F412404

General Info

Members Datasets Scaffolds Average Seq Length
335 170 670 232

Family's Representative Sequence

Representative Sequence 3300048909|Ga0496106_0209021|Ga0496106_0209021_226_1029
Length 258
Sequence MLRTDCRLPIANCQLRINSLLKLPIGNWHLAMLLXXLLAQSAFAQCTKKAAELPAAPELLGFHLGMTKEQIKARVPQTKFGKTDPFGVSRTTINPYFDPSIDKTKFEGVRSISLDLLDERLTSLWIGFDETFKAHTTEEFVKLVSQSLQVPENWSSWRYKGQQLRCADFQLIVTTVAGGPSFRVLDMAAEETIATRRQAKEEQDSLAEAGVDAASTETAEIVGDKQSKTYYSGSCPPPKEIADANKVSFKTTPAKNCH

Samples

Sample ID Description Type Environment
1 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
4 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
5 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
143 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
144 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
145 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
150 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
151 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
152 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
154 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
155 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
156 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
157 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
158 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
159 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
160 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
161 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
162 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
163 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
164 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
165 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
166 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
169 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
170 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.79
Rhizosphere 98.21
Stem 0
Stem Tuber 0
Unclassified 15.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496106_0209021 3300048909 Bacteria 1554
2 MBSR1b_contig_12721133 2162886012 Unclassified 905
3 CNBas_1002114 3300000531 Bacteria 1085
4 CNAas_1001737 3300000532 Bacteria 1728
5 JGI24736J21556_1025631 3300001904 Bacteria 917
6 JGI24751J29686_10000145 3300002459 Bacteria 34775
7 JGI25406J46586_10014924 3300003203 Unclassified 3289
8 Ga0065714_10002198 3300005288 Bacteria 90565
9 Ga0065704_10003606 3300005289 Bacteria 3926
10 Ga0065704_10102827 3300005289 Unclassified 2192
11 Ga0065712_10000119 3300005290 Bacteria 137052
12 Ga0065712_10000903 3300005290 Bacteria 8870
13 Ga0065715_10010719 3300005293 Bacteria 2158
14 Ga0065715_10090359 3300005293 Bacteria 7153
15 Ga0065707_10003641 3300005295 Bacteria 9562
16 Ga0070676_10172594 3300005328 Bacteria 1400
17 Ga0070683_100305664 3300005329 Bacteria 1513
18 Ga0070690_100426171 3300005330 Unclassified 979
19 Ga0070670_100000073 3300005331 Bacteria 98443
20 Ga0070670_100052821 3300005331 Bacteria 3490
21 Ga0070677_10074768 3300005333 Bacteria 1434
22 Ga0068869_100047677 3300005334 Bacteria 3095
23 Ga0070666_10359426 3300005335 Viruses 1043
24 Ga0070680_100072922 3300005336 Bacteria 2822
25 Ga0070680_100462477 3300005336 Bacteria 1084
26 Ga0070682_100006169 3300005337 Bacteria 6716
27 Ga0070682_100109795 3300005337 Bacteria 1836
28 Ga0070660_100069633 3300005339 Bacteria 2744
29 Ga0070689_100001296 3300005340 Bacteria 15930
30 Ga0070687_100217480 3300005343 Bacteria 1168
31 Ga0070687_100428286 3300005343 Unclassified 875
32 Ga0070661_100033639 3300005344 Bacteria 3714
33 Ga0070675_100152992 3300005354 Unclassified 1979
34 Ga0070675_100452568 3300005354 Bacteria 1151
35 Ga0070675_100481377 3300005354 Bacteria 1116
36 Ga0070659_100107798 3300005366 Bacteria 2247
37 Ga0070659_100198202 3300005366 Bacteria 1652
38 Ga0070703_10051596 3300005406 Unclassified 1317
39 Ga0070701_10031248 3300005438 Bacteria 2641
40 Ga0070705_100021445 3300005440 Bacteria 3437
41 Ga0070705_100055437 3300005440 Bacteria 2330
42 Ga0070705_100349079 3300005440 Unclassified 1078
43 Ga0070700_100001633 3300005441 Bacteria 11207
44 Ga0070700_100027781 3300005441 Bacteria 3358
45 Ga0070694_100051567 3300005444 Bacteria 2778
46 Ga0070694_100091578 3300005444 Bacteria 2134
47 Ga0070694_100219324 3300005444 Bacteria 1426
48 Ga0070694_100412770 3300005444 Bacteria 1059
49 Ga0070662_100028646 3300005457 Bacteria 3878
50 Ga0070662_100251352 3300005457 Bacteria 1421
51 Ga0070681_10009236 3300005458 Bacteria 9691
52 Ga0070681_10046351 3300005458 Bacteria 4346
53 Ga0068867_100012038 3300005459 Bacteria 6109
54 Ga0070706_100168590 3300005467 Bacteria 2044
55 Ga0070707_100063540 3300005468 Bacteria 3543
56 Ga0070707_100649549 3300005468 Bacteria 1017
57 Ga0070698_100001051 3300005471 Bacteria 30385
58 Ga0070698_100111434 3300005471 Bacteria 2701
59 Ga0070699_100010346 3300005518 Bacteria 8067
60 Ga0070699_100089427 3300005518 Bacteria 2690
61 Ga0070699_100385220 3300005518 Bacteria 1266
62 Ga0070679_100016266 3300005530 Bacteria 7168
63 Ga0070679_100274869 3300005530 Bacteria 1638
64 Ga0070697_100126971 3300005536 Unclassified 2137
65 Ga0068853_100018503 3300005539 Bacteria 5768
66 Ga0068853_100042865 3300005539 Bacteria 3871
67 Ga0070695_100025386 3300005545 Bacteria 3659
68 Ga0070696_100145263 3300005546 Unclassified 1737
69 Ga0070693_100005965 3300005547 Bacteria 5887
70 Ga0070693_100032675 3300005547 Bacteria 2864
71 Ga0070693_100100271 3300005547 Bacteria 1763
72 Ga0070693_100124303 3300005547 Bacteria 1604
73 Ga0070693_100147089 3300005547 Bacteria 1489
74 Ga0070693_100211761 3300005547 Bacteria 1265
75 Ga0070704_100031124 3300005549 Bacteria 3585
76 Ga0070704_100070708 3300005549 Bacteria 2533
77 Ga0070704_100084486 3300005549 Unclassified 2347
78 Ga0070704_100129454 3300005549 Bacteria 1953
79 Ga0070704_100208695 3300005549 Bacteria 1581
80 Ga0070704_100359079 3300005549 Bacteria 1232
81 Ga0068855_100160940 3300005563 Bacteria 2548
82 Ga0070664_100041019 3300005564 Bacteria 3904
83 Ga0070664_100046056 3300005564 Bacteria 3684
84 Ga0068857_100022648 3300005577 Bacteria 5526
85 Ga0068857_100148755 3300005577 Bacteria 2120
86 Ga0068854_100028808 3300005578 Bacteria 3840
87 Ga0068854_100201948 3300005578 Bacteria 1563
88 Ga0070702_100062230 3300005615 Bacteria 2175
89 Ga0070702_100085725 3300005615 Bacteria 1898
90 Ga0068852_100388398 3300005616 Bacteria 1370
91 Ga0068859_100016463 3300005617 Bacteria 7427
92 Ga0068859_100032991 3300005617 Bacteria 5201
93 Ga0068859_100193756 3300005617 Unclassified 2117
94 Ga0068864_100024714 3300005618 Bacteria 5054
95 Ga0068864_100114220 3300005618 Bacteria 2408
96 Ga0068864_100265908 3300005618 Bacteria 1596
97 Ga0068851_10004342 3300005834 Bacteria 6381
98 Ga0068870_10008373 3300005840 Bacteria 4650
99 Ga0068870_10071245 3300005840 Bacteria 1896
100 Ga0068870_10186501 3300005840 Bacteria 1249
101 Ga0068863_100305129 3300005841 Bacteria 1545
102 Ga0068858_100035366 3300005842 Bacteria 4634
103 Ga0068858_100089739 3300005842 Unclassified 2860
104 Ga0068858_100113940 3300005842 Bacteria 2526
105 Ga0068858_100409107 3300005842 Bacteria 1304
106 Ga0068858_100958727 3300005842 Unclassified 837
107 Ga0068860_100040165 3300005843 Bacteria 4474
108 Ga0068860_100051050 3300005843 Bacteria 3936
109 Ga0068860_100319192 3300005843 Bacteria 1524
110 Ga0068860_100320632 3300005843 Unclassified 1521
111 Ga0068860_100360732 3300005843 Bacteria 1432
112 Ga0068860_100394817 3300005843 Bacteria 1368
113 Ga0068860_100407414 3300005843 Bacteria 1346
114 Ga0068860_100871438 3300005843 Bacteria 916
115 Ga0081539_10000346 3300005985 Bacteria 101962
116 Ga0081539_10000875 3300005985 Bacteria 57733
117 Ga0097621_100001426 3300006237 Bacteria 16407
118 Ga0068871_100003287 3300006358 Bacteria 11088
119 Ga0068871_100153834 3300006358 Bacteria 1963
120 Ga0075428_100118887 3300006844 Bacteria 2878
121 Ga0075430_100021229 3300006846 Bacteria 5520
122 Ga0075431_100023719 3300006847 Bacteria 6280
123 Ga0075433_10109415 3300006852 Bacteria 2452
124 Ga0075433_10216283 3300006852 Bacteria 1703
125 Ga0075434_100116717 3300006871 Bacteria 2682
126 Ga0075434_100320464 3300006871 Bacteria 1571
127 Ga0075429_100035273 3300006880 Bacteria 4350
128 Ga0097620_100001811 3300006931 Bacteria 21762
129 Ga0097620_100016463 3300006931 Bacteria 7427
130 Ga0097620_100032990 3300006931 Bacteria 5201
131 Ga0097620_100060918 3300006931 Bacteria 3802
132 Ga0097620_100193751 3300006931 Unclassified 2117
133 Ga0075435_100022952 3300007076 Bacteria 4817
134 Ga0075435_100077352 3300007076 Bacteria 2728
135 Ga0105247_10001590 3300009101 Bacteria 16076
136 Ga0105247_10241002 3300009101 Bacteria 1232
137 Ga0114129_10014948 3300009147 Bacteria 11060
138 Ga0114129_10026205 3300009147 Bacteria 8255
139 Ga0114129_10049958 3300009147 Bacteria 5875
140 Ga0114129_10128081 3300009147 Bacteria 3489
141 Ga0114129_10154007 3300009147 Bacteria 3145
142 Ga0114129_10358601 3300009147 Bacteria 1929
143 Ga0114129_10471494 3300009147 Unclassified 1644
144 Ga0114129_10639626 3300009147 Unclassified 1374
145 Ga0105243_10319494 3300009148 Bacteria 1414
146 Ga0105243_10497582 3300009148 Bacteria 1154
147 Ga0105243_10589105 3300009148 Unclassified 1069
148 Ga0105241_10010334 3300009174 Bacteria 6853
149 Ga0105241_10075631 3300009174 Bacteria 2624
150 Ga0105241_10168643 3300009174 Bacteria 1806
151 Ga0105241_10172074 3300009174 Bacteria 1789
152 Ga0105241_10209608 3300009174 Bacteria 1632
153 Ga0105241_10445391 3300009174 Unclassified 1145
154 Ga0105241_10514088 3300009174 Bacteria 1070
155 Ga0105241_10601563 3300009174 Bacteria 993
156 Ga0105242_10055105 3300009176 Bacteria 3253
157 Ga0105248_10099250 3300009177 Bacteria 3281
158 Ga0105248_10160356 3300009177 Unclassified 2537
159 Ga0105248_10166175 3300009177 Bacteria 2488
160 Ga0105248_10168584 3300009177 Bacteria 2468
161 Ga0105248_10926581 3300009177 Unclassified 984
162 Ga0105248_11067686 3300009177 Unclassified 912
163 Ga0105237_10005907 3300009545 Bacteria 13724
164 Ga0105237_10402093 3300009545 Bacteria 1374
165 Ga0105237_10924402 3300009545 Unclassified 879
166 Ga0105238_10004519 3300009551 Bacteria 13784
167 Ga0105238_10081567 3300009551 Bacteria 3224
168 Ga0105238_10860907 3300009551 Unclassified 924
169 Ga0105249_10004360 3300009553 Bacteria 12240
170 Ga0105239_10298978 3300010375 Bacteria 1812
171 Ga0105239_10981153 3300010375 Bacteria 971
172 Ga0105246_10125472 3300011119 Bacteria 1909
173 Ga0157373_10073372 3300013100 Bacteria 2415
174 Ga0163162_10128405 3300013306 Bacteria 2643
175 Ga0163162_10193549 3300013306 Bacteria 2161
176 Ga0163162_10228524 3300013306 Unclassified 1991
177 Ga0163162_10263539 3300013306 Bacteria 1855
178 Ga0157372_10003205 3300013307 Bacteria 17671
179 Ga0157375_10053131 3300013308 Bacteria 3985
180 Ga0157375_10208574 3300013308 Bacteria 2111
181 Ga0157375_10484549 3300013308 Unclassified 1402
182 Ga0157375_10719881 3300013308 Bacteria 1151
183 Ga0163163_10007124 3300014325 Bacteria 9831
184 Ga0163163_10051392 3300014325 Bacteria 4064
185 Ga0163163_10090219 3300014325 Bacteria 3078
186 Ga0163163_10092886 3300014325 Bacteria 3033
187 Ga0157377_10025195 3300014745 Bacteria 3170
188 Ga0157377_10222489 3300014745 Bacteria 1209
189 Ga0157379_10062890 3300014968 Bacteria 3319
190 Ga0157379_10339872 3300014968 Bacteria 1373
191 Ga0157376_10350214 3300014969 Bacteria 1413
192 Ga0207656_10041429 3300025321 Bacteria 1957
193 Ga0207653_10002923 3300025885 Bacteria 5420
194 Ga0207710_10000266 3300025900 Bacteria 43131
195 Ga0207710_10179343 3300025900 Bacteria 1039
196 Ga0207688_10078918 3300025901 Bacteria 1877
197 Ga0207647_10030155 3300025904 Unclassified 3502
198 Ga0207645_10075398 3300025907 Bacteria 2159
199 Ga0207643_10009806 3300025908 Bacteria 5144
200 Ga0207643_10091316 3300025908 Bacteria 1776
201 Ga0207643_10130646 3300025908 Unclassified 1494
202 Ga0207643_10144241 3300025908 Bacteria 1424
203 Ga0207684_10000083 3300025910 Bacteria 176092
204 Ga0207684_10253776 3300025910 Bacteria 1517
205 Ga0207654_10540646 3300025911 Unclassified 827
206 Ga0207707_10016929 3300025912 Bacteria 6350
207 Ga0207707_10048155 3300025912 Bacteria 3712
208 Ga0207707_10105160 3300025912 Bacteria 2467
209 Ga0207707_10575764 3300025912 Archaea 955
210 Ga0207671_10468244 3300025914 Unclassified 1004
211 Ga0207660_10460526 3300025917 Bacteria 1029
212 Ga0207662_10025624 3300025918 Bacteria 3397
213 Ga0207649_10069279 3300025920 Bacteria 2246
214 Ga0207652_10073113 3300025921 Unclassified 2982
215 Ga0207652_10236357 3300025921 Bacteria 1647
216 Ga0207694_10108634 3300025924 Bacteria 2204
217 Ga0207650_10000006 3300025925 Bacteria 544730
218 Ga0207650_10294503 3300025925 Bacteria 1324
219 Ga0207659_10264874 3300025926 Bacteria 1400
220 Ga0207687_10189831 3300025927 Bacteria 1598
221 Ga0207690_10037562 3300025932 Bacteria 3145
222 Ga0207706_10014877 3300025933 Bacteria 7046
223 Ga0207686_10026238 3300025934 Unclassified 3398
224 Ga0207709_10217738 3300025935 Bacteria 1375
225 Ga0207670_10000390 3300025936 Bacteria 25211
226 Ga0207670_10104243 3300025936 Bacteria 2031
227 Ga0207711_10092774 3300025941 Bacteria 2658
228 Ga0207711_10173701 3300025941 Bacteria 1957
229 Ga0207711_10311632 3300025941 Bacteria 1453
230 Ga0207689_10008258 3300025942 Bacteria 9073
231 Ga0207689_10091585 3300025942 Bacteria 2498
232 Ga0207689_10122200 3300025942 Unclassified 2141
233 Ga0207689_10142485 3300025942 Bacteria 1975
234 Ga0207689_10208258 3300025942 Bacteria 1615
235 Ga0207661_10698838 3300025944 Unclassified 933
236 Ga0207679_10014914 3300025945 Bacteria 5120
237 Ga0207712_10019137 3300025961 Bacteria 4468
238 Ga0207640_10022836 3300025981 Bacteria 3750
239 Ga0207640_10162316 3300025981 Bacteria 1655
240 Ga0207640_10192354 3300025981 Unclassified 1539
241 Ga0207640_10429458 3300025981 Unclassified 1083
242 Ga0207703_10044863 3300026035 Bacteria 3554
243 Ga0207703_10199860 3300026035 Bacteria 1776
244 Ga0207703_10251650 3300026035 Unclassified 1593
245 Ga0207703_10301526 3300026035 Bacteria 1461
246 Ga0207639_10026467 3300026041 Bacteria 4215
247 Ga0207639_10041484 3300026041 Bacteria 3443
248 Ga0207639_10250081 3300026041 Bacteria 1545
249 Ga0207708_10004334 3300026075 Bacteria 10449
250 Ga0207708_10021551 3300026075 Bacteria 4861
251 Ga0207708_10064951 3300026075 Bacteria 2789
252 Ga0207708_10087546 3300026075 Bacteria 2398
253 Ga0207641_10248533 3300026088 Unclassified 1660
254 Ga0207641_10867251 3300026088 Unclassified 895
255 Ga0207648_10148309 3300026089 Bacteria 2070
256 Ga0207676_10039020 3300026095 Bacteria 3629
257 Ga0207676_10041804 3300026095 Bacteria 3522
258 Ga0207676_10075282 3300026095 Bacteria 2722
259 Ga0207676_10076275 3300026095 Bacteria 2708
260 Ga0207674_10014187 3300026116 Bacteria 8807
261 Ga0207674_10094292 3300026116 Bacteria 2980
262 Ga0207674_10158087 3300026116 Bacteria 2221
263 Ga0207674_10270215 3300026116 Bacteria 1648
264 Ga0207674_10295353 3300026116 Unclassified 1569
265 Ga0207674_10358038 3300026116 Unclassified 1411
266 Ga0207674_10409694 3300026116 Unclassified 1310
267 Ga0207674_10539150 3300026116 Unclassified 1127
268 Ga0207698_10742897 3300026142 Bacteria 979
269 Ga0268265_10140908 3300028380 Bacteria 2019
270 Ga0268265_10700530 3300028380 Unclassified 978
271 Ga0268264_10009655 3300028381 Bacteria 7994
272 Ga0268264_10098090 3300028381 Unclassified 2541
273 Ga0268264_10167151 3300028381 Bacteria 1987
274 Ga0268264_10335743 3300028381 Bacteria 1434
275 Ga0268264_10505425 3300028381 Unclassified 1179
276 Ga0268264_10738495 3300028381 Bacteria 980
277 Ga0316178_1102858 3300030735 Bacteria 1263
278 Ga0307408_100003979 3300031548 Bacteria 10068
279 Ga0307408_100784604 3300031548 Bacteria 863
280 Ga0307405_10009046 3300031731 Bacteria 5088
281 Ga0307406_10010187 3300031901 Bacteria 5296
282 Ga0307407_10025116 3300031903 Bacteria 3136
283 Ga0307412_10003326 3300031911 Bacteria 8932
284 Ga0307412_10183518 3300031911 Bacteria 1576
285 Ga0307409_100223430 3300031995 Bacteria 1702
286 Ga0307416_100194896 3300032002 Bacteria 1915
287 Ga0307414_10015105 3300032004 Bacteria 4653
288 Ga0307414_10357786 3300032004 Bacteria 1255
289 Ga0307411_10009619 3300032005 Bacteria 5098
290 Ga0307415_100006102 3300032126 Bacteria 6463
291 Ga0395901_0109461 3300038443 Bacteria 2901
292 Ga0395901_0220477 3300038443 Bacteria 1983
293 Ga0395901_0352298 3300038443 Bacteria 1519
294 Ga0242420_016394 3300038996 Bacteria 1290
295 Ga0439455_0027084 3300042012 Bacteria 1403
296 Ga0439458_0005554 3300042157 Bacteria 2834
297 Ga0496106_0166281 3300048909 Bacteria 1746
298 Ga0496107_0182502 3300048910 Bacteria 1558
299 Ga0496111_0302744 3300048914 Bacteria 1185
300 Ga0496112_0332290 3300048915 Bacteria 1464
301 Ga0496113_0228992 3300048916 Bacteria 1482
302 Ga0501291_010913 3300049514 Bacteria 1302
303 Ga0501296_003455 3300049519 Bacteria 1686
304 Ga0501299_047433 3300049522 Bacteria 879
305 Ga0501048_0179431 3300049582 Bacteria 1501
306 Ga0501202_009682 3300049652 Bacteria 1777
307 Ga0501230_030079 3300049667 Bacteria 1006
308 Ga0501233_025891 3300049668 Bacteria 1292
309 Ga0501235_011801 3300049669 Bacteria 1919
310 Ga0501236_014881 3300049670 Bacteria 1083
311 Ga0501251_001461 3300049681 Bacteria 2206
312 Ga0501251_007687 3300049681 Bacteria 1204
313 Ga0501258_001273 3300049687 Bacteria 2025
314 Ga0501221_010842 3300049704 Bacteria 1628
315 Ga0501225_0004800 3300049705 Unclassified 4000
316 Ga0501225_0015309 3300049705 Bacteria 2137
317 Ga0501229_005853 3300049706 Bacteria 1515
318 Ga0501204_004432 3300049850 Bacteria 1512
319 nmdc:mga05p37_32750_c1 3300050507 Bacteria 6359
320 nmdc:mga05p37_351157_c1 3300050507 Bacteria 1736
321 nmdc:mga05p37_373786_c1 3300050507 Bacteria 1672
322 nmdc:mga05p37_417318_c1 3300050507 Bacteria 1563
323 nmdc:mga05p37_445453_c1 3300050507 Bacteria 1500
324 nmdc:mga05p37_566736_c1 3300050507 Unclassified 1289
325 nmdc:mga05p37_96954_c1 3300050507 Bacteria 3633
326 nmdc:mga09592_155151_c1 3300050508 Unclassified 1976
327 nmdc:mga09592_389797_c1 3300050508 Bacteria 1204
328 nmdc:mga06r32_241856_c1 3300050510 Unclassified 1792
329 nmdc:mga06r32_267680_c1 3300050510 Bacteria 1696
330 nmdc:mga08y16_21229_c1 3300050511 Bacteria 6857
331 nmdc:mga0n895_189663_c1 3300050512 Bacteria 2087
332 nmdc:mga0n895_55348_c1 3300050512 Bacteria 3904
333 nmdc:mga0rr50_188565_c1 3300050513 Bacteria 1689
334 nmdc:mga0a205_23476_c1 3300050515 Bacteria 5851
335 nmdc:mga0a205_608926_c1 3300050515 Unclassified 945
336 Ga0496106_0209021
337 MBSR1b_contig_12721133
338 CNBas_1002114
339 CNAas_1001737
340 JGI24736J21556_1025631
341 JGI24751J29686_10000145
342 JGI25406J46586_10014924
343 Ga0065714_10002198
344 Ga0065704_10003606
345 Ga0065704_10102827
346 Ga0065712_10000119
347 Ga0065712_10000903
348 Ga0065715_10010719
349 Ga0065715_10090359
350 Ga0065707_10003641
351 Ga0070676_10172594
352 Ga0070683_100305664
353 Ga0070690_100426171
354 Ga0070670_100000073
355 Ga0070670_100052821
356 Ga0070677_10074768
357 Ga0068869_100047677
358 Ga0070666_10359426
359 Ga0070680_100072922
360 Ga0070680_100462477
361 Ga0070682_100006169
362 Ga0070682_100109795
363 Ga0070660_100069633
364 Ga0070689_100001296
365 Ga0070687_100217480
366 Ga0070687_100428286
367 Ga0070661_100033639
368 Ga0070675_100152992
369 Ga0070675_100452568
370 Ga0070675_100481377
371 Ga0070659_100107798
372 Ga0070659_100198202
373 Ga0070703_10051596
374 Ga0070701_10031248
375 Ga0070705_100021445
376 Ga0070705_100055437
377 Ga0070705_100349079
378 Ga0070700_100001633
379 Ga0070700_100027781
380 Ga0070694_100051567
381 Ga0070694_100091578
382 Ga0070694_100219324
383 Ga0070694_100412770
384 Ga0070662_100028646
385 Ga0070662_100251352
386 Ga0070681_10009236
387 Ga0070681_10046351
388 Ga0068867_100012038
389 Ga0070706_100168590
390 Ga0070707_100063540
391 Ga0070707_100649549
392 Ga0070698_100001051
393 Ga0070698_100111434
394 Ga0070699_100010346
395 Ga0070699_100089427
396 Ga0070699_100385220
397 Ga0070679_100016266
398 Ga0070679_100274869
399 Ga0070697_100126971
400 Ga0068853_100018503
401 Ga0068853_100042865
402 Ga0070695_100025386
403 Ga0070696_100145263
404 Ga0070693_100005965
405 Ga0070693_100032675
406 Ga0070693_100100271
407 Ga0070693_100124303
408 Ga0070693_100147089
409 Ga0070693_100211761
410 Ga0070704_100031124
411 Ga0070704_100070708
412 Ga0070704_100084486
413 Ga0070704_100129454
414 Ga0070704_100208695
415 Ga0070704_100359079
416 Ga0068855_100160940
417 Ga0070664_100041019
418 Ga0070664_100046056
419 Ga0068857_100022648
420 Ga0068857_100148755
421 Ga0068854_100028808
422 Ga0068854_100201948
423 Ga0070702_100062230
424 Ga0070702_100085725
425 Ga0068852_100388398
426 Ga0068859_100016463
427 Ga0068859_100032991
428 Ga0068859_100193756
429 Ga0068864_100024714
430 Ga0068864_100114220
431 Ga0068864_100265908
432 Ga0068851_10004342
433 Ga0068870_10008373
434 Ga0068870_10071245
435 Ga0068870_10186501
436 Ga0068863_100305129
437 Ga0068858_100035366
438 Ga0068858_100089739
439 Ga0068858_100113940
440 Ga0068858_100409107
441 Ga0068858_100958727
442 Ga0068860_100040165
443 Ga0068860_100051050
444 Ga0068860_100319192
445 Ga0068860_100320632
446 Ga0068860_100360732
447 Ga0068860_100394817
448 Ga0068860_100407414
449 Ga0068860_100871438
450 Ga0081539_10000346
451 Ga0081539_10000875
452 Ga0097621_100001426
453 Ga0068871_100003287
454 Ga0068871_100153834
455 Ga0075428_100118887
456 Ga0075430_100021229
457 Ga0075431_100023719
458 Ga0075433_10109415
459 Ga0075433_10216283
460 Ga0075434_100116717
461 Ga0075434_100320464
462 Ga0075429_100035273
463 Ga0097620_100001811
464 Ga0097620_100016463
465 Ga0097620_100032990
466 Ga0097620_100060918
467 Ga0097620_100193751
468 Ga0075435_100022952
469 Ga0075435_100077352
470 Ga0105247_10001590
471 Ga0105247_10241002
472 Ga0114129_10014948
473 Ga0114129_10026205
474 Ga0114129_10049958
475 Ga0114129_10128081
476 Ga0114129_10154007
477 Ga0114129_10358601
478 Ga0114129_10471494
479 Ga0114129_10639626
480 Ga0105243_10319494
481 Ga0105243_10497582
482 Ga0105243_10589105
483 Ga0105241_10010334
484 Ga0105241_10075631
485 Ga0105241_10168643
486 Ga0105241_10172074
487 Ga0105241_10209608
488 Ga0105241_10445391
489 Ga0105241_10514088
490 Ga0105241_10601563
491 Ga0105242_10055105
492 Ga0105248_10099250
493 Ga0105248_10160356
494 Ga0105248_10166175
495 Ga0105248_10168584
496 Ga0105248_10926581
497 Ga0105248_11067686
498 Ga0105237_10005907
499 Ga0105237_10402093
500 Ga0105237_10924402
501 Ga0105238_10004519
502 Ga0105238_10081567
503 Ga0105238_10860907
504 Ga0105249_10004360
505 Ga0105239_10298978
506 Ga0105239_10981153
507 Ga0105246_10125472
508 Ga0157373_10073372
509 Ga0163162_10128405
510 Ga0163162_10193549
511 Ga0163162_10228524
512 Ga0163162_10263539
513 Ga0157372_10003205
514 Ga0157375_10053131
515 Ga0157375_10208574
516 Ga0157375_10484549
517 Ga0157375_10719881
518 Ga0163163_10007124
519 Ga0163163_10051392
520 Ga0163163_10090219
521 Ga0163163_10092886
522 Ga0157377_10025195
523 Ga0157377_10222489
524 Ga0157379_10062890
525 Ga0157379_10339872
526 Ga0157376_10350214
527 Ga0207656_10041429
528 Ga0207653_10002923
529 Ga0207710_10000266
530 Ga0207710_10179343
531 Ga0207688_10078918
532 Ga0207647_10030155
533 Ga0207645_10075398
534 Ga0207643_10009806
535 Ga0207643_10091316
536 Ga0207643_10130646
537 Ga0207643_10144241
538 Ga0207684_10000083
539 Ga0207684_10253776
540 Ga0207654_10540646
541 Ga0207707_10016929
542 Ga0207707_10048155
543 Ga0207707_10105160
544 Ga0207707_10575764
545 Ga0207671_10468244
546 Ga0207660_10460526
547 Ga0207662_10025624
548 Ga0207649_10069279
549 Ga0207652_10073113
550 Ga0207652_10236357
551 Ga0207694_10108634
552 Ga0207650_10000006
553 Ga0207650_10294503
554 Ga0207659_10264874
555 Ga0207687_10189831
556 Ga0207690_10037562
557 Ga0207706_10014877
558 Ga0207686_10026238
559 Ga0207709_10217738
560 Ga0207670_10000390
561 Ga0207670_10104243
562 Ga0207711_10092774
563 Ga0207711_10173701
564 Ga0207711_10311632
565 Ga0207689_10008258
566 Ga0207689_10091585
567 Ga0207689_10122200
568 Ga0207689_10142485
569 Ga0207689_10208258
570 Ga0207661_10698838
571 Ga0207679_10014914
572 Ga0207712_10019137
573 Ga0207640_10022836
574 Ga0207640_10162316
575 Ga0207640_10192354
576 Ga0207640_10429458
577 Ga0207703_10044863
578 Ga0207703_10199860
579 Ga0207703_10251650
580 Ga0207703_10301526
581 Ga0207639_10026467
582 Ga0207639_10041484
583 Ga0207639_10250081
584 Ga0207708_10004334
585 Ga0207708_10021551
586 Ga0207708_10064951
587 Ga0207708_10087546
588 Ga0207641_10248533
589 Ga0207641_10867251
590 Ga0207648_10148309
591 Ga0207676_10039020
592 Ga0207676_10041804
593 Ga0207676_10075282
594 Ga0207676_10076275
595 Ga0207674_10014187
596 Ga0207674_10094292
597 Ga0207674_10158087
598 Ga0207674_10270215
599 Ga0207674_10295353
600 Ga0207674_10358038
601 Ga0207674_10409694
602 Ga0207674_10539150
603 Ga0207698_10742897
604 Ga0268265_10140908
605 Ga0268265_10700530
606 Ga0268264_10009655
607 Ga0268264_10098090
608 Ga0268264_10167151
609 Ga0268264_10335743
610 Ga0268264_10505425
611 Ga0268264_10738495
612 Ga0316178_1102858
613 Ga0307408_100003979
614 Ga0307408_100784604
615 Ga0307405_10009046
616 Ga0307406_10010187
617 Ga0307407_10025116
618 Ga0307412_10003326
619 Ga0307412_10183518
620 Ga0307409_100223430
621 Ga0307416_100194896
622 Ga0307414_10015105
623 Ga0307414_10357786
624 Ga0307411_10009619
625 Ga0307415_100006102
626 Ga0395901_0109461
627 Ga0395901_0220477
628 Ga0395901_0352298
629 Ga0242420_016394
630 Ga0439455_0027084
631 Ga0439458_0005554
632 Ga0496106_0166281
633 Ga0496107_0182502
634 Ga0496111_0302744
635 Ga0496112_0332290
636 Ga0496113_0228992
637 Ga0501291_010913
638 Ga0501296_003455
639 Ga0501299_047433
640 Ga0501048_0179431
641 Ga0501202_009682
642 Ga0501230_030079
643 Ga0501233_025891
644 Ga0501235_011801
645 Ga0501236_014881
646 Ga0501251_001461
647 Ga0501251_007687
648 Ga0501258_001273
649 Ga0501221_010842
650 Ga0501225_0004800
651 Ga0501225_0015309
652 Ga0501229_005853
653 Ga0501204_004432
654 nmdc:mga05p37_32750_c1
655 nmdc:mga05p37_351157_c1
656 nmdc:mga05p37_373786_c1
657 nmdc:mga05p37_417318_c1
658 nmdc:mga05p37_445453_c1
659 nmdc:mga05p37_566736_c1
660 nmdc:mga05p37_96954_c1
661 nmdc:mga09592_155151_c1
662 nmdc:mga09592_389797_c1
663 nmdc:mga06r32_241856_c1
664 nmdc:mga06r32_267680_c1
665 nmdc:mga08y16_21229_c1
666 nmdc:mga0n895_189663_c1
667 nmdc:mga0n895_55348_c1
668 nmdc:mga0rr50_188565_c1
669 nmdc:mga0a205_23476_c1
670 nmdc:mga0a205_608926_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fg8-assembly3.cif.gz_C crystal structure of pas domain of rha05790 0.8111 126 152
7t3b-assembly1.cif.gz_G gator1-rag-ragulator - gap complex 0.7705 123 154
5y38-assembly1.cif.gz_B crystal structure of c7orf59-hbxip complex 0.7495 125 152
7tif-assembly12.cif.gz_L 2.85 angstroem crystal structure of arginyltransferase 1 (ate1) from saccharomyces cerevisiae 0.7346 78 95
7kyw-assembly1.cif.gz_A-2 crystal structure of timothy grass allergen phl p 12.0101 reveals an unusual profilin dimer 0.7242 121 152
ID Description Score Start End Superfamily
af_A0A1D8PGW0_1_74_3.40.10.10 Alpha Beta;3-Layer(aba) Sandwich;DNA Methylphosphotriester Repair Domain;DNA Methylphosphotriester Repair Domain 0.8501 186 231 3.40.10.10
3fg8C00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.8111 126 152 3.30.450.20
af_P34392_15_97_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7875 122 152 2.40.50.140
af_Q9VZL6_13_89_3.30.450.30 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.7613 122 151 3.30.450.30
af_Q4D2K4_12_131_3.30.450.30 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.7606 123 154 3.30.450.30
ID Description Score Start End GO Terms
AF-A0A7W0ZL02-F1-model_v4 Uncharacterized protein 0.9834 15 171
AF-A0A7W0ZL02-F1-model_v4 Uncharacterized protein 0.9534 15 171
AF-A0A2V8NBR2-F1-model_v4 Uncharacterized protein 0.9174 2 169
AF-A0A838PK13-F1-model_v4 Uncharacterized protein 0.8721 20 167
AF-A0A1U7I1H4-F1-model_v4 deleted 0.8715 186 231

Map