535459 3300005355 Bacteria 590
23 Ga0070674_100450769 3300005356 Bacteria 1062
24 Ga0070674_101671470 3300005356 Unclassified 575
25 Ga0070659_100008380 3300005366 Bacteria 7551
26 Ga0070659_100080230 3300005366 Bacteria 2605
27 Ga0070659_100260196 3300005366 Bacteria 1440
28 Ga0070708_100448549 3300005445 Bacteria 1217
29 Ga0070663_100007870 3300005455 Bacteria 6518
30 Ga0070663_100368816 3300005455 Unclassified 1166
31 Ga0070678_101734641 3300005456 Bacteria 588
32 Ga0070662_100201265 3300005457 Bacteria 1580
33 Ga0070662_100785622 3300005457 Bacteria 809
34 Ga0068867_100036847 3300005459 Bacteria 3553
35 Ga0070699_101497885 3300005518 Unclassified 619
36 Ga0068853_100299813 3300005539 Bacteria 1485
37 Ga0068853_100502650 3300005539 Unclassified 1144
38 Ga0070672_100473592 3300005543 Bacteria 1081
39 Ga0070696_101009945 3300005546 Unclassified 695
40 Ga0070693_100600970 3300005547 Bacteria 794
41 Ga0068855_100830081 3300005563 Unclassified 981
42 Ga0068855_100906105 3300005563 Bacteria 931
43 Ga0070664_100012827 3300005564 Bacteria 6816
44 Ga0070664_101035188 3300005564 Bacteria 772
45 Ga0068854_101212477 3300005578 Unclassified 676
46 Ga0068856_101730119 3300005614 Bacteria 637
47 Ga0068852_100372582 3300005616 Unclassified 1399
48 Ga0068852_100481073 3300005616 Bacteria 1234
49 Ga0068866_10112235 3300005718 Bacteria 1523
50 Ga0068861_100030440 3300005719 Bacteria 3956
51 Ga0068861_100344214 3300005719 Unclassified 1306
52 Ga0068870_10232555 3300005840 Bacteria 1134
53 Ga0068858_101568015 3300005842 Bacteria 650
54 Ga0068860_100564837 3300005843 Unclassified 1141
55 Ga0068860_101844024 3300005843 Bacteria 626
56 Ga0068862_100246309 3300005844 Bacteria 1627
57 Ga0068862_102207257 3300005844 Unclassified 562
58 Ga0081455_10003164 3300005937 Bacteria 19121
59 Ga0081455_10012617 3300005937 Bacteria 8419
60 Ga0081455_10017081 3300005937 Bacteria 6975
61 Ga0081455_10117231 3300005937 Bacteria 2104
62 Ga0081538_10000976 3300005981 Bacteria 30480
63 Ga0081538_10306079 3300005981 Unclassified 582
64 Ga0081539_10000526 3300005985 Bacteria 79609
65 Ga0075432_10000607 3300006058 Bacteria 10864
66 Ga0075428_100010720 3300006844 Bacteria 10189
67 Ga0075428_100012749 3300006844 Bacteria 9346
68 Ga0075431_100023727 3300006847 Bacteria 6279
69 Ga0075433_10015122 3300006852 Bacteria 6322
70 Ga0075434_100022237 3300006871 Bacteria 6177
71 Ga0075429_100104152 3300006880 Bacteria 2478
72 Ga0068865_100339238 3300006881 Unclassified 1214
73 Ga0075435_100014149 3300007076 Bacteria 5954
74 Ga0105244_10084707 3300009036 Bacteria 1565
75 Ga0111539_10126387 3300009094 Bacteria 2995
76 Ga0111539_10746579 3300009094 Bacteria 1139
77 Ga0111539_11670469 3300009094 Bacteria 739
78 Ga0105245_10109770 3300009098 Bacteria 2564
79 Ga0105245_10203080 3300009098 Bacteria 1904
80 Ga0105245_10813207 3300009098 Bacteria 973
81 Ga0105245_10891323 3300009098 Unclassified 931
82 Ga0105247_10149498 3300009101 Bacteria 1538
83 Ga0114129_10164219 3300009147 Bacteria 3031
84 Ga0105243_10009173 3300009148 Bacteria 7554
85 Ga0105243_10021332 3300009148 Bacteria 4916
86 Ga0105243_10058381 3300009148 Bacteria 3075
87 Ga0105243_10079608 3300009148 Archaea 2671
88 Ga0105243_10670653 3300009148 Bacteria 1007
89 Ga0105242_10013269 3300009176 Bacteria 6362
90 Ga0105242_10057025 3300009176 Bacteria 3197
91 Ga0105242_10385243 3300009176 Bacteria 1304
92 Ga0105237_10396974 3300009545 Archaea 1384
93 Ga0105238_11039522 3300009551 Unclassified 841
94 Ga0105249_10152540 3300009553 Bacteria 2225
95 Ga0105249_10250929 3300009553 Bacteria 1754
96 Ga0105249_10317058 3300009553 Bacteria 1569
97 Ga0105239_10178843 3300010375 Unclassified 2373
98 Ga0105239_10994839 3300010375 Bacteria 964
99 Ga0105239_11593466 3300010375 Bacteria 755
100 Ga0105239_12316065 3300010375 Bacteria 625
101 Ga0105246_10003484 3300011119 Bacteria 9537
102 Ga0105246_10088765 3300011119 Bacteria 2222
103 Ga0157320_1000416 3300012481 Bacteria 1688
104 Ga0157337_1001138 3300012483 Bacteria 1321
105 Ga0157322_1013173 3300012490 Unclassified 707
106 Ga0157335_1000993 3300012492 Bacteria 1450
107 Ga0157314_1003562 3300012500 Bacteria 1112
108 Ga0157315_1049276 3300012508 Unclassified 561
109 Ga0157371_10228293 3300013102 Bacteria 1338
110 Ga0157369_10677472 3300013105 Unclassified 1063
111 Ga0163162_10015277 3300013306 Bacteria 7499
112 Ga0163162_10017067 3300013306 Bacteria 7102
113 Ga0163162_10048616 3300013306 Unclassified 4250
114 Ga0163162_10278786 3300013306 Bacteria 1804
115 Ga0163162_10674655 3300013306 Bacteria 1156
116 Ga0163162_13281759 3300013306 Bacteria 518
117 Ga0157372_10047403 3300013307 Bacteria 4775
118 Ga0157372_10364421 3300013307 Bacteria 1684
119 Ga0157372_12855602 3300013307 Unclassified 553
120 Ga0157375_10093850 3300013308 Bacteria 3067
121 Ga0157375_11215745 3300013308 Bacteria 884
122 Ga0157375_11388986 3300013308 Bacteria 827
123 Ga0157375_11629024 3300013308 Bacteria 763
124 Ga0163163_10596539 3300014325 Bacteria 1168
125 Ga0163163_12116277 3300014325 Bacteria 622
126 Ga0157380_10019524 3300014326 Bacteria 5051
127 Ga0157380_10172797 3300014326 Unclassified 1890
128 Ga0157377_10044783 3300014745 Bacteria 2469
129 Ga0157376_10257336 3300014969 Bacteria 1633
130 Ga0163161_10036448 3300017792 Bacteria 3522
131 Ga0163161_10306678 3300017792 Archaea 1252
132 Ga0163161_10919100 3300017792 Unclassified 742
133 Ga0197907_11323729 3300020069 Unclassified 721
134 Ga0206350_11635640 3300020080 Unclassified 512
135 Ga0206354_10761561 3300020081 Unclassified 749
136 Ga0207425_1033831 3300025245 Bacteria 1005
137 Ga0209129_1000100 3300025258 Bacteria 162353
138 Ga0209025_1001942 3300025294 Bacteria 23851
139 Ga0209051_1023603 3300025303 Bacteria 2552
140 Ga0207642_10367319 3300025899 Unclassified 853
141 Ga0207688_10048663 3300025901 Bacteria 2368
142 Ga0207688_10275689 3300025901 Bacteria 1024
143 Ga0207643_10086181 3300025908 Bacteria 1825
144 Ga0207657_10147304 3300025919 Bacteria 1919
145 Ga0207657_10461681 3300025919 Unclassified 996
146 Ga0207694_10520660 3300025924 Bacteria 997
147 Ga0207650_10248606 3300025925 Bacteria 1439
148 Ga0207687_10016539 3300025927 Bacteria 4846
149 Ga0207690_10083550 3300025932 Bacteria 2236
150 Ga0207706_10163812 3300025933 Bacteria 1954
151 Ga0207706_10239429 3300025933 Bacteria 1586
152 Ga0207686_10133921 3300025934 Bacteria 1703
153 Ga0207686_10261689 3300025934 Bacteria 1269
154 Ga0207709_10105437 3300025935 Bacteria 1873
155 Ga0207709_10125230 3300025935 Archaea 1742
156 Ga0207709_10219666 3300025935 Unclassified 1370
157 Ga0207669_11180345 3300025937 Unclassified 648
158 Ga0207691_10455777 3300025940 Bacteria 1088
159 Ga0207691_10626379 3300025940 Unclassified 910
160 Ga0207711_10832229 3300025941 Bacteria 859
161 Ga0207689_10349090 3300025942 Bacteria 1230
162 Ga0207661_10348956 3300025944 Bacteria 1335
163 Ga0207679_10007701 3300025945 Bacteria 6842
164 Ga0207712_10100635 3300025961 Unclassified 2148
165 Ga0207712_11222466 3300025961 Unclassified 671
166 Ga0207668_10543713 3300025972 Unclassified 1005
167 Ga0207640_10425133 3300025981 Unclassified 1088
168 Ga0207677_10475830 3300026023 Bacteria 1075
169 Ga0207703_11792952 3300026035 Bacteria 590
170 Ga0207639_10634617 3300026041 Unclassified 987
171 Ga0207641_10716716 3300026088 Bacteria 986
172 Ga0207648_10521158 3300026089 Bacteria 1089
173 Ga0207648_10555370 3300026089 Bacteria 1055
174 Ga0207674_10449547 3300026116 Bacteria 1245
175 Ga0207675_100009687 3300026118 Bacteria 9014
176 Ga0207675_100053568 3300026118 Bacteria 3765
177 Ga0207683_11603762 3300026121 Bacteria 600
178 Ga0207698_10373177 3300026142 Bacteria 1355
179 Ga0207428_10000858 3300027907 Bacteria 34254
180 Ga0268266_10280306 3300028379 Bacteria 1550
181 Ga0268265_11781704 3300028380 Unclassified 622
182 Ga0265327_10138157 3300031251 Bacteria 1141
183 Ga0307408_100040233 3300031548 Bacteria 3309
184 Ga0307408_100082161 3300031548 Unclassified 2411
185 Ga0307408_101147771 3300031548 Bacteria 723
186 Ga0307408_101222864 3300031548 Unclassified 701
187 Ga0307405_10228356 3300031731 Bacteria 1370
188 Ga0307405_11464542 3300031731 Bacteria 599
189 Ga0307413_10160809 3300031824 Bacteria 1577
190 Ga0307410_10000741 3300031852 Bacteria 13672
191 Ga0307410_10073584 3300031852 Bacteria 2376
192 Ga0307410_10240207 3300031852 Bacteria 1403
193 Ga0307410_10280641 3300031852 Bacteria 1307
194 Ga0307410_10874661 3300031852 Bacteria 768
195 Ga0307406_10000021 3300031901 Bacteria 98265
196 Ga0307406_10323194 3300031901 Bacteria 1194
197 Ga0307407_10001926 3300031903 Bacteria 7853
198 Ga0307407_10110186 3300031903 Bacteria 1726
199 Ga0307407_10118914 3300031903 Bacteria 1671
200 Ga0307407_10441502 3300031903 Unclassified 942
201 Ga0307407_10615630 3300031903 Unclassified 810
202 Ga0307412_10252077 3300031911 Bacteria 1371
203 Ga0307412_10317899 3300031911 Bacteria 1237
204 Ga0307412_11180346 3300031911 Bacteria 685
205 Ga0307412_11397500 3300031911 Bacteria 633
206 Ga0307409_100000027 3300031995 Bacteria 50583
207 Ga0307409_100085605 3300031995 Bacteria 2563
208 Ga0307409_100227671 3300031995 Bacteria 1687
209 Ga0307409_100539987 3300031995 Bacteria 1143
210 Ga0307409_100675893 3300031995 Bacteria 1029
211 Ga0307416_100000390 3300032002 Bacteria 22692
212 Ga0307416_100167226 3300032002 Bacteria 2041
213 Ga0307416_100169688 3300032002 Unclassified 2029
214 Ga0307416_100353323 3300032002 Bacteria 1488
215 Ga0307414_10038569 3300032004 Bacteria 3210
216 Ga0307414_10071524 3300032004 Unclassified 2502
217 Ga0307414_10153374 3300032004 Bacteria 1820
218 Ga0307414_10445956 3300032004 Unclassified 1134
219 Ga0307411_10032273 3300032005 Bacteria 3234
220 Ga0307411_10064285 3300032005 Unclassified 2456
221 Ga0307411_10209115 3300032005 Unclassified 1505
222 Ga0307415_100022090 3300032126 Bacteria 3922
223 Ga0307415_100134034 3300032126 Bacteria 1880
224 Ga0307415_100286871 3300032126 Bacteria 1356
225 Ga0307415_100702993 3300032126 Bacteria 912
226 Ga0307415_100906851 3300032126 Unclassified 813
227 Ga0373931_0892589 3300035691 Unclassified 597
228 Ga0395900_0206776 3300037418 Bacteria 1984
229 Ga0395901_0087455 3300038443 Bacteria 3258
230 Ga0395901_0157273 3300038443 Bacteria 2387
231 Ga0400488_43733 3300038741 Bacteria 1704
232 Ga0400486_17799 3300038742 Unclassified 1077
233 Ga0451793_0174862 3300041452 Bacteria 806
234 Ga0451800_1345592 3300041459 Unclassified 561
235 Ga0451835_0841040 3300041492 Bacteria 544
236 Ga0439450_122384 3300042008 Bacteria 671
237 Ga0439451_069425 3300042009 Unclassified 706
238 Ga0439454_051138 3300042011 Bacteria 698
239 Ga0439455_0130329 3300042012 Bacteria 709
240 Ga0439463_020518 3300042016 Bacteria 1649
241 Ga0439459_0157474 3300042438 Unclassified 597
242 Ga0439464_0032829 3300042439 Bacteria 1459
243 Ga0439464_0044993 3300042439 Bacteria 1266
244 Ga0439440_0004579 3300042993 Bacteria 2720
245 Ga0439440_0061851 3300042993 Bacteria 958
246 Ga0466966_0216587 3300044684 Bacteria 1157
247 Ga0466961_0086365 3300044693 Bacteria 1983
248 Ga0466963_0373430 3300044694 Bacteria 1005
249 Ga0495603_0369232 3300046455 Unclassified 823
250 Ga0495603_0533829 3300046455 Bacteria 672
251 Ga0495629_0199224 3300046459 Bacteria 1385
252 Ga0495641_0144932 3300046461 Bacteria 1061
253 Ga0495580_0114308 3300046472 Bacteria 1875
254 Ga0495582_0258126 3300046473 Bacteria 1000
255 Ga0495639_0377734 3300046475 Bacteria 714
256 Ga0495584_0120154 3300046491 Unclassified 1331
257 Ga0495594_0415901 3300046499 Bacteria 765
258 Ga0495608_0217031 3300046511 Bacteria 1201
259 Ga0495644_0241887 3300046523 Unclassified 700
260 Ga0495642_0014354 3300046528 Bacteria 3068
261 Ga0495642_0103821 3300046528 Bacteria 1212
262 Ga0495645_0802997 3300046543 Bacteria 564
263 Ga0495633_0526593 3300046558 Bacteria 532
264 Ga0495656_0035100 3300046615 Bacteria 2058
265 Ga0495656_0275816 3300046615 Bacteria 856
266 Ga0495656_0413669 3300046615 Bacteria 707
267 Ga0495668_0378062 3300046616 Bacteria 778
268 Ga0495659_0520611 3300046664 Unclassified 523
269 Ga0495588_0067521 3300046674 Bacteria 1856
270 Ga0495588_0080489 3300046674 Bacteria 1700
271 Ga0495624_0106300 3300046690 Bacteria 1727
272 Ga0495670_0009205 3300046691 Bacteria 4857
273 Ga0495670_0012481 3300046691 Bacteria 4180
274 Ga0495670_0151344 3300046691 Bacteria 1217
275 Ga0495670_0318264 3300046691 Bacteria 835
276 Ga0495589_0098502 3300046794 Unclassified 1416
277 Ga0495581_0238004 3300047315 Bacteria 1065
278 Ga0495636_0010799 3300047318 Bacteria 3611
279 Ga0495636_0172937 3300047318 Bacteria 977
280 Ga0495680_0268209 3300047322 Bacteria 1206
281 Ga0495677_0020361 3300047445 Bacteria 2405
282 Ga0495685_082082 3300047447 Bacteria 1073
283 Ga0496100_0104121 3300048903 Bacteria 1960
284 Ga0496101_0003726 3300048904 Bacteria 9506
285 Ga0496102_0035536 3300048905 Bacteria 4485
286 Ga0496102_0109210 3300048905 Bacteria 2577
287 Ga0496102_0147023 3300048905 Bacteria 2212
288 Ga0496103_0025185 3300048906 Bacteria 3594
289 Ga0496103_0241934 3300048906 Bacteria 1161
290 Ga0496104_0188853 3300048907 Bacteria 1971
291 Ga0496104_0236771 3300048907 Bacteria 1737
292 Ga0496104_0605897 3300048907 Bacteria 1005
293 Ga0496105_0005269 3300048908 Bacteria 9801
294 Ga0496105_0094411 3300048908 Bacteria 2470
295 Ga0496107_0002897 3300048910 Bacteria 11335
296 Ga0496108_0164146 3300048911 Bacteria 1920
297 Ga0496108_0410141 3300048911 Bacteria 1183
298 Ga0496108_1082795 3300048911 Bacteria 682
299 Ga0496109_0504126 3300048912 Bacteria 1142
300 Ga0496109_1634633 3300048912 Bacteria 578
301 Ga0496110_0056509 3300048913 Bacteria 3454
302 Ga0496110_0120285 3300048913 Bacteria 2365
303 Ga0496110_0174897 3300048913 Bacteria 1948
304 Ga0496110_0383600 3300048913 Bacteria 1281
305 Ga0496111_0081540 3300048914 Bacteria 2361
306 Ga0496111_0400604 3300048914 Bacteria 1014
307 Ga0496112_0805876 3300048915 Bacteria 864
308 Ga0496113_0041625 3300048916 Bacteria 3391
309 Ga0496113_0111112 3300048916 Bacteria 2134
310 Ga0496114_0783933 3300048917 Bacteria 831
311 Ga0496114_0863133 3300048917 Bacteria 785
312 Ga0496115_0520857 3300048918 Bacteria 953
313 Ga0496115_0663828 3300048918 Bacteria 823
314 Ga0496126_0002114 3300048929 Bacteria 27822
315 Ga0501292_091277 3300049515 Bacteria 592
316 Ga0501297_050424 3300049520 Unclassified 611
317 Ga0501298_125554 3300049521 Unclassified 608
318 Ga0501302_026244 3300049525 Unclassified 531
319 Ga0501034_0023367 3300049571 Bacteria 6299
320 Ga0501039_0914849 3300049575 Unclassified 683
321 Ga0501070_0139175 3300049586 Bacteria 2004
322 Ga0501202_201853 3300049652 Unclassified 544
323 Ga0501243_016003 3300049675 Unclassified 1209
324 Ga0501225_0188633 3300049705 Unclassified 648
325 Ga0501229_033200 3300049706 Unclassified 714
326 nmdc:mga05p37_2097_c1 3300050507 Bacteria 23274
327 nmdc:mga09592_382577_c1 3300050508 Unclassified 1217
328 nmdc:mga06r32_129884_c1 3300050510 Bacteria 2491
329 nmdc:mga08y16_3127_c1 3300050511 Bacteria 17141
330 nmdc:mga08y16_766172_c1 3300050511 Bacteria 960
331 nmdc:mga0n895_8004_c1 3300050512 Bacteria 9117
332 nmdc:mga0rr50_59974_c1 3300050513 Bacteria 2860
333 nmdc:mga0a205_2191_c1 3300050515 Bacteria 17194
334 2833709790 2833709550 Bacteria 4008291
335 2844850170 2844849076 Bacteria 4091819
336 Ga0496114_0386947
337 JGI25152J39213_1000086
338 JGI25151J46595_10022108
339 JGI25406J46586_10029055
340 JGI25407J50210_10048159
341 JGI25405J52794_10051324
342 JGI25405J52794_10057289
343 Ga0070658_10361096
344 Ga0070676_10655983
345 Ga0070683_100390625
346 Ga0070683_100562463
347 Ga0068869_100160832
348 Ga0068869_101520664
349 Ga0070682_100311537
350 Ga0068868_100309216
351 Ga0068868_100702937
352 Ga0070660_100507023
353 Ga0070668_100048075
354 Ga0070668_100285484
355 Ga0070669_100137755
356 Ga0070671_100335562
357 Ga0070671_101535459
358 Ga0070674_100450769
359 Ga0070674_101671470
360 Ga0070659_100008380
361 Ga0070659_100080230
362 Ga0070659_100260196
363 Ga0070708_100448549
364 Ga0070663_100007870
365 Ga0070663_100368816
366 Ga0070678_101734641
367 Ga0070662_100201265
368 Ga0070662_100785622
369 Ga0068867_100036847
370 Ga0070699_101497885
371 Ga0068853_100299813
372 Ga0068853_100502650
373 Ga0070672_100473592
374 Ga0070696_101009945
375 Ga0070693_100600970
376 Ga0068855_100830081
377 Ga0068855_100906105
378 Ga0070664_100012827
379 Ga0070664_101035188
380 Ga0068854_101212477
381 Ga0068856_101730119
382 Ga0068852_100372582
383 Ga0068852_100481073
384 Ga0068866_10112235
385 Ga0068861_100030440
386 Ga0068861_100344214
387 Ga0068870_10232555
388 Ga0068858_101568015
389 Ga0068860_100564837
390 Ga0068860_101844024
391 Ga0068862_100246309
392 Ga0068862_102207257
393 Ga0081455_10003164
394 Ga0081455_10012617
395 Ga0081455_10017081
396 Ga0081455_10117231
397 Ga0081538_10000976
398 Ga0081538_10306079
399 Ga0081539_10000526
400 Ga0075432_10000607
401 Ga0075428_100010720
402 Ga0075428_100012749
403 Ga0075431_100023727
404 Ga0075433_10015122
405 Ga0075434_100022237
406 Ga0075429_100104152
407 Ga0068865_100339238
408 Ga0075435_100014149
409 Ga0105244_10084707
410 Ga0111539_10126387
411 Ga0111539_10746579
412 Ga0111539_11670469
413 Ga0105245_10109770
414 Ga0105245_10203080
415 Ga0105245_10813207
416 Ga0105245_10891323
417 Ga0105247_10149498
418 Ga0114129_10164219
419 Ga0105243_10009173
420 Ga0105243_10021332
421 Ga0105243_10058381
422 Ga0105243_10079608
423 Ga0105243_10670653
424 Ga0105242_10013269
425 Ga0105242_10057025
426 Ga0105242_10385243
427 Ga0105237_10396974
428 Ga0105238_11039522
429 Ga0105249_10152540
430 Ga0105249_10250929
431 Ga0105249_10317058
432 Ga0105239_10178843
433 Ga0105239_10994839
434 Ga0105239_11593466
435 Ga0105239_12316065
436 Ga0105246_10003484
437 Ga0105246_10088765
438 Ga0157320_1000416
439 Ga0157337_1001138
440 Ga0157322_1013173
441 Ga0157335_1000993
442 Ga0157314_1003562
443 Ga0157315_1049276
444 Ga0157371_10228293
445 Ga0157369_10677472
446 Ga0163162_10015277
447 Ga0163162_10017067
448 Ga0163162_10048616
449 Ga0163162_10278786
450 Ga0163162_10674655
451 Ga0163162_13281759
452 Ga0157372_10047403
453 Ga0157372_10364421
454 Ga0157372_12855602
455 Ga0157375_10093850
456 Ga0157375_11215745
457 Ga0157375_11388986
458 Ga0157375_11629024
459 Ga0163163_10596539
460 Ga0163163_12116277
461 Ga0157380_10019524
462 Ga0157380_10172797
463 Ga0157377_10044783
464 Ga0157376_10257336
465 Ga0163161_10036448
466 Ga0163161_10306678
467 Ga0163161_10919100
468 Ga0197907_11323729
469 Ga0206350_11635640
470 Ga0206354_10761561
471 Ga0207425_1033831
472 Ga0209129_1000100
473 Ga0209025_1001942
474 Ga0209051_1023603
475 Ga0207642_10367319
476 Ga0207688_10048663
477 Ga0207688_10275689
478 Ga0207643_10086181
479 Ga0207657_10147304
480 Ga0207657_10461681
481 Ga0207694_10520660
482 Ga0207650_10248606
483 Ga0207687_10016539
484 Ga0207690_10083550
485 Ga0207706_10163812
486 Ga0207706_10239429
487 Ga0207686_10133921
488 Ga0207686_10261689
489 Ga0207709_10105437
490 Ga0207709_10125230
491 Ga0207709_10219666
492 Ga0207669_11180345
493 Ga0207691_10455777
494 Ga0207691_10626379
495 Ga0207711_10832229
496 Ga0207689_10349090
497 Ga0207661_10348956
498 Ga0207679_10007701
499 Ga0207712_10100635
500 Ga0207712_11222466
501 Ga0207668_10543713
502 Ga0207640_10425133
503 Ga0207677_10475830
504 Ga0207703_11792952
505 Ga0207639_10634617
506 Ga0207641_10716716
507 Ga0207648_10521158
508 Ga0207648_10555370
509 Ga0207674_10449547
510 Ga0207675_100009687
511 Ga0207675_100053568
512 Ga0207683_11603762
513 Ga0207698_10373177
514 Ga0207428_10000858
515 Ga0268266_10280306
516 Ga0268265_11781704
517 Ga0265327_10138157
518 Ga0307408_100040233
519 Ga0307408_100082161
520 Ga0307408_101147771
521 Ga0307408_101222864
522 Ga0307405_10228356
523 Ga0307405_11464542
524 Ga0307413_10160809
525 Ga0307410_10000741
526 Ga0307410_10073584
527 Ga0307410_10240207
528 Ga0307410_10280641
529 Ga0307410_10874661
530 Ga0307406_10000021
531 Ga0307406_10323194
532 Ga0307407_10001926
533 Ga0307407_10110186
534 Ga0307407_10118914
535 Ga0307407_10441502
536 Ga0307407_10615630
537 Ga0307412_10252077
538 Ga0307412_10317899
539 Ga0307412_11180346
540 Ga0307412_11397500
541 Ga0307409_100000027
542 Ga0307409_100085605
543 Ga0307409_100227671
544 Ga0307409_100539987
545 Ga0307409_100675893
546 Ga0307416_100000390
547 Ga0307416_100167226
548 Ga0307416_100169688
549 Ga0307416_100353323
550 Ga0307414_10038569
551 Ga0307414_10071524
552 Ga0307414_10153374
553 Ga0307414_10445956
554 Ga0307411_10032273
555 Ga0307411_10064285
556 Ga0307411_10209115
557 Ga0307415_100022090
558 Ga0307415_100134034
559 Ga0307415_100286871
560 Ga0307415_100702993
561 Ga0307415_100906851
562 Ga0373931_0892589
563 Ga0395900_0206776
564 Ga0395901_0087455
565 Ga0395901_0157273
566 Ga0400488_43733
567 Ga0400486_17799
568 Ga0451793_0174862
569 Ga0451800_1345592
570 Ga0451835_0841040
571 Ga0439450_122384
572 Ga0439451_069425
573 Ga0439454_051138
574 Ga0439455_0130329
575 Ga0439463_020518
576 Ga0439459_0157474
577 Ga0439464_0032829
578 Ga0439464_0044993
579 Ga0439440_0004579
580 Ga0439440_0061851
581 Ga0466966_0216587
582 Ga0466961_0086365
583 Ga0466963_0373430
584 Ga0495603_0369232
585 Ga0495603_0533829
586 Ga0495629_0199224
587 Ga0495641_0144932
588 Ga0495580_0114308
589 Ga0495582_0258126
590 Ga0495639_0377734
591 Ga0495584_0120154
592 Ga0495594_0415901
593 Ga0495608_0217031
594 Ga0495644_0241887
595 Ga0495642_0014354
596 Ga0495642_0103821
597 Ga0495645_0802997
598 Ga0495633_0526593
599 Ga0495656_0035100
600 Ga0495656_0275816
601 Ga0495656_0413669
602 Ga0495668_0378062
603 Ga0495659_0520611
604 Ga0495588_0067521
605 Ga0495588_0080489
606 Ga0495624_0106300
607 Ga0495670_0009205
608 Ga0495670_0012481
609 Ga0495670_0151344
610 Ga0495670_0318264
611 Ga0495589_0098502
612 Ga0495581_0238004
613 Ga0495636_0010799
614 Ga0495636_0172937
615 Ga0495680_0268209
616 Ga0495677_0020361
617 Ga0495685_082082
618 Ga0496100_0104121
619 Ga0496101_0003726
620 Ga0496102_0035536
621 Ga0496102_0109210
622 Ga0496102_0147023
623 Ga0496103_0025185
624 Ga0496103_0241934
625 Ga0496104_0188853
626 Ga0496104_0236771
627 Ga0496104_0605897
628 Ga0496105_0005269
629 Ga0496105_0094411
630 Ga0496107_0002897
631 Ga0496108_0164146
632 Ga0496108_0410141
633 Ga0496108_1082795
634 Ga0496109_0504126
635 Ga0496109_1634633
636 Ga0496110_0056509
637 Ga0496110_0120285
638 Ga0496110_0174897
639 Ga0496110_0383600
640 Ga0496111_0081540
641 Ga0496111_0400604
642 Ga0496112_0805876
643 Ga0496113_0041625
644 Ga0496113_0111112
645 Ga0496114_0783933
646 Ga0496114_0863133
647 Ga0496115_0520857
648 Ga0496115_0663828
649 Ga0496126_0002114
650 Ga0501292_091277
651 Ga0501297_050424
652 Ga0501298_125554
653 Ga0501302_026244
654 Ga0501034_0023367
655 Ga0501039_0914849
656 Ga0501070_0139175
657 Ga0501202_201853
658 Ga0501243_016003
659 Ga0501225_0188633
660 Ga0501229_033200
661 nmdc:mga05p37_2097_c1
662 nmdc:mga09592_382577_c1
663 nmdc:mga06r32_129884_c1
664 nmdc:mga08y16_3127_c1
665 nmdc:mga08y16_766172_c1
666 nmdc:mga0n895_8004_c1
667 nmdc:mga0rr50_59974_c1
668 nmdc:mga0a205_2191_c1
669 2833709790
670 2844850170

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

33

160

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2leq-assembly1.cif.gz_A chemical shift assignment and solution structure of chr145 from cytophaga hutchinsonii, northeast structural genomics consortium target chr145 0.8838 6 139
6v04-assembly1.cif.gz_A dynu16 crystal structure, a putative protein in the dynemicin biosynthetic locus 0.879 4 138
4fpw-assembly3.cif.gz_A crystal structure of calu16 from micromonospora echinospora. northeast structural genomics consortium target mir12. 0.8498 6 140
2leq-assembly1.cif.gz_A chemical shift assignment and solution structure of chr145 from cytophaga hutchinsonii, northeast structural genomics consortium target chr145 0.8274 6 139
2lgh-assembly1.cif.gz_A solution nmr structure of the ahsa1-like protein aha_2358 from aeromonas hydrophila refined with nh rdcs, northeast structural genomics consortium target ahr99. 0.8222 6 138
ID Description Score Start End Superfamily
2leqA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8838 6 139 3.30.530.20
af_O53773_104_241_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8392 8 142 3.30.530.20
2leqA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8274 6 139 3.30.530.20
2lghA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8222 6 138 3.30.530.20
2m89B00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8207 6 141 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A839NK21-F1-model_v4 Uncharacterized protein YndB with AHSA1/START domain 0.9934 6 142
AF-A0A6M1ZBP9-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9924 6 140
AF-A0A522PG36-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9895 11 103
AF-A0A120I085-F1-model_v4 ATPase 0.9885 1 142
AF-C6W496-F1-model_v4 Activator of Hsp90 ATPase 1 family protein 0.983 1 141

Map