F412351
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 335 | 204 | 325 | 322 |
Family's Representative Sequence
| Representative Sequence | 3300044656|Ga0466969_0064552|Ga0466969_0064552_320_1369 |
| Length | 349 |
| Sequence | MSDRYSRQTVLPEVGAAGQERLRGASVLVVGAGGLGCAVLQYLCAAGVGRLIIIDPDRVEESNLHRQPLYRMSDLGALKVEASRAALLQVNPDVCIETLAERLTPANVSAAVSKAQLIVDAADSFAATYVLSDECHAVGKPLISASVLGLSGYVGAFCGGAPSYRAVFPEMPRQAGSCAQSGVLGTAVGVMGTLQAHMTLALALDLKAAPGLERLPRDAEQASGGPADGAARCAALGQLITVDFRTLRFGGFSFANAQEPAGAAIPFIDPTEVADTDIVIDLRSLTEAPVSPFASALRIGVDTVERAEEQLPQGRRIVLCCRTGVRAWRAARALQRQGHSNVALIALGD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 2 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 3 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 4 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 5 | 2834578030 | Paracoccus thiocyanatus SST | Isolate | Unclassified |
| 6 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 7 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 8 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 9 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 51 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 52 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 53 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 54 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 58 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 59 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 60 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 61 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 75 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 84 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 87 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 89 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 90 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 91 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 127 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 128 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 129 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 130 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 131 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 132 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 133 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 134 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 135 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 136 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 137 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 138 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 139 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 140 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 141 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 142 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 143 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 144 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 145 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 146 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 147 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 148 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 149 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 150 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 151 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 152 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 153 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 154 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 155 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 156 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 157 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 158 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 164 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 165 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 166 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 167 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 168 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 169 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 170 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 171 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 172 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 173 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 174 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 175 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 176 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 177 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 178 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 179 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 180 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 181 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 190 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 191 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 192 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 193 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 195 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 196 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 197 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 198 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 199 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 200 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 201 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 202 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 203 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 204 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.72 |
| Metatranscriptomes | 0.3 |
| Isolates | 2.99 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.36 |
| Nodule | 1.49 |
| Rhizoplane | 3.28 |
| Rhizosphere | 77.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.85 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootL2_10082985 | 3300003322 | Bacteria | 3721 |
| 2 | Ga0065165_1000132 | 3300005262 | Bacteria | 128732 |
| 3 | Ga0070658_10004845 | 3300005327 | Bacteria | 10959 |
| 4 | Ga0070683_100048777 | 3300005329 | Bacteria | 3915 |
| 5 | Ga0070683_100208036 | 3300005329 | Unclassified | 1858 |
| 6 | Ga0070666_10006053 | 3300005335 | Bacteria | 7430 |
| 7 | Ga0070682_100058587 | 3300005337 | Bacteria | 2429 |
| 8 | Ga0068868_100084470 | 3300005338 | Bacteria | 2550 |
| 9 | Ga0070661_100019304 | 3300005344 | Bacteria | 4859 |
| 10 | Ga0070671_100002471 | 3300005355 | Bacteria | 14293 |
| 11 | Ga0070671_100052893 | 3300005355 | Bacteria | 3376 |
| 12 | Ga0070673_100030920 | 3300005364 | Bacteria | 4013 |
| 13 | Ga0070667_100019356 | 3300005367 | Bacteria | 5647 |
| 14 | Ga0070667_100094182 | 3300005367 | Bacteria | 2580 |
| 15 | Ga0070667_100196671 | 3300005367 | Unclassified | 1787 |
| 16 | Ga0070714_100125247 | 3300005435 | Bacteria | 2290 |
| 17 | Ga0070713_100000397 | 3300005436 | Bacteria | 27956 |
| 18 | Ga0070713_100028752 | 3300005436 | Bacteria | 4393 |
| 19 | Ga0070713_100051968 | 3300005436 | Bacteria | 3391 |
| 20 | Ga0070710_10031700 | 3300005437 | Bacteria | 2857 |
| 21 | Ga0070711_100095159 | 3300005439 | Bacteria | 2155 |
| 22 | Ga0070705_100046086 | 3300005440 | Bacteria | 2512 |
| 23 | Ga0070708_100044953 | 3300005445 | Bacteria | 3888 |
| 24 | Ga0070678_100011994 | 3300005456 | Bacteria | 5368 |
| 25 | Ga0070681_10004986 | 3300005458 | Bacteria | 12781 |
| 26 | Ga0070681_10006133 | 3300005458 | Bacteria | 11669 |
| 27 | Ga0070681_10029396 | 3300005458 | Bacteria | 5519 |
| 28 | Ga0070681_10192364 | 3300005458 | Unclassified | 1960 |
| 29 | Ga0068867_100140656 | 3300005459 | Bacteria | 1886 |
| 30 | Ga0070706_100034527 | 3300005467 | Bacteria | 4672 |
| 31 | Ga0070698_100005048 | 3300005471 | Bacteria | 14467 |
| 32 | Ga0070699_100029046 | 3300005518 | Bacteria | 4767 |
| 33 | Ga0070699_100143135 | 3300005518 | Bacteria | 2112 |
| 34 | Ga0070699_100551732 | 3300005518 | Unclassified | 1049 |
| 35 | Ga0070679_100028958 | 3300005530 | Bacteria | 5463 |
| 36 | Ga0070679_100053779 | 3300005530 | Bacteria | 4008 |
| 37 | Ga0070679_100148106 | 3300005530 | Bacteria | 2325 |
| 38 | Ga0070684_100198238 | 3300005535 | Bacteria | 1828 |
| 39 | Ga0070697_100133115 | 3300005536 | Bacteria | 2086 |
| 40 | Ga0068853_100097326 | 3300005539 | Bacteria | 2597 |
| 41 | Ga0068853_100326202 | 3300005539 | Bacteria | 1424 |
| 42 | Ga0070686_100085638 | 3300005544 | Unclassified | 2096 |
| 43 | Ga0070695_100026405 | 3300005545 | Bacteria | 3592 |
| 44 | Ga0070665_100004850 | 3300005548 | Bacteria | 13977 |
| 45 | Ga0070665_100009408 | 3300005548 | Bacteria | 9890 |
| 46 | Ga0070665_100019793 | 3300005548 | Bacteria | 6757 |
| 47 | Ga0070665_100061097 | 3300005548 | Bacteria | 3777 |
| 48 | Ga0070665_100107949 | 3300005548 | Bacteria | 2786 |
| 49 | Ga0070665_100151476 | 3300005548 | Bacteria | 2322 |
| 50 | Ga0070665_100172827 | 3300005548 | Bacteria | 2161 |
| 51 | Ga0070665_100266188 | 3300005548 | Bacteria | 1715 |
| 52 | Ga0068855_100000456 | 3300005563 | Bacteria | 50301 |
| 53 | Ga0068855_100042393 | 3300005563 | Bacteria | 5392 |
| 54 | Ga0068855_100052408 | 3300005563 | Bacteria | 4803 |
| 55 | Ga0068855_100214883 | 3300005563 | Bacteria | 2159 |
| 56 | Ga0068855_100308973 | 3300005563 | Bacteria | 1750 |
| 57 | Ga0070664_100065265 | 3300005564 | Bacteria | 3105 |
| 58 | Ga0068857_100045550 | 3300005577 | Bacteria | 3892 |
| 59 | Ga0068856_100044148 | 3300005614 | Bacteria | 4385 |
| 60 | Ga0068859_100020031 | 3300005617 | Bacteria | 6717 |
| 61 | Ga0068859_100409726 | 3300005617 | Bacteria | 1451 |
| 62 | Ga0068851_10074340 | 3300005834 | Unclassified | 1764 |
| 63 | Ga0068863_100007033 | 3300005841 | Bacteria | 11025 |
| 64 | Ga0068863_100015599 | 3300005841 | Bacteria | 7299 |
| 65 | Ga0068863_100050965 | 3300005841 | Bacteria | 3924 |
| 66 | Ga0068858_100000542 | 3300005842 | Bacteria | 39272 |
| 67 | Ga0068858_100005019 | 3300005842 | Bacteria | 12969 |
| 68 | Ga0068858_100023857 | 3300005842 | Bacteria | 5699 |
| 69 | Ga0068858_100226650 | 3300005842 | Bacteria | 1771 |
| 70 | Ga0068858_100263092 | 3300005842 | Bacteria | 1640 |
| 71 | Ga0068860_100001034 | 3300005843 | Bacteria | 30629 |
| 72 | Ga0068860_100004915 | 3300005843 | Bacteria | 13619 |
| 73 | Ga0068860_100179993 | 3300005843 | Bacteria | 2043 |
| 74 | Ga0068862_100032154 | 3300005844 | Bacteria | 4432 |
| 75 | Ga0081455_10001725 | 3300005937 | Bacteria | 26473 |
| 76 | Ga0081455_10037419 | 3300005937 | Bacteria | 4310 |
| 77 | Ga0081455_10054516 | 3300005937 | Bacteria | 3407 |
| 78 | Ga0081539_10003921 | 3300005985 | Bacteria | 17277 |
| 79 | Ga0081539_10004477 | 3300005985 | Bacteria | 15388 |
| 80 | Ga0075365_10087909 | 3300006038 | Unclassified | 2113 |
| 81 | Ga0075364_10083393 | 3300006051 | Bacteria | 2115 |
| 82 | Ga0070715_10001423 | 3300006163 | Bacteria | 6928 |
| 83 | Ga0070716_100044238 | 3300006173 | Bacteria | 2494 |
| 84 | Ga0070712_100070729 | 3300006175 | Bacteria | 2494 |
| 85 | Ga0070712_100183848 | 3300006175 | Unclassified | 1631 |
| 86 | Ga0075362_10005463 | 3300006177 | Bacteria | 4652 |
| 87 | Ga0075362_10011850 | 3300006177 | Bacteria | 3445 |
| 88 | Ga0075367_10094668 | 3300006178 | Bacteria | 1821 |
| 89 | Ga0075369_10004840 | 3300006186 | Bacteria | 5010 |
| 90 | Ga0075366_10010533 | 3300006195 | Bacteria | 5192 |
| 91 | Ga0097621_100062095 | 3300006237 | Unclassified | 3067 |
| 92 | Ga0068871_100051163 | 3300006358 | Plasmid | 3344 |
| 93 | Ga0068871_100062057 | 3300006358 | Bacteria | 3054 |
| 94 | Ga0068871_100063310 | 3300006358 | Bacteria | 3025 |
| 95 | Ga0097620_100020032 | 3300006931 | Bacteria | 6717 |
| 96 | Ga0097620_100409725 | 3300006931 | Bacteria | 1451 |
| 97 | Ga0105240_10000420 | 3300009093 | Bacteria | 78578 |
| 98 | Ga0105240_10006821 | 3300009093 | Bacteria | 16702 |
| 99 | Ga0105240_10015909 | 3300009093 | Bacteria | 10206 |
| 100 | Ga0105240_10018310 | 3300009093 | Bacteria | 9413 |
| 101 | Ga0105240_10064440 | 3300009093 | Bacteria | 4554 |
| 102 | Ga0105240_10066081 | 3300009093 | Bacteria | 4488 |
| 103 | Ga0105240_10076621 | 3300009093 | Bacteria | 4122 |
| 104 | Ga0105240_10090871 | 3300009093 | Bacteria | 3731 |
| 105 | Ga0105240_10135897 | 3300009093 | Bacteria | 2945 |
| 106 | Ga0105240_10168712 | 3300009093 | Unclassified | 2594 |
| 107 | Ga0111539_10572683 | 3300009094 | Bacteria | 1315 |
| 108 | Ga0105245_10027152 | 3300009098 | Bacteria | 5043 |
| 109 | Ga0105247_10000359 | 3300009101 | Bacteria | 39147 |
| 110 | Ga0105247_10082029 | 3300009101 | Unclassified | 2034 |
| 111 | Ga0105241_10505957 | 3300009174 | Bacteria | 1078 |
| 112 | Ga0105242_10002762 | 3300009176 | Bacteria | 13735 |
| 113 | Ga0105248_10035899 | 3300009177 | Bacteria | 5545 |
| 114 | Ga0105248_10061836 | 3300009177 | Bacteria | 4205 |
| 115 | Ga0105237_10135637 | 3300009545 | Bacteria | 2455 |
| 116 | Ga0105237_10196815 | 3300009545 | Bacteria | 2015 |
| 117 | Ga0105238_10001541 | 3300009551 | Bacteria | 23092 |
| 118 | Ga0105238_10056394 | 3300009551 | Bacteria | 3942 |
| 119 | Ga0105238_10113339 | 3300009551 | Unclassified | 2691 |
| 120 | Ga0105238_10220777 | 3300009551 | Unclassified | 1871 |
| 121 | Ga0105249_10018075 | 3300009553 | Bacteria | 6267 |
| 122 | Ga0105249_10036911 | 3300009553 | Bacteria | 4434 |
| 123 | Ga0105035_101723 | 3300009988 | Bacteria | 1545 |
| 124 | Ga0099796_10034563 | 3300010159 | Unclassified | 1670 |
| 125 | Ga0105239_10039820 | 3300010375 | Bacteria | 5149 |
| 126 | Ga0105239_10206848 | 3300010375 | Bacteria | 2199 |
| 127 | Ga0105239_10286479 | 3300010375 | Unclassified | 1855 |
| 128 | Ga0105246_10047687 | 3300011119 | Bacteria | 2927 |
| 129 | Ga0157370_10017473 | 3300013104 | Bacteria | 7237 |
| 130 | Ga0157370_10055563 | 3300013104 | Bacteria | 3771 |
| 131 | Ga0157369_10011238 | 3300013105 | Bacteria | 10176 |
| 132 | Ga0157369_10179502 | 3300013105 | Unclassified | 2228 |
| 133 | Ga0157378_10016752 | 3300013297 | Bacteria | 6421 |
| 134 | Ga0157372_10019757 | 3300013307 | Bacteria | 7260 |
| 135 | Ga0157372_10150017 | 3300013307 | Bacteria | 2690 |
| 136 | Ga0157372_10519095 | 3300013307 | Bacteria | 1389 |
| 137 | Ga0163163_10062455 | 3300014325 | Bacteria | 3691 |
| 138 | Ga0182008_10015029 | 3300014497 | Bacteria | 4047 |
| 139 | Ga0157379_10067384 | 3300014968 | Bacteria | 3200 |
| 140 | Ga0157379_10115802 | 3300014968 | Unclassified | 2410 |
| 141 | Ga0157379_10344768 | 3300014968 | Unclassified | 1363 |
| 142 | Ga0157376_10076274 | 3300014969 | Bacteria | 2864 |
| 143 | Ga0182007_10008070 | 3300015262 | Bacteria | 4348 |
| 144 | Ga0206353_10462851 | 3300020082 | Bacteria | 1325 |
| 145 | Ga0213874_10000509 | 3300021377 | Bacteria | 7798 |
| 146 | Ga0213871_10003393 | 3300021441 | Bacteria | 3064 |
| 147 | Ga0209026_1000010 | 3300025250 | Bacteria | 511986 |
| 148 | Ga0209130_1000327 | 3300025284 | Bacteria | 54775 |
| 149 | Ga0207426_1010390 | 3300025302 | Bacteria | 3614 |
| 150 | Ga0207692_10045489 | 3300025898 | Bacteria | 2196 |
| 151 | Ga0207710_10005711 | 3300025900 | Bacteria | 5343 |
| 152 | Ga0207710_10088233 | 3300025900 | Unclassified | 1448 |
| 153 | Ga0207647_10084671 | 3300025904 | Unclassified | 1897 |
| 154 | Ga0207685_10009080 | 3300025905 | Bacteria | 2871 |
| 155 | Ga0207699_10001022 | 3300025906 | Bacteria | 13212 |
| 156 | Ga0207699_10091672 | 3300025906 | Bacteria | 1909 |
| 157 | Ga0207705_10031713 | 3300025909 | Bacteria | 3774 |
| 158 | Ga0207684_10205849 | 3300025910 | Bacteria | 1697 |
| 159 | Ga0207707_10080546 | 3300025912 | Bacteria | 2844 |
| 160 | Ga0207707_10095791 | 3300025912 | Bacteria | 2594 |
| 161 | Ga0207707_10189435 | 3300025912 | Bacteria | 1795 |
| 162 | Ga0207695_10017905 | 3300025913 | Bacteria | 8207 |
| 163 | Ga0207695_10032020 | 3300025913 | Bacteria | 5759 |
| 164 | Ga0207695_10044617 | 3300025913 | Bacteria | 4713 |
| 165 | Ga0207695_10076166 | 3300025913 | Bacteria | 3411 |
| 166 | Ga0207695_10080892 | 3300025913 | Bacteria | 3289 |
| 167 | Ga0207695_10081416 | 3300025913 | Bacteria | 3276 |
| 168 | Ga0207695_10160414 | 3300025913 | Unclassified | 2181 |
| 169 | Ga0207671_10083552 | 3300025914 | Bacteria | 2397 |
| 170 | Ga0207693_10000673 | 3300025915 | Bacteria | 30672 |
| 171 | Ga0207649_10010921 | 3300025920 | Bacteria | 4994 |
| 172 | Ga0207652_10022444 | 3300025921 | Bacteria | 5222 |
| 173 | Ga0207652_10136236 | 3300025921 | Bacteria | 2193 |
| 174 | Ga0207694_10029976 | 3300025924 | Bacteria | 4154 |
| 175 | Ga0207694_10154659 | 3300025924 | Bacteria | 1849 |
| 176 | Ga0207694_10214025 | 3300025924 | Bacteria | 1570 |
| 177 | Ga0207659_10272656 | 3300025926 | Bacteria | 1380 |
| 178 | Ga0207700_10098246 | 3300025928 | Bacteria | 2328 |
| 179 | Ga0207644_10228420 | 3300025931 | Bacteria | 1478 |
| 180 | Ga0207690_10022316 | 3300025932 | Bacteria | 3935 |
| 181 | Ga0207690_10186181 | 3300025932 | Bacteria | 1567 |
| 182 | Ga0207665_10013173 | 3300025939 | Bacteria | 5438 |
| 183 | Ga0207665_10143096 | 3300025939 | Bacteria | 1707 |
| 184 | Ga0207691_10129865 | 3300025940 | Bacteria | 2226 |
| 185 | Ga0207711_10424772 | 3300025941 | Unclassified | 1236 |
| 186 | Ga0207667_10001926 | 3300025949 | Bacteria | 26045 |
| 187 | Ga0207667_10026338 | 3300025949 | Bacteria | 6356 |
| 188 | Ga0207667_10044995 | 3300025949 | Bacteria | 4675 |
| 189 | Ga0207667_10051462 | 3300025949 | Bacteria | 4342 |
| 190 | Ga0207667_10169519 | 3300025949 | Bacteria | 2244 |
| 191 | Ga0207667_10377407 | 3300025949 | Bacteria | 1445 |
| 192 | Ga0207651_10051268 | 3300025960 | Bacteria | 2807 |
| 193 | Ga0207658_10075450 | 3300025986 | Unclassified | 2565 |
| 194 | Ga0207703_10001716 | 3300026035 | Bacteria | 19682 |
| 195 | Ga0207678_10284715 | 3300026067 | Unclassified | 1419 |
| 196 | Ga0207702_10036824 | 3300026078 | Bacteria | 4093 |
| 197 | Ga0207702_10074949 | 3300026078 | Bacteria | 2922 |
| 198 | Ga0207641_10000106 | 3300026088 | Bacteria | 121316 |
| 199 | Ga0207648_10121731 | 3300026089 | Bacteria | 2294 |
| 200 | Ga0207674_10043086 | 3300026116 | Bacteria | 4655 |
| 201 | Ga0207683_10018935 | 3300026121 | Bacteria | 5874 |
| 202 | Ga0268266_10002158 | 3300028379 | Bacteria | 21584 |
| 203 | Ga0268266_10002983 | 3300028379 | Bacteria | 17447 |
| 204 | Ga0268266_10027913 | 3300028379 | Bacteria | 4800 |
| 205 | Ga0268266_10073944 | 3300028379 | Bacteria | 2959 |
| 206 | Ga0268266_10447565 | 3300028379 | Bacteria | 1227 |
| 207 | Ga0268264_10000188 | 3300028381 | Bacteria | 129042 |
| 208 | Ga0265334_10015508 | 3300028573 | Bacteria | 3163 |
| 209 | Ga0307515_10068007 | 3300028794 | Bacteria | 4903 |
| 210 | Ga0307511_10000348 | 3300030521 | Bacteria | 49134 |
| 211 | Ga0307511_10011017 | 3300030521 | Bacteria | 8926 |
| 212 | Ga0265332_10034756 | 3300031238 | Bacteria | 2190 |
| 213 | Ga0265340_10004596 | 3300031247 | Bacteria | 7684 |
| 214 | Ga0307509_10000002 | 3300031507 | Bacteria | 607551 |
| 215 | Ga0307509_10229853 | 3300031507 | Bacteria | 1659 |
| 216 | Ga0307508_10184778 | 3300031616 | Bacteria | 1687 |
| 217 | Ga0307406_10096093 | 3300031901 | Bacteria | 2007 |
| 218 | Ga0307416_100358274 | 3300032002 | Bacteria | 1480 |
| 219 | Ga0373936_0001707 | 3300035113 | Bacteria | 8062 |
| 220 | Ga0373931_0025111 | 3300035691 | Bacteria | 3026 |
| 221 | Ga0373927_0077965 | 3300035695 | Bacteria | 2146 |
| 222 | Ga0373927_0135910 | 3300035695 | Bacteria | 1607 |
| 223 | Ga0373937_0026169 | 3300036401 | Bacteria | 5272 |
| 224 | Ga0373937_0030721 | 3300036401 | Bacteria | 4865 |
| 225 | Ga0373925_0080892 | 3300037068 | Bacteria | 2470 |
| 226 | Ga0395899_0009795 | 3300037312 | Bacteria | 7353 |
| 227 | Ga0395899_0016573 | 3300037312 | Bacteria | 5620 |
| 228 | Ga0395899_0068673 | 3300037312 | Bacteria | 2598 |
| 229 | Ga0395900_0007979 | 3300037418 | Bacteria | 10895 |
| 230 | Ga0395900_0012665 | 3300037418 | Bacteria | 8623 |
| 231 | Ga0395898_0006242 | 3300037466 | Bacteria | 12763 |
| 232 | Ga0395898_0108924 | 3300037466 | Bacteria | 2656 |
| 233 | Ga0395898_0247371 | 3300037466 | Bacteria | 1700 |
| 234 | Ga0395905_0174106 | 3300037471 | Bacteria | 2021 |
| 235 | Ga0395901_0002054 | 3300038443 | Bacteria | 20648 |
| 236 | Ga0395901_0003392 | 3300038443 | Bacteria | 16043 |
| 237 | Ga0395901_0151759 | 3300038443 | Bacteria | 2434 |
| 238 | Ga0395901_0345533 | 3300038443 | Bacteria | 1536 |
| 239 | Ga0436360_1021191 | 3300039438 | Unclassified | 1716 |
| 240 | Ga0436360_1376989 | 3300039438 | Bacteria | 11305 |
| 241 | Ga0436361_0685736 | 3300039447 | Bacteria | 2320 |
| 242 | Ga0436363_1569227 | 3300039450 | Bacteria | 9740 |
| 243 | Ga0436363_1676543 | 3300039450 | Bacteria | 1145 |
| 244 | Ga0436362_0082311 | 3300039453 | Bacteria | 5594 |
| 245 | Ga0436362_1130171 | 3300039453 | Bacteria | 2657 |
| 246 | Ga0466969_0005906 | 3300044656 | Bacteria | 6510 |
| 247 | Ga0466969_0007699 | 3300044656 | Bacteria | 5729 |
| 248 | Ga0466969_0064552 | 3300044656 | Bacteria | 1772 |
| 249 | Ga0466961_0003120 | 3300044693 | Bacteria | 10312 |
| 250 | Ga0466961_0067386 | 3300044693 | Bacteria | 2274 |
| 251 | Ga0466964_0003100 | 3300044706 | Bacteria | 6048 |
| 252 | Ga0466971_0000538 | 3300044719 | Bacteria | 15029 |
| 253 | Ga0466970_0018079 | 3300044765 | Bacteria | 3648 |
| 254 | Ga0466957_0053972 | 3300044842 | Bacteria | 2451 |
| 255 | Ga0466960_0027673 | 3300044901 | Bacteria | 2589 |
| 256 | Ga0466959_0025140 | 3300045049 | Bacteria | 4411 |
| 257 | Ga0466959_0118174 | 3300045049 | Unclassified | 1887 |
| 258 | Ga0466959_0151720 | 3300045049 | Bacteria | 1633 |
| 259 | Ga0466958_0112415 | 3300045836 | Bacteria | 1701 |
| 260 | Ga0495580_0004619 | 3300046472 | Bacteria | 11560 |
| 261 | Ga0495580_0090088 | 3300046472 | Bacteria | 2135 |
| 262 | Ga0495618_0147181 | 3300046514 | Unclassified | 1505 |
| 263 | Ga0495632_0070560 | 3300046519 | Unclassified | 1680 |
| 264 | Ga0495668_0201330 | 3300046616 | Unclassified | 1090 |
| 265 | Ga0495687_043727 | 3300047443 | Bacteria | 1950 |
| 266 | Ga0496102_0006186 | 3300048905 | Bacteria | 10204 |
| 267 | Ga0496102_0115253 | 3300048905 | Bacteria | 2507 |
| 268 | Ga0496103_0019493 | 3300048906 | Bacteria | 4074 |
| 269 | Ga0496103_0101083 | 3300048906 | Bacteria | 1825 |
| 270 | Ga0496105_0211780 | 3300048908 | Bacteria | 1580 |
| 271 | Ga0496107_0005388 | 3300048910 | Bacteria | 8753 |
| 272 | Ga0496110_0010247 | 3300048913 | Bacteria | 7614 |
| 273 | Ga0496111_0056794 | 3300048914 | Bacteria | 2833 |
| 274 | Ga0496112_0048367 | 3300048915 | Bacteria | 4170 |
| 275 | Ga0496114_0013758 | 3300048917 | Bacteria | 6485 |
| 276 | Ga0496115_0153396 | 3300048918 | Bacteria | 1902 |
| 277 | Ga0496116_0007140 | 3300048919 | Bacteria | 9992 |
| 278 | Ga0496117_0000110 | 3300048920 | Bacteria | 184627 |
| 279 | Ga0496118_0000014 | 3300048921 | Bacteria | 561628 |
| 280 | Ga0496119_0000203 | 3300048922 | Bacteria | 84250 |
| 281 | Ga0496119_0052522 | 3300048922 | Bacteria | 2495 |
| 282 | Ga0496119_0093099 | 3300048922 | Unclassified | 1708 |
| 283 | Ga0496119_0242124 | 3300048922 | Unclassified | 913 |
| 284 | Ga0496120_0000018 | 3300048923 | Bacteria | 263952 |
| 285 | Ga0496120_0089741 | 3300048923 | Bacteria | 1644 |
| 286 | Ga0496120_0153418 | 3300048923 | Unclassified | 1155 |
| 287 | Ga0496121_0001306 | 3300048924 | Bacteria | 42785 |
| 288 | Ga0496121_0143923 | 3300048924 | Unclassified | 1764 |
| 289 | Ga0496124_0032798 | 3300048927 | Bacteria | 4580 |
| 290 | Ga0496125_0000568 | 3300048928 | Bacteria | 63393 |
| 291 | Ga0496125_0005340 | 3300048928 | Bacteria | 14354 |
| 292 | Ga0496125_0143029 | 3300048928 | Unclassified | 1659 |
| 293 | Ga0496126_0019198 | 3300048929 | Bacteria | 6738 |
| 294 | Ga0501032_0014065 | 3300049569 | Bacteria | 5677 |
| 295 | Ga0501034_0001246 | 3300049571 | Bacteria | 34606 |
| 296 | Ga0501034_0001285 | 3300049571 | Bacteria | 33952 |
| 297 | Ga0501034_0139025 | 3300049571 | Bacteria | 2409 |
| 298 | Ga0501034_0248718 | 3300049571 | Bacteria | 1723 |
| 299 | Ga0501037_0129548 | 3300049573 | Bacteria | 1810 |
| 300 | Ga0501043_0012714 | 3300049579 | Bacteria | 6581 |
| 301 | Ga0501046_0009097 | 3300049580 | Bacteria | 8608 |
| 302 | Ga0501047_0024895 | 3300049581 | Bacteria | 5748 |
| 303 | Ga0501047_0111712 | 3300049581 | Bacteria | 2615 |
| 304 | Ga0501068_0019566 | 3300049584 | Bacteria | 3934 |
| 305 | Ga0501044_0065928 | 3300049823 | Bacteria | 3693 |
| 306 | nmdc:mga03683_405_c2 | 3300050489 | Bacteria | 8154 |
| 307 | nmdc:mga0yw44_152268_c1 | 3300050492 | Bacteria | 1509 |
| 308 | nmdc:mga0yw44_21392_c1 | 3300050492 | Bacteria | 3607 |
| 309 | nmdc:mga06z11_77756_c1 | 3300050494 | Bacteria | 1772 |
| 310 | nmdc:mga07m45_62144_c1 | 3300050496 | Unclassified | 2116 |
| 311 | nmdc:mga08y16_785780_c1 | 3300050511 | Bacteria | 946 |
| 312 | nmdc:mga0sz30_1802_c1 | 3300050516 | Bacteria | 7615 |
| 313 | nmdc:mga0sz30_4471_c2 | 3300050516 | Bacteria | 4614 |
| 314 | Ga0500644_0006737 | 3300053088 | Bacteria | 2959 |
| 315 | Ga0500644_0059544 | 3300053088 | Unclassified | 1340 |
| 316 | Ga0500583_0001345 | 3300053092 | Bacteria | 7024 |
| 317 | Ga0500583_0074249 | 3300053092 | Bacteria | 1631 |
| 318 | Ga0500651_0028041 | 3300053093 | Bacteria | 3541 |
| 319 | Ga0500651_0163955 | 3300053093 | Unclassified | 1328 |
| 320 | Ga0500641_0003063 | 3300053096 | Bacteria | 5928 |
| 321 | Ga0500588_0008545 | 3300053146 | Unclassified | 2397 |
| 322 | Ga0500616_0012975 | 3300053153 | Bacteria | 4853 |
| 323 | Ga0500622_0035807 | 3300053156 | Unclassified | 2596 |
| 324 | Ga0500637_0038445 | 3300053178 | Bacteria | 2696 |
| 325 | Ga0466962_0014340 | 3300061719 | Bacteria | 3819 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300011119 | Ga0105246_10047687 | Ga0105246_100476873 | 270 |
| 2 | 3300005937 | Ga0081455_10037419 | Ga0081455_100374192 | 271 |
| 3 | 3300005262 | Ga0065165_1000132 | Ga0065165_100013299 | 276 |
| 4 | 3300025284 | Ga0209130_1000327 | Ga0209130_100032724 | 276 |
| 5 | 3300025302 | Ga0207426_1010390 | Ga0207426_10103904 | 276 |
| 6 | 3300048922 | Ga0496119_0052522 | Ga0496119_0052522_1639_2472 | 276 |
| 7 | 3300048922 | Ga0496119_0242124 | Ga0496119_0242124_24_857 | 276 |
| 8 | 3300048923 | Ga0496120_0089741 | Ga0496120_0089741_24_857 | 276 |
| 9 | 3300048923 | Ga0496120_0153418 | Ga0496120_0153418_24_857 | 276 |
| 10 | 3300050511 | nmdc:mga08y16_785780_c1 | nmdc:mga08y16_785780_c1_58_912 | 283 |
| 11 | 3300025928 | Ga0207700_10098246 | Ga0207700_100982464 | 289 |
| 12 | 3300015262 | Ga0182007_10008070 | Ga0182007_100080704 | 290 |
| 13 | 3300010375 | Ga0105239_10039820 | Ga0105239_100398206 | 291 |
| 14 | 3300021441 | Ga0213871_10003393 | Ga0213871_100033932 | 293 |
| 15 | 3300039438 | Ga0436360_1376989 | Ga0436360_1376989_3161_4174 | 293 |
| 16 | 3300046616 | Ga0495668_0201330 | Ga0495668_0201330_10_897 | 294 |
| 17 | 3300053088 | Ga0500644_0059544 | Ga0500644_0059544_439_1329 | 294 |
| 18 | 3300005548 | Ga0070665_100151476 | Ga0070665_1001514763 | 296 |
| 19 | 3300005563 | Ga0068855_100000456 | Ga0068855_10000045624 | 296 |
| 20 | 3300009093 | Ga0105240_10000420 | Ga0105240_1000042057 | 296 |
| 21 | 3300009545 | Ga0105237_10196815 | Ga0105237_101968152 | 296 |
| 22 | 3300010375 | Ga0105239_10286479 | Ga0105239_102864792 | 296 |
| 23 | 3300013307 | Ga0157372_10519095 | Ga0157372_105190951 | 296 |
| 24 | 3300025913 | Ga0207695_10160414 | Ga0207695_101604143 | 296 |
| 25 | 3300025914 | Ga0207671_10083552 | Ga0207671_100835522 | 296 |
| 26 | 3300025924 | Ga0207694_10154659 | Ga0207694_101546592 | 296 |
| 27 | 3300025949 | Ga0207667_10001926 | Ga0207667_100019263 | 296 |
| 28 | 3300028379 | Ga0268266_10073944 | Ga0268266_100739444 | 296 |
| 29 | 3300005436 | Ga0070713_100000397 | Ga0070713_10000039718 | 297 |
| 30 | 3300014497 | Ga0182008_10015029 | Ga0182008_100150296 | 297 |
| 31 | 3300031238 | Ga0265332_10034756 | Ga0265332_100347562 | 298 |
| 32 | 3300048906 | Ga0496103_0101083 | Ga0496103_0101083_254_1228 | 298 |
| 33 | 3300049569 | Ga0501032_0014065 | Ga0501032_0014065_239_1225 | 299 |
| 34 | 3300049573 | Ga0501037_0129548 | Ga0501037_0129548_812_1798 | 299 |
| 35 | 3300049579 | Ga0501043_0012714 | Ga0501043_0012714_3426_4412 | 299 |
| 36 | 3300049580 | Ga0501046_0009097 | Ga0501046_0009097_4537_5523 | 299 |
| 37 | 3300049581 | Ga0501047_0024895 | Ga0501047_0024895_1647_2633 | 299 |
| 38 | 3300005327 | Ga0070658_10004845 | Ga0070658_100048459 | 301 |
| 39 | 3300005458 | Ga0070681_10006133 | Ga0070681_100061336 | 301 |
| 40 | 3300005530 | Ga0070679_100028958 | Ga0070679_1000289586 | 301 |
| 41 | 3300005563 | Ga0068855_100042393 | Ga0068855_1000423936 | 301 |
| 42 | 3300009093 | Ga0105240_10006821 | Ga0105240_1000682111 | 301 |
| 43 | 3300025909 | Ga0207705_10031713 | Ga0207705_100317135 | 301 |
| 44 | 3300025921 | Ga0207652_10022444 | Ga0207652_100224446 | 301 |
| 45 | 3300025949 | Ga0207667_10044995 | Ga0207667_100449956 | 301 |
| 46 | 3300028794 | Ga0307515_10068007 | Ga0307515_100680075 | 301 |
| 47 | 3300053153 | Ga0500616_0012975 | Ga0500616_0012975_2305_3270 | 301 |
| 48 | 3300031247 | Ga0265340_10004596 | Ga0265340_100045963 | 304 |
| 49 | 3300035695 | Ga0373927_0135910 | Ga0373927_0135910_398_1366 | 304 |
| 50 | iso_pu_bacteria | 2834578030 | 2834580959 | 304 |
| 51 | 3300025250 | Ga0209026_1000010 | Ga0209026_1000010377 | 309 |
| 52 | 3300005539 | Ga0068853_100326202 | Ga0068853_1003262021 | 311 |
| 53 | 3300005548 | Ga0070665_100004850 | Ga0070665_10000485014 | 311 |
| 54 | 3300005548 | Ga0070665_100172827 | Ga0070665_1001728273 | 311 |
| 55 | 3300005842 | Ga0068858_100226650 | Ga0068858_1002266502 | 311 |
| 56 | 3300028379 | Ga0268266_10027913 | Ga0268266_100279134 | 311 |
| 57 | 3300028379 | Ga0268266_10447565 | Ga0268266_104475652 | 311 |
| 58 | 3300044901 | Ga0466960_0027673 | Ga0466960_0027673_449_1423 | 311 |
| 59 | 3300049581 | Ga0501047_0111712 | Ga0501047_0111712_1546_2535 | 311 |
| 60 | 3300053088 | Ga0500644_0006737 | Ga0500644_0006737_929_1891 | 311 |
| 61 | 3300053093 | Ga0500651_0163955 | Ga0500651_0163955_165_1127 | 311 |
| 62 | 3300005329 | Ga0070683_100048777 | Ga0070683_1000487775 | 312 |
| 63 | 3300005344 | Ga0070661_100019304 | Ga0070661_1000193047 | 312 |
| 64 | 3300005456 | Ga0070678_100011994 | Ga0070678_1000119947 | 312 |
| 65 | 3300005535 | Ga0070684_100198238 | Ga0070684_1001982383 | 312 |
| 66 | 3300005548 | Ga0070665_100009408 | Ga0070665_1000094089 | 312 |
| 67 | 3300005548 | Ga0070665_100266188 | Ga0070665_1002661882 | 312 |
| 68 | 3300005563 | Ga0068855_100052408 | Ga0068855_1000524085 | 312 |
| 69 | 3300005563 | Ga0068855_100308973 | Ga0068855_1003089732 | 312 |
| 70 | 3300005564 | Ga0070664_100065265 | Ga0070664_1000652653 | 312 |
| 71 | 3300005614 | Ga0068856_100044148 | Ga0068856_1000441487 | 312 |
| 72 | 3300006038 | Ga0075365_10087909 | Ga0075365_100879092 | 312 |
| 73 | 3300006051 | Ga0075364_10083393 | Ga0075364_100833934 | 312 |
| 74 | 3300006177 | Ga0075362_10011850 | Ga0075362_100118502 | 312 |
| 75 | 3300006178 | Ga0075367_10094668 | Ga0075367_100946683 | 312 |
| 76 | 3300006195 | Ga0075366_10010533 | Ga0075366_100105332 | 312 |
| 77 | 3300006358 | Ga0068871_100063310 | Ga0068871_1000633103 | 312 |
| 78 | 3300009093 | Ga0105240_10066081 | Ga0105240_100660816 | 312 |
| 79 | 3300009551 | Ga0105238_10056394 | Ga0105238_100563942 | 312 |
| 80 | 3300009988 | Ga0105035_101723 | Ga0105035_1017232 | 312 |
| 81 | 3300010375 | Ga0105239_10206848 | Ga0105239_102068482 | 312 |
| 82 | 3300020082 | Ga0206353_10462851 | Ga0206353_104628511 | 312 |
| 83 | 3300025913 | Ga0207695_10044617 | Ga0207695_100446177 | 312 |
| 84 | 3300025920 | Ga0207649_10010921 | Ga0207649_100109217 | 312 |
| 85 | 3300025926 | Ga0207659_10272656 | Ga0207659_102726562 | 312 |
| 86 | 3300025931 | Ga0207644_10228420 | Ga0207644_102284202 | 312 |
| 87 | 3300025932 | Ga0207690_10186181 | Ga0207690_101861811 | 312 |
| 88 | 3300025940 | Ga0207691_10129865 | Ga0207691_101298653 | 312 |
| 89 | 3300025949 | Ga0207667_10026338 | Ga0207667_100263387 | 312 |
| 90 | 3300025949 | Ga0207667_10377407 | Ga0207667_103774071 | 312 |
| 91 | 3300026078 | Ga0207702_10036824 | Ga0207702_100368242 | 312 |
| 92 | 3300026121 | Ga0207683_10018935 | Ga0207683_100189357 | 312 |
| 93 | 3300037312 | Ga0395899_0016573 | Ga0395899_0016573_1128_2093 | 312 |
| 94 | 3300037418 | Ga0395900_0007979 | Ga0395900_0007979_2431_3396 | 312 |
| 95 | 3300037466 | Ga0395898_0006242 | Ga0395898_0006242_199_1164 | 312 |
| 96 | 3300037471 | Ga0395905_0174106 | Ga0395905_0174106_866_1831 | 312 |
| 97 | 3300038443 | Ga0395901_0003392 | Ga0395901_0003392_7470_8435 | 312 |
| 98 | 3300038443 | Ga0395901_0151759 | Ga0395901_0151759_545_1510 | 312 |
| 99 | 3300039447 | Ga0436361_0685736 | Ga0436361_0685736_1058_2020 | 312 |
| 100 | 3300045836 | Ga0466958_0112415 | Ga0466958_0112415_174_1139 | 312 |
| 101 | 3300049571 | Ga0501034_0001246 | Ga0501034_0001246_1157_2122 | 312 |
| 102 | 3300049571 | Ga0501034_0001285 | Ga0501034_0001285_15072_16037 | 312 |
| 103 | 3300049571 | Ga0501034_0139025 | Ga0501034_0139025_1131_2096 | 312 |
| 104 | 3300049571 | Ga0501034_0248718 | Ga0501034_0248718_418_1383 | 312 |
| 105 | 3300049584 | Ga0501068_0019566 | Ga0501068_0019566_310_1275 | 312 |
| 106 | 3300049823 | Ga0501044_0065928 | Ga0501044_0065928_2558_3523 | 312 |
| 107 | 3300050489 | nmdc:mga03683_405_c2 | nmdc:mga03683_405_c2_5473_6438 | 312 |
| 108 | 3300050494 | nmdc:mga06z11_77756_c1 | nmdc:mga06z11_77756_c1_143_1108 | 312 |
| 109 | 3300050496 | nmdc:mga07m45_62144_c1 | nmdc:mga07m45_62144_c1_980_1945 | 312 |
| 110 | 3300050516 | nmdc:mga0sz30_1802_c1 | nmdc:mga0sz30_1802_c1_2858_3823 | 312 |
| 111 | 3300053093 | Ga0500651_0028041 | Ga0500651_0028041_445_1410 | 312 |
| 112 | 3300053096 | Ga0500641_0003063 | Ga0500641_0003063_2018_2983 | 312 |
| 113 | 3300005445 | Ga0070708_100044953 | Ga0070708_1000449533 | 313 |
| 114 | 3300005458 | Ga0070681_10029396 | Ga0070681_100293966 | 313 |
| 115 | 3300005467 | Ga0070706_100034527 | Ga0070706_1000345277 | 313 |
| 116 | 3300005471 | Ga0070698_100005048 | Ga0070698_1000050486 | 313 |
| 117 | 3300005518 | Ga0070699_100143135 | Ga0070699_1001431353 | 313 |
| 118 | 3300005518 | Ga0070699_100551732 | Ga0070699_1005517321 | 313 |
| 119 | 3300005530 | Ga0070679_100148106 | Ga0070679_1001481063 | 313 |
| 120 | 3300005536 | Ga0070697_100133115 | Ga0070697_1001331152 | 313 |
| 121 | 3300005563 | Ga0068855_100214883 | Ga0068855_1002148832 | 313 |
| 122 | 3300005937 | Ga0081455_10001725 | Ga0081455_100017253 | 313 |
| 123 | 3300005937 | Ga0081455_10054516 | Ga0081455_100545163 | 313 |
| 124 | 3300005985 | Ga0081539_10003921 | Ga0081539_100039219 | 313 |
| 125 | 3300005985 | Ga0081539_10004477 | Ga0081539_100044775 | 313 |
| 126 | 3300006177 | Ga0075362_10005463 | Ga0075362_100054633 | 313 |
| 127 | 3300006186 | Ga0075369_10004840 | Ga0075369_100048406 | 313 |
| 128 | 3300009093 | Ga0105240_10018310 | Ga0105240_100183107 | 313 |
| 129 | 3300009093 | Ga0105240_10135897 | Ga0105240_101358973 | 313 |
| 130 | 3300009094 | Ga0111539_10572683 | Ga0111539_105726832 | 313 |
| 131 | 3300013104 | Ga0157370_10055563 | Ga0157370_100555635 | 313 |
| 132 | 3300013105 | Ga0157369_10011238 | Ga0157369_100112383 | 313 |
| 133 | 3300013307 | Ga0157372_10150017 | Ga0157372_101500173 | 313 |
| 134 | 3300021377 | Ga0213874_10000509 | Ga0213874_100005096 | 313 |
| 135 | 3300025906 | Ga0207699_10091672 | Ga0207699_100916722 | 313 |
| 136 | 3300025910 | Ga0207684_10205849 | Ga0207684_102058492 | 313 |
| 137 | 3300025912 | Ga0207707_10080546 | Ga0207707_100805463 | 313 |
| 138 | 3300025913 | Ga0207695_10080892 | Ga0207695_100808925 | 313 |
| 139 | 3300025913 | Ga0207695_10081416 | Ga0207695_100814163 | 313 |
| 140 | 3300025921 | Ga0207652_10136236 | Ga0207652_101362363 | 313 |
| 141 | 3300025939 | Ga0207665_10143096 | Ga0207665_101430963 | 313 |
| 142 | 3300025949 | Ga0207667_10169519 | Ga0207667_101695193 | 313 |
| 143 | 3300028573 | Ga0265334_10015508 | Ga0265334_100155083 | 313 |
| 144 | 3300031507 | Ga0307509_10229853 | Ga0307509_102298532 | 313 |
| 145 | 3300035691 | Ga0373931_0025111 | Ga0373931_0025111_1863_2831 | 313 |
| 146 | 3300037312 | Ga0395899_0009795 | Ga0395899_0009795_3769_4737 | 313 |
| 147 | 3300037312 | Ga0395899_0068673 | Ga0395899_0068673_447_1415 | 313 |
| 148 | 3300037418 | Ga0395900_0012665 | Ga0395900_0012665_3343_4311 | 313 |
| 149 | 3300037466 | Ga0395898_0108924 | Ga0395898_0108924_1655_2629 | 313 |
| 150 | 3300037466 | Ga0395898_0247371 | Ga0395898_0247371_453_1439 | 313 |
| 151 | 3300038443 | Ga0395901_0002054 | Ga0395901_0002054_4432_5400 | 313 |
| 152 | 3300038443 | Ga0395901_0345533 | Ga0395901_0345533_162_1130 | 313 |
| 153 | 3300039450 | Ga0436363_1569227 | Ga0436363_1569227_5568_6536 | 313 |
| 154 | 3300044656 | Ga0466969_0005906 | Ga0466969_0005906_3743_4723 | 313 |
| 155 | 3300044693 | Ga0466961_0003120 | Ga0466961_0003120_6371_7351 | 313 |
| 156 | 3300044706 | Ga0466964_0003100 | Ga0466964_0003100_1253_2233 | 313 |
| 157 | 3300044719 | Ga0466971_0000538 | Ga0466971_0000538_12527_13507 | 313 |
| 158 | 3300044765 | Ga0466970_0018079 | Ga0466970_0018079_686_1666 | 313 |
| 159 | 3300044842 | Ga0466957_0053972 | Ga0466957_0053972_515_1495 | 313 |
| 160 | 3300050492 | nmdc:mga0yw44_152268_c1 | nmdc:mga0yw44_152268_c1_120_1088 | 313 |
| 161 | 3300050492 | nmdc:mga0yw44_21392_c1 | nmdc:mga0yw44_21392_c1_324_1292 | 313 |
| 162 | 3300050516 | nmdc:mga0sz30_4471_c2 | nmdc:mga0sz30_4471_c2_3073_4041 | 313 |
| 163 | 3300053146 | Ga0500588_0008545 | Ga0500588_0008545_1167_2147 | 313 |
| 164 | 3300061719 | Ga0466962_0014340 | Ga0466962_0014340_2760_3740 | 313 |
| 165 | 3300010159 | Ga0099796_10034563 | Ga0099796_100345632 | 314 |
| 166 | 3300025912 | Ga0207707_10189435 | Ga0207707_101894352 | 314 |
| 167 | 3300030521 | Ga0307511_10011017 | Ga0307511_100110173 | 314 |
| 168 | 3300035113 | Ga0373936_0001707 | Ga0373936_0001707_5795_6769 | 314 |
| 169 | 3300046519 | Ga0495632_0070560 | Ga0495632_0070560_664_1638 | 314 |
| 170 | 3300047443 | Ga0495687_043727 | Ga0495687_043727_189_1136 | 314 |
| 171 | 3300053092 | Ga0500583_0001345 | Ga0500583_0001345_3974_4948 | 314 |
| 172 | 3300053092 | Ga0500583_0074249 | Ga0500583_0074249_253_1227 | 314 |
| 173 | 3300053156 | Ga0500622_0035807 | Ga0500622_0035807_262_1212 | 314 |
| 174 | iso_pu_bacteria | 2841760612 | 2841764601 | 314 |
| 175 | iso_pu_bacteria | 2844104063 | 2844107951 | 314 |
| 176 | iso_pu_bacteria | 2851182111 | 2851187882 | 314 |
| 177 | iso_pu_bacteria | 2851246043 | 2851250057 | 314 |
| 178 | iso_pu_bacteria | 8057529695 | 8057533347 | 314 |
| 179 | 3300005329 | Ga0070683_100208036 | Ga0070683_1002080362 | 315 |
| 180 | 3300005335 | Ga0070666_10006053 | Ga0070666_100060535 | 315 |
| 181 | 3300005338 | Ga0068868_100084470 | Ga0068868_1000844702 | 315 |
| 182 | 3300005355 | Ga0070671_100002471 | Ga0070671_1000024714 | 315 |
| 183 | 3300005355 | Ga0070671_100052893 | Ga0070671_1000528933 | 315 |
| 184 | 3300005364 | Ga0070673_100030920 | Ga0070673_1000309202 | 315 |
| 185 | 3300005367 | Ga0070667_100019356 | Ga0070667_1000193563 | 315 |
| 186 | 3300005367 | Ga0070667_100094182 | Ga0070667_1000941823 | 315 |
| 187 | 3300005367 | Ga0070667_100196671 | Ga0070667_1001966711 | 315 |
| 188 | 3300005435 | Ga0070714_100125247 | Ga0070714_1001252473 | 315 |
| 189 | 3300005436 | Ga0070713_100051968 | Ga0070713_1000519682 | 315 |
| 190 | 3300005437 | Ga0070710_10031700 | Ga0070710_100317003 | 315 |
| 191 | 3300005439 | Ga0070711_100095159 | Ga0070711_1000951592 | 315 |
| 192 | 3300005440 | Ga0070705_100046086 | Ga0070705_1000460863 | 315 |
| 193 | 3300005458 | Ga0070681_10004986 | Ga0070681_100049864 | 315 |
| 194 | 3300005459 | Ga0068867_100140656 | Ga0068867_1001406562 | 315 |
| 195 | 3300005518 | Ga0070699_100029046 | Ga0070699_1000290465 | 315 |
| 196 | 3300005530 | Ga0070679_100053779 | Ga0070679_1000537793 | 315 |
| 197 | 3300005544 | Ga0070686_100085638 | Ga0070686_1000856382 | 315 |
| 198 | 3300005545 | Ga0070695_100026405 | Ga0070695_1000264053 | 315 |
| 199 | 3300005548 | Ga0070665_100061097 | Ga0070665_1000610975 | 315 |
| 200 | 3300005548 | Ga0070665_100107949 | Ga0070665_1001079492 | 315 |
| 201 | 3300005617 | Ga0068859_100020031 | Ga0068859_1000200312 | 315 |
| 202 | 3300005617 | Ga0068859_100409726 | Ga0068859_1004097262 | 315 |
| 203 | 3300005834 | Ga0068851_10074340 | Ga0068851_100743402 | 315 |
| 204 | 3300005841 | Ga0068863_100007033 | Ga0068863_1000070333 | 315 |
| 205 | 3300005841 | Ga0068863_100015599 | Ga0068863_1000155994 | 315 |
| 206 | 3300005841 | Ga0068863_100050965 | Ga0068863_1000509655 | 315 |
| 207 | 3300005842 | Ga0068858_100000542 | Ga0068858_10000054235 | 315 |
| 208 | 3300005842 | Ga0068858_100005019 | Ga0068858_10000501913 | 315 |
| 209 | 3300005842 | Ga0068858_100023857 | Ga0068858_1000238573 | 315 |
| 210 | 3300005843 | Ga0068860_100001034 | Ga0068860_1000010347 | 315 |
| 211 | 3300005843 | Ga0068860_100004915 | Ga0068860_10000491516 | 315 |
| 212 | 3300005843 | Ga0068860_100179993 | Ga0068860_1001799933 | 315 |
| 213 | 3300005844 | Ga0068862_100032154 | Ga0068862_1000321545 | 315 |
| 214 | 3300006163 | Ga0070715_10001423 | Ga0070715_100014236 | 315 |
| 215 | 3300006173 | Ga0070716_100044238 | Ga0070716_1000442383 | 315 |
| 216 | 3300006175 | Ga0070712_100070729 | Ga0070712_1000707293 | 315 |
| 217 | 3300006175 | Ga0070712_100183848 | Ga0070712_1001838481 | 315 |
| 218 | 3300006358 | Ga0068871_100062057 | Ga0068871_1000620573 | 315 |
| 219 | 3300006931 | Ga0097620_100020032 | Ga0097620_1000200325 | 315 |
| 220 | 3300006931 | Ga0097620_100409725 | Ga0097620_1004097252 | 315 |
| 221 | 3300009093 | Ga0105240_10015909 | Ga0105240_100159092 | 315 |
| 222 | 3300009093 | Ga0105240_10168712 | Ga0105240_101687123 | 315 |
| 223 | 3300009098 | Ga0105245_10027152 | Ga0105245_100271526 | 315 |
| 224 | 3300009101 | Ga0105247_10000359 | Ga0105247_100003596 | 315 |
| 225 | 3300009101 | Ga0105247_10082029 | Ga0105247_100820293 | 315 |
| 226 | 3300009176 | Ga0105242_10002762 | Ga0105242_100027623 | 315 |
| 227 | 3300009177 | Ga0105248_10035899 | Ga0105248_100358996 | 315 |
| 228 | 3300009177 | Ga0105248_10061836 | Ga0105248_100618363 | 315 |
| 229 | 3300009551 | Ga0105238_10113339 | Ga0105238_101133392 | 315 |
| 230 | 3300009553 | Ga0105249_10018075 | Ga0105249_100180752 | 315 |
| 231 | 3300009553 | Ga0105249_10036911 | Ga0105249_100369112 | 315 |
| 232 | 3300013297 | Ga0157378_10016752 | Ga0157378_100167526 | 315 |
| 233 | 3300014968 | Ga0157379_10067384 | Ga0157379_100673843 | 315 |
| 234 | 3300014968 | Ga0157379_10115802 | Ga0157379_101158023 | 315 |
| 235 | 3300014969 | Ga0157376_10076274 | Ga0157376_100762743 | 315 |
| 236 | 3300025898 | Ga0207692_10045489 | Ga0207692_100454892 | 315 |
| 237 | 3300025900 | Ga0207710_10005711 | Ga0207710_100057113 | 315 |
| 238 | 3300025900 | Ga0207710_10088233 | Ga0207710_100882332 | 315 |
| 239 | 3300025904 | Ga0207647_10084671 | Ga0207647_100846712 | 315 |
| 240 | 3300025905 | Ga0207685_10009080 | Ga0207685_100090804 | 315 |
| 241 | 3300025906 | Ga0207699_10001022 | Ga0207699_1000102211 | 315 |
| 242 | 3300025912 | Ga0207707_10095791 | Ga0207707_100957911 | 315 |
| 243 | 3300025913 | Ga0207695_10017905 | Ga0207695_100179052 | 315 |
| 244 | 3300025913 | Ga0207695_10032020 | Ga0207695_100320205 | 315 |
| 245 | 3300025915 | Ga0207693_10000673 | Ga0207693_1000067313 | 315 |
| 246 | 3300025939 | Ga0207665_10013173 | Ga0207665_100131732 | 315 |
| 247 | 3300025941 | Ga0207711_10424772 | Ga0207711_104247722 | 315 |
| 248 | 3300025960 | Ga0207651_10051268 | Ga0207651_100512682 | 315 |
| 249 | 3300025986 | Ga0207658_10075450 | Ga0207658_100754502 | 315 |
| 250 | 3300026035 | Ga0207703_10001716 | Ga0207703_1000171611 | 315 |
| 251 | 3300026067 | Ga0207678_10284715 | Ga0207678_102847151 | 315 |
| 252 | 3300026078 | Ga0207702_10074949 | Ga0207702_100749495 | 315 |
| 253 | 3300026088 | Ga0207641_10000106 | Ga0207641_1000010655 | 315 |
| 254 | 3300026089 | Ga0207648_10121731 | Ga0207648_101217313 | 315 |
| 255 | 3300028379 | Ga0268266_10002158 | Ga0268266_100021582 | 315 |
| 256 | 3300028381 | Ga0268264_10000188 | Ga0268264_100001888 | 315 |
| 257 | 3300031507 | Ga0307509_10000002 | Ga0307509_10000002147 | 315 |
| 258 | 3300031901 | Ga0307406_10096093 | Ga0307406_100960933 | 315 |
| 259 | 3300032002 | Ga0307416_100358274 | Ga0307416_1003582742 | 315 |
| 260 | 3300035695 | Ga0373927_0077965 | Ga0373927_0077965_362_1366 | 315 |
| 261 | 3300036401 | Ga0373937_0026169 | Ga0373937_0026169_2323_3327 | 315 |
| 262 | 3300036401 | Ga0373937_0030721 | Ga0373937_0030721_210_1187 | 315 |
| 263 | 3300037068 | Ga0373925_0080892 | Ga0373925_0080892_903_1877 | 315 |
| 264 | 3300039438 | Ga0436360_1021191 | Ga0436360_1021191_174_1163 | 315 |
| 265 | 3300039453 | Ga0436362_1130171 | Ga0436362_1130171_1085_2074 | 315 |
| 266 | 3300044656 | Ga0466969_0064552 | Ga0466969_0064552_320_1369 | 315 |
| 267 | 3300046472 | Ga0495580_0004619 | Ga0495580_0004619_4544_5518 | 315 |
| 268 | 3300046472 | Ga0495580_0090088 | Ga0495580_0090088_149_1153 | 315 |
| 269 | 3300046514 | Ga0495618_0147181 | Ga0495618_0147181_483_1484 | 315 |
| 270 | 3300048905 | Ga0496102_0006186 | Ga0496102_0006186_5406_6404 | 315 |
| 271 | 3300048905 | Ga0496102_0115253 | Ga0496102_0115253_768_1772 | 315 |
| 272 | 3300048906 | Ga0496103_0019493 | Ga0496103_0019493_2772_3770 | 315 |
| 273 | 3300048908 | Ga0496105_0211780 | Ga0496105_0211780_490_1488 | 315 |
| 274 | 3300048910 | Ga0496107_0005388 | Ga0496107_0005388_3206_4210 | 315 |
| 275 | 3300048913 | Ga0496110_0010247 | Ga0496110_0010247_2109_3113 | 315 |
| 276 | 3300048914 | Ga0496111_0056794 | Ga0496111_0056794_156_1160 | 315 |
| 277 | 3300048915 | Ga0496112_0048367 | Ga0496112_0048367_759_1733 | 315 |
| 278 | 3300048917 | Ga0496114_0013758 | Ga0496114_0013758_736_1740 | 315 |
| 279 | 3300048918 | Ga0496115_0153396 | Ga0496115_0153396_501_1505 | 315 |
| 280 | 3300048919 | Ga0496116_0007140 | Ga0496116_0007140_7388_8386 | 315 |
| 281 | 3300048920 | Ga0496117_0000110 | Ga0496117_0000110_67287_68285 | 315 |
| 282 | 3300048921 | Ga0496118_0000014 | Ga0496118_0000014_535437_536435 | 315 |
| 283 | 3300048922 | Ga0496119_0000203 | Ga0496119_0000203_57254_58231 | 315 |
| 284 | 3300048922 | Ga0496119_0093099 | Ga0496119_0093099_478_1452 | 315 |
| 285 | 3300048923 | Ga0496120_0000018 | Ga0496120_0000018_147980_148957 | 315 |
| 286 | 3300048924 | Ga0496121_0001306 | Ga0496121_0001306_8487_9461 | 315 |
| 287 | 3300048924 | Ga0496121_0143923 | Ga0496121_0143923_372_1370 | 315 |
| 288 | 3300048927 | Ga0496124_0032798 | Ga0496124_0032798_3139_4137 | 315 |
| 289 | 3300048928 | Ga0496125_0000568 | Ga0496125_0000568_56210_57184 | 315 |
| 290 | 3300048928 | Ga0496125_0005340 | Ga0496125_0005340_11314_12288 | 315 |
| 291 | 3300048928 | Ga0496125_0143029 | Ga0496125_0143029_216_1214 | 315 |
| 292 | 3300048929 | Ga0496126_0019198 | Ga0496126_0019198_5358_6332 | 315 |
| 293 | 3300003322 | rootL2_10082985 | rootL2_100829853 | 316 |
| 294 | 3300005337 | Ga0070682_100058587 | Ga0070682_1000585873 | 316 |
| 295 | 3300005436 | Ga0070713_100028752 | Ga0070713_1000287523 | 316 |
| 296 | 3300005458 | Ga0070681_10192364 | Ga0070681_101923642 | 316 |
| 297 | 3300005539 | Ga0068853_100097326 | Ga0068853_1000973264 | 316 |
| 298 | 3300005548 | Ga0070665_100019793 | Ga0070665_1000197935 | 316 |
| 299 | 3300005577 | Ga0068857_100045550 | Ga0068857_1000455504 | 316 |
| 300 | 3300005842 | Ga0068858_100263092 | Ga0068858_1002630922 | 316 |
| 301 | 3300006237 | Ga0097621_100062095 | Ga0097621_1000620954 | 316 |
| 302 | 3300006358 | Ga0068871_100051163 | Ga0068871_1000511632 | 316 |
| 303 | 3300009093 | Ga0105240_10064440 | Ga0105240_100644406 | 316 |
| 304 | 3300009093 | Ga0105240_10076621 | Ga0105240_100766213 | 316 |
| 305 | 3300009093 | Ga0105240_10090871 | Ga0105240_100908711 | 316 |
| 306 | 3300009174 | Ga0105241_10505957 | Ga0105241_105059571 | 316 |
| 307 | 3300009545 | Ga0105237_10135637 | Ga0105237_101356372 | 316 |
| 308 | 3300009551 | Ga0105238_10001541 | Ga0105238_1000154118 | 316 |
| 309 | 3300009551 | Ga0105238_10220777 | Ga0105238_102207772 | 316 |
| 310 | 3300013104 | Ga0157370_10017473 | Ga0157370_100174733 | 316 |
| 311 | 3300013105 | Ga0157369_10179502 | Ga0157369_101795022 | 316 |
| 312 | 3300013307 | Ga0157372_10019757 | Ga0157372_100197577 | 316 |
| 313 | 3300014325 | Ga0163163_10062455 | Ga0163163_100624553 | 316 |
| 314 | 3300014968 | Ga0157379_10344768 | Ga0157379_103447682 | 316 |
| 315 | 3300025913 | Ga0207695_10076166 | Ga0207695_100761662 | 316 |
| 316 | 3300025924 | Ga0207694_10029976 | Ga0207694_100299763 | 316 |
| 317 | 3300025924 | Ga0207694_10214025 | Ga0207694_102140252 | 316 |
| 318 | 3300025932 | Ga0207690_10022316 | Ga0207690_100223163 | 316 |
| 319 | 3300025949 | Ga0207667_10051462 | Ga0207667_100514625 | 316 |
| 320 | 3300026116 | Ga0207674_10043086 | Ga0207674_100430863 | 316 |
| 321 | 3300028379 | Ga0268266_10002983 | Ga0268266_100029838 | 316 |
| 322 | 3300030521 | Ga0307511_10000348 | Ga0307511_1000034824 | 316 |
| 323 | 3300031616 | Ga0307508_10184778 | Ga0307508_101847782 | 316 |
| 324 | 3300039450 | Ga0436363_1676543 | Ga0436363_1676543_45_1019 | 316 |
| 325 | 3300039453 | Ga0436362_0082311 | Ga0436362_0082311_1217_2194 | 316 |
| 326 | 3300044656 | Ga0466969_0007699 | Ga0466969_0007699_2638_3630 | 316 |
| 327 | 3300044693 | Ga0466961_0067386 | Ga0466961_0067386_152_1144 | 316 |
| 328 | 3300045049 | Ga0466959_0025140 | Ga0466959_0025140_1927_2904 | 316 |
| 329 | 3300045049 | Ga0466959_0118174 | Ga0466959_0118174_820_1812 | 316 |
| 330 | 3300045049 | Ga0466959_0151720 | Ga0466959_0151720_30_1022 | 316 |
| 331 | 3300053178 | Ga0500637_0038445 | Ga0500637_0038445_357_1337 | 316 |
| 332 | iso_pu_bacteria | 2537561836 | 2538834080 | 316 |
| 333 | iso_pu_bacteria | 2643221562 | 2643828996 | 316 |
| 334 | iso_pu_bacteria | 2643221577 | 2643895827 | 316 |
| 335 | iso_pu_bacteria | 2643221685 | 2644478019 | 316 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1jwa-assembly1.cif.gz_B-2 | structure of the atp-bound moeb-moad protein complex | 0.969 | 2 | 220 |
| 7sol-assembly1.cif.gz_A | crystal structures of the bispecific ubiquitin/fat10 activating enzyme, uba6 | 0.9501 | 11 | 158 |
| 7pvn-assembly1.cif.gz_A | crystal structure of human uba6 in complex with atp | 0.9499 | 11 | 157 |
| 6o82-assembly1.cif.gz_A | s. pombe ubiquitin e1 complex with a ubiquitin-amp mimic | 0.9496 | 7 | 156 |
| 7pvn-assembly2.cif.gz_B | crystal structure of human uba6 in complex with atp | 0.949 | 11 | 158 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q6H7A7_75_268_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9863 | 2 | 150 | 3.40.50.720 |
| af_A0A1D6II59_3_109_3.50.50.80 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;Ubiquitin-activating enzyme E1, inactive adenylation domain, subdomain 1 | 0.9642 | 11 | 94 | 3.50.50.80 |
| af_L7N674_15_263_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9597 | 2 | 222 | 3.40.50.720 |
| af_O44510_10_262_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9497 | 2 | 228 | 3.40.50.720 |
| 1jwbB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9494 | 2 | 228 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2J0N1C4-F1-model_v4 | Adenylyltransferase | 0.9956 | 2 | 96 |
GO:0004792
GO:0005829 GO:0008146 GO:0008641 GO:0016779 |
| AF-A0A356FT47-F1-model_v4 | THIF-type NAD/FAD binding fold domain-containing protein | 0.9953 | 2 | 127 |
GO:0004792
GO:0005829 GO:0008146 GO:0008641 GO:0016779 |
| AF-A0A2S5NTV2-F1-model_v4 | Molybdopterin biosynthesis protein MoeB | 0.9951 | 2 | 91 |
GO:0004792
GO:0005737 GO:0016779 GO:0042292 |
| AF-A0A349E792-F1-model_v4 | THIF-type NAD/FAD binding fold domain-containing protein | 0.9934 | 2 | 95 |
GO:0004792
GO:0005829 GO:0008146 GO:0008641 GO:0016779 |
| AF-A0A3C0GNI2-F1-model_v4 | Molybdopterin biosynthesis protein MoeB | 0.993 | 2 | 135 |
GO:0004792
GO:0005524 GO:0005829 GO:0008146 GO:0008641 GO:0016779 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar