F412351

General Info

Members Datasets Scaffolds Average Seq Length
335 204 325 322

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0064552|Ga0466969_0064552_320_1369
Length 349
Sequence MSDRYSRQTVLPEVGAAGQERLRGASVLVVGAGGLGCAVLQYLCAAGVGRLIIIDPDRVEESNLHRQPLYRMSDLGALKVEASRAALLQVNPDVCIETLAERLTPANVSAAVSKAQLIVDAADSFAATYVLSDECHAVGKPLISASVLGLSGYVGAFCGGAPSYRAVFPEMPRQAGSCAQSGVLGTAVGVMGTLQAHMTLALALDLKAAPGLERLPRDAEQASGGPADGAARCAALGQLITVDFRTLRFGGFSFANAQEPAGAAIPFIDPTEVADTDIVIDLRSLTEAPVSPFASALRIGVDTVERAEEQLPQGRRIVLCCRTGVRAWRAARALQRQGHSNVALIALGD

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
3 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
4 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
5 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
6 2841760612 Bosea sp. Tri-49 Isolate Nodule
7 2844104063 Bosea sp. Tri-39 Isolate Nodule
8 2851182111 Bosea sp. Tri-44 Isolate Nodule
9 2851246043 Bosea sp. Tri-54 Isolate Nodule
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
75 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
87 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
89 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
90 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
91 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
92 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
127 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
128 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
129 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
130 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
131 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
132 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
146 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
147 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
148 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
149 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
150 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
151 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
152 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
153 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
160 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
161 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
162 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
173 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
174 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
175 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
176 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
177 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
178 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
179 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
180 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
181 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
188 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
189 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
190 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
191 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
192 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
195 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
196 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
197 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
198 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
199 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
200 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
201 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
202 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
203 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
204 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.72
Metatranscriptomes 0.3
Isolates 2.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.36
Nodule 1.49
Rhizoplane 3.28
Rhizosphere 77.01
Stem 0
Stem Tuber 0
Unclassified 9.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10082985 3300003322 Bacteria 3721
2 Ga0065165_1000132 3300005262 Bacteria 128732
3 Ga0070658_10004845 3300005327 Bacteria 10959
4 Ga0070683_100048777 3300005329 Bacteria 3915
5 Ga0070683_100208036 3300005329 Unclassified 1858
6 Ga0070666_10006053 3300005335 Bacteria 7430
7 Ga0070682_100058587 3300005337 Bacteria 2429
8 Ga0068868_100084470 3300005338 Bacteria 2550
9 Ga0070661_100019304 3300005344 Bacteria 4859
10 Ga0070671_100002471 3300005355 Bacteria 14293
11 Ga0070671_100052893 3300005355 Bacteria 3376
12 Ga0070673_100030920 3300005364 Bacteria 4013
13 Ga0070667_100019356 3300005367 Bacteria 5647
14 Ga0070667_100094182 3300005367 Bacteria 2580
15 Ga0070667_100196671 3300005367 Unclassified 1787
16 Ga0070714_100125247 3300005435 Bacteria 2290
17 Ga0070713_100000397 3300005436 Bacteria 27956
18 Ga0070713_100028752 3300005436 Bacteria 4393
19 Ga0070713_100051968 3300005436 Bacteria 3391
20 Ga0070710_10031700 3300005437 Bacteria 2857
21 Ga0070711_100095159 3300005439 Bacteria 2155
22 Ga0070705_100046086 3300005440 Bacteria 2512
23 Ga0070708_100044953 3300005445 Bacteria 3888
24 Ga0070678_100011994 3300005456 Bacteria 5368
25 Ga0070681_10004986 3300005458 Bacteria 12781
26 Ga0070681_10006133 3300005458 Bacteria 11669
27 Ga0070681_10029396 3300005458 Bacteria 5519
28 Ga0070681_10192364 3300005458 Unclassified 1960
29 Ga0068867_100140656 3300005459 Bacteria 1886
30 Ga0070706_100034527 3300005467 Bacteria 4672
31 Ga0070698_100005048 3300005471 Bacteria 14467
32 Ga0070699_100029046 3300005518 Bacteria 4767
33 Ga0070699_100143135 3300005518 Bacteria 2112
34 Ga0070699_100551732 3300005518 Unclassified 1049
35 Ga0070679_100028958 3300005530 Bacteria 5463
36 Ga0070679_100053779 3300005530 Bacteria 4008
37 Ga0070679_100148106 3300005530 Bacteria 2325
38 Ga0070684_100198238 3300005535 Bacteria 1828
39 Ga0070697_100133115 3300005536 Bacteria 2086
40 Ga0068853_100097326 3300005539 Bacteria 2597
41 Ga0068853_100326202 3300005539 Bacteria 1424
42 Ga0070686_100085638 3300005544 Unclassified 2096
43 Ga0070695_100026405 3300005545 Bacteria 3592
44 Ga0070665_100004850 3300005548 Bacteria 13977
45 Ga0070665_100009408 3300005548 Bacteria 9890
46 Ga0070665_100019793 3300005548 Bacteria 6757
47 Ga0070665_100061097 3300005548 Bacteria 3777
48 Ga0070665_100107949 3300005548 Bacteria 2786
49 Ga0070665_100151476 3300005548 Bacteria 2322
50 Ga0070665_100172827 3300005548 Bacteria 2161
51 Ga0070665_100266188 3300005548 Bacteria 1715
52 Ga0068855_100000456 3300005563 Bacteria 50301
53 Ga0068855_100042393 3300005563 Bacteria 5392
54 Ga0068855_100052408 3300005563 Bacteria 4803
55 Ga0068855_100214883 3300005563 Bacteria 2159
56 Ga0068855_100308973 3300005563 Bacteria 1750
57 Ga0070664_100065265 3300005564 Bacteria 3105
58 Ga0068857_100045550 3300005577 Bacteria 3892
59 Ga0068856_100044148 3300005614 Bacteria 4385
60 Ga0068859_100020031 3300005617 Bacteria 6717
61 Ga0068859_100409726 3300005617 Bacteria 1451
62 Ga0068851_10074340 3300005834 Unclassified 1764
63 Ga0068863_100007033 3300005841 Bacteria 11025
64 Ga0068863_100015599 3300005841 Bacteria 7299
65 Ga0068863_100050965 3300005841 Bacteria 3924
66 Ga0068858_100000542 3300005842 Bacteria 39272
67 Ga0068858_100005019 3300005842 Bacteria 12969
68 Ga0068858_100023857 3300005842 Bacteria 5699
69 Ga0068858_100226650 3300005842 Bacteria 1771
70 Ga0068858_100263092 3300005842 Bacteria 1640
71 Ga0068860_100001034 3300005843 Bacteria 30629
72 Ga0068860_100004915 3300005843 Bacteria 13619
73 Ga0068860_100179993 3300005843 Bacteria 2043
74 Ga0068862_100032154 3300005844 Bacteria 4432
75 Ga0081455_10001725 3300005937 Bacteria 26473
76 Ga0081455_10037419 3300005937 Bacteria 4310
77 Ga0081455_10054516 3300005937 Bacteria 3407
78 Ga0081539_10003921 3300005985 Bacteria 17277
79 Ga0081539_10004477 3300005985 Bacteria 15388
80 Ga0075365_10087909 3300006038 Unclassified 2113
81 Ga0075364_10083393 3300006051 Bacteria 2115
82 Ga0070715_10001423 3300006163 Bacteria 6928
83 Ga0070716_100044238 3300006173 Bacteria 2494
84 Ga0070712_100070729 3300006175 Bacteria 2494
85 Ga0070712_100183848 3300006175 Unclassified 1631
86 Ga0075362_10005463 3300006177 Bacteria 4652
87 Ga0075362_10011850 3300006177 Bacteria 3445
88 Ga0075367_10094668 3300006178 Bacteria 1821
89 Ga0075369_10004840 3300006186 Bacteria 5010
90 Ga0075366_10010533 3300006195 Bacteria 5192
91 Ga0097621_100062095 3300006237 Unclassified 3067
92 Ga0068871_100051163 3300006358 Plasmid 3344
93 Ga0068871_100062057 3300006358 Bacteria 3054
94 Ga0068871_100063310 3300006358 Bacteria 3025
95 Ga0097620_100020032 3300006931 Bacteria 6717
96 Ga0097620_100409725 3300006931 Bacteria 1451
97 Ga0105240_10000420 3300009093 Bacteria 78578
98 Ga0105240_10006821 3300009093 Bacteria 16702
99 Ga0105240_10015909 3300009093 Bacteria 10206
100 Ga0105240_10018310 3300009093 Bacteria 9413
101 Ga0105240_10064440 3300009093 Bacteria 4554
102 Ga0105240_10066081 3300009093 Bacteria 4488
103 Ga0105240_10076621 3300009093 Bacteria 4122
104 Ga0105240_10090871 3300009093 Bacteria 3731
105 Ga0105240_10135897 3300009093 Bacteria 2945
106 Ga0105240_10168712 3300009093 Unclassified 2594
107 Ga0111539_10572683 3300009094 Bacteria 1315
108 Ga0105245_10027152 3300009098 Bacteria 5043
109 Ga0105247_10000359 3300009101 Bacteria 39147
110 Ga0105247_10082029 3300009101 Unclassified 2034
111 Ga0105241_10505957 3300009174 Bacteria 1078
112 Ga0105242_10002762 3300009176 Bacteria 13735
113 Ga0105248_10035899 3300009177 Bacteria 5545
114 Ga0105248_10061836 3300009177 Bacteria 4205
115 Ga0105237_10135637 3300009545 Bacteria 2455
116 Ga0105237_10196815 3300009545 Bacteria 2015
117 Ga0105238_10001541 3300009551 Bacteria 23092
118 Ga0105238_10056394 3300009551 Bacteria 3942
119 Ga0105238_10113339 3300009551 Unclassified 2691
120 Ga0105238_10220777 3300009551 Unclassified 1871
121 Ga0105249_10018075 3300009553 Bacteria 6267
122 Ga0105249_10036911 3300009553 Bacteria 4434
123 Ga0105035_101723 3300009988 Bacteria 1545
124 Ga0099796_10034563 3300010159 Unclassified 1670
125 Ga0105239_10039820 3300010375 Bacteria 5149
126 Ga0105239_10206848 3300010375 Bacteria 2199
127 Ga0105239_10286479 3300010375 Unclassified 1855
128 Ga0105246_10047687 3300011119 Bacteria 2927
129 Ga0157370_10017473 3300013104 Bacteria 7237
130 Ga0157370_10055563 3300013104 Bacteria 3771
131 Ga0157369_10011238 3300013105 Bacteria 10176
132 Ga0157369_10179502 3300013105 Unclassified 2228
133 Ga0157378_10016752 3300013297 Bacteria 6421
134 Ga0157372_10019757 3300013307 Bacteria 7260
135 Ga0157372_10150017 3300013307 Bacteria 2690
136 Ga0157372_10519095 3300013307 Bacteria 1389
137 Ga0163163_10062455 3300014325 Bacteria 3691
138 Ga0182008_10015029 3300014497 Bacteria 4047
139 Ga0157379_10067384 3300014968 Bacteria 3200
140 Ga0157379_10115802 3300014968 Unclassified 2410
141 Ga0157379_10344768 3300014968 Unclassified 1363
142 Ga0157376_10076274 3300014969 Bacteria 2864
143 Ga0182007_10008070 3300015262 Bacteria 4348
144 Ga0206353_10462851 3300020082 Bacteria 1325
145 Ga0213874_10000509 3300021377 Bacteria 7798
146 Ga0213871_10003393 3300021441 Bacteria 3064
147 Ga0209026_1000010 3300025250 Bacteria 511986
148 Ga0209130_1000327 3300025284 Bacteria 54775
149 Ga0207426_1010390 3300025302 Bacteria 3614
150 Ga0207692_10045489 3300025898 Bacteria 2196
151 Ga0207710_10005711 3300025900 Bacteria 5343
152 Ga0207710_10088233 3300025900 Unclassified 1448
153 Ga0207647_10084671 3300025904 Unclassified 1897
154 Ga0207685_10009080 3300025905 Bacteria 2871
155 Ga0207699_10001022 3300025906 Bacteria 13212
156 Ga0207699_10091672 3300025906 Bacteria 1909
157 Ga0207705_10031713 3300025909 Bacteria 3774
158 Ga0207684_10205849 3300025910 Bacteria 1697
159 Ga0207707_10080546 3300025912 Bacteria 2844
160 Ga0207707_10095791 3300025912 Bacteria 2594
161 Ga0207707_10189435 3300025912 Bacteria 1795
162 Ga0207695_10017905 3300025913 Bacteria 8207
163 Ga0207695_10032020 3300025913 Bacteria 5759
164 Ga0207695_10044617 3300025913 Bacteria 4713
165 Ga0207695_10076166 3300025913 Bacteria 3411
166 Ga0207695_10080892 3300025913 Bacteria 3289
167 Ga0207695_10081416 3300025913 Bacteria 3276
168 Ga0207695_10160414 3300025913 Unclassified 2181
169 Ga0207671_10083552 3300025914 Bacteria 2397
170 Ga0207693_10000673 3300025915 Bacteria 30672
171 Ga0207649_10010921 3300025920 Bacteria 4994
172 Ga0207652_10022444 3300025921 Bacteria 5222
173 Ga0207652_10136236 3300025921 Bacteria 2193
174 Ga0207694_10029976 3300025924 Bacteria 4154
175 Ga0207694_10154659 3300025924 Bacteria 1849
176 Ga0207694_10214025 3300025924 Bacteria 1570
177 Ga0207659_10272656 3300025926 Bacteria 1380
178 Ga0207700_10098246 3300025928 Bacteria 2328
179 Ga0207644_10228420 3300025931 Bacteria 1478
180 Ga0207690_10022316 3300025932 Bacteria 3935
181 Ga0207690_10186181 3300025932 Bacteria 1567
182 Ga0207665_10013173 3300025939 Bacteria 5438
183 Ga0207665_10143096 3300025939 Bacteria 1707
184 Ga0207691_10129865 3300025940 Bacteria 2226
185 Ga0207711_10424772 3300025941 Unclassified 1236
186 Ga0207667_10001926 3300025949 Bacteria 26045
187 Ga0207667_10026338 3300025949 Bacteria 6356
188 Ga0207667_10044995 3300025949 Bacteria 4675
189 Ga0207667_10051462 3300025949 Bacteria 4342
190 Ga0207667_10169519 3300025949 Bacteria 2244
191 Ga0207667_10377407 3300025949 Bacteria 1445
192 Ga0207651_10051268 3300025960 Bacteria 2807
193 Ga0207658_10075450 3300025986 Unclassified 2565
194 Ga0207703_10001716 3300026035 Bacteria 19682
195 Ga0207678_10284715 3300026067 Unclassified 1419
196 Ga0207702_10036824 3300026078 Bacteria 4093
197 Ga0207702_10074949 3300026078 Bacteria 2922
198 Ga0207641_10000106 3300026088 Bacteria 121316
199 Ga0207648_10121731 3300026089 Bacteria 2294
200 Ga0207674_10043086 3300026116 Bacteria 4655
201 Ga0207683_10018935 3300026121 Bacteria 5874
202 Ga0268266_10002158 3300028379 Bacteria 21584
203 Ga0268266_10002983 3300028379 Bacteria 17447
204 Ga0268266_10027913 3300028379 Bacteria 4800
205 Ga0268266_10073944 3300028379 Bacteria 2959
206 Ga0268266_10447565 3300028379 Bacteria 1227
207 Ga0268264_10000188 3300028381 Bacteria 129042
208 Ga0265334_10015508 3300028573 Bacteria 3163
209 Ga0307515_10068007 3300028794 Bacteria 4903
210 Ga0307511_10000348 3300030521 Bacteria 49134
211 Ga0307511_10011017 3300030521 Bacteria 8926
212 Ga0265332_10034756 3300031238 Bacteria 2190
213 Ga0265340_10004596 3300031247 Bacteria 7684
214 Ga0307509_10000002 3300031507 Bacteria 607551
215 Ga0307509_10229853 3300031507 Bacteria 1659
216 Ga0307508_10184778 3300031616 Bacteria 1687
217 Ga0307406_10096093 3300031901 Bacteria 2007
218 Ga0307416_100358274 3300032002 Bacteria 1480
219 Ga0373936_0001707 3300035113 Bacteria 8062
220 Ga0373931_0025111 3300035691 Bacteria 3026
221 Ga0373927_0077965 3300035695 Bacteria 2146
222 Ga0373927_0135910 3300035695 Bacteria 1607
223 Ga0373937_0026169 3300036401 Bacteria 5272
224 Ga0373937_0030721 3300036401 Bacteria 4865
225 Ga0373925_0080892 3300037068 Bacteria 2470
226 Ga0395899_0009795 3300037312 Bacteria 7353
227 Ga0395899_0016573 3300037312 Bacteria 5620
228 Ga0395899_0068673 3300037312 Bacteria 2598
229 Ga0395900_0007979 3300037418 Bacteria 10895
230 Ga0395900_0012665 3300037418 Bacteria 8623
231 Ga0395898_0006242 3300037466 Bacteria 12763
232 Ga0395898_0108924 3300037466 Bacteria 2656
233 Ga0395898_0247371 3300037466 Bacteria 1700
234 Ga0395905_0174106 3300037471 Bacteria 2021
235 Ga0395901_0002054 3300038443 Bacteria 20648
236 Ga0395901_0003392 3300038443 Bacteria 16043
237 Ga0395901_0151759 3300038443 Bacteria 2434
238 Ga0395901_0345533 3300038443 Bacteria 1536
239 Ga0436360_1021191 3300039438 Unclassified 1716
240 Ga0436360_1376989 3300039438 Bacteria 11305
241 Ga0436361_0685736 3300039447 Bacteria 2320
242 Ga0436363_1569227 3300039450 Bacteria 9740
243 Ga0436363_1676543 3300039450 Bacteria 1145
244 Ga0436362_0082311 3300039453 Bacteria 5594
245 Ga0436362_1130171 3300039453 Bacteria 2657
246 Ga0466969_0005906 3300044656 Bacteria 6510
247 Ga0466969_0007699 3300044656 Bacteria 5729
248 Ga0466969_0064552 3300044656 Bacteria 1772
249 Ga0466961_0003120 3300044693 Bacteria 10312
250 Ga0466961_0067386 3300044693 Bacteria 2274
251 Ga0466964_0003100 3300044706 Bacteria 6048
252 Ga0466971_0000538 3300044719 Bacteria 15029
253 Ga0466970_0018079 3300044765 Bacteria 3648
254 Ga0466957_0053972 3300044842 Bacteria 2451
255 Ga0466960_0027673 3300044901 Bacteria 2589
256 Ga0466959_0025140 3300045049 Bacteria 4411
257 Ga0466959_0118174 3300045049 Unclassified 1887
258 Ga0466959_0151720 3300045049 Bacteria 1633
259 Ga0466958_0112415 3300045836 Bacteria 1701
260 Ga0495580_0004619 3300046472 Bacteria 11560
261 Ga0495580_0090088 3300046472 Bacteria 2135
262 Ga0495618_0147181 3300046514 Unclassified 1505
263 Ga0495632_0070560 3300046519 Unclassified 1680
264 Ga0495668_0201330 3300046616 Unclassified 1090
265 Ga0495687_043727 3300047443 Bacteria 1950
266 Ga0496102_0006186 3300048905 Bacteria 10204
267 Ga0496102_0115253 3300048905 Bacteria 2507
268 Ga0496103_0019493 3300048906 Bacteria 4074
269 Ga0496103_0101083 3300048906 Bacteria 1825
270 Ga0496105_0211780 3300048908 Bacteria 1580
271 Ga0496107_0005388 3300048910 Bacteria 8753
272 Ga0496110_0010247 3300048913 Bacteria 7614
273 Ga0496111_0056794 3300048914 Bacteria 2833
274 Ga0496112_0048367 3300048915 Bacteria 4170
275 Ga0496114_0013758 3300048917 Bacteria 6485
276 Ga0496115_0153396 3300048918 Bacteria 1902
277 Ga0496116_0007140 3300048919 Bacteria 9992
278 Ga0496117_0000110 3300048920 Bacteria 184627
279 Ga0496118_0000014 3300048921 Bacteria 561628
280 Ga0496119_0000203 3300048922 Bacteria 84250
281 Ga0496119_0052522 3300048922 Bacteria 2495
282 Ga0496119_0093099 3300048922 Unclassified 1708
283 Ga0496119_0242124 3300048922 Unclassified 913
284 Ga0496120_0000018 3300048923 Bacteria 263952
285 Ga0496120_0089741 3300048923 Bacteria 1644
286 Ga0496120_0153418 3300048923 Unclassified 1155
287 Ga0496121_0001306 3300048924 Bacteria 42785
288 Ga0496121_0143923 3300048924 Unclassified 1764
289 Ga0496124_0032798 3300048927 Bacteria 4580
290 Ga0496125_0000568 3300048928 Bacteria 63393
291 Ga0496125_0005340 3300048928 Bacteria 14354
292 Ga0496125_0143029 3300048928 Unclassified 1659
293 Ga0496126_0019198 3300048929 Bacteria 6738
294 Ga0501032_0014065 3300049569 Bacteria 5677
295 Ga0501034_0001246 3300049571 Bacteria 34606
296 Ga0501034_0001285 3300049571 Bacteria 33952
297 Ga0501034_0139025 3300049571 Bacteria 2409
298 Ga0501034_0248718 3300049571 Bacteria 1723
299 Ga0501037_0129548 3300049573 Bacteria 1810
300 Ga0501043_0012714 3300049579 Bacteria 6581
301 Ga0501046_0009097 3300049580 Bacteria 8608
302 Ga0501047_0024895 3300049581 Bacteria 5748
303 Ga0501047_0111712 3300049581 Bacteria 2615
304 Ga0501068_0019566 3300049584 Bacteria 3934
305 Ga0501044_0065928 3300049823 Bacteria 3693
306 nmdc:mga03683_405_c2 3300050489 Bacteria 8154
307 nmdc:mga0yw44_152268_c1 3300050492 Bacteria 1509
308 nmdc:mga0yw44_21392_c1 3300050492 Bacteria 3607
309 nmdc:mga06z11_77756_c1 3300050494 Bacteria 1772
310 nmdc:mga07m45_62144_c1 3300050496 Unclassified 2116
311 nmdc:mga08y16_785780_c1 3300050511 Bacteria 946
312 nmdc:mga0sz30_1802_c1 3300050516 Bacteria 7615
313 nmdc:mga0sz30_4471_c2 3300050516 Bacteria 4614
314 Ga0500644_0006737 3300053088 Bacteria 2959
315 Ga0500644_0059544 3300053088 Unclassified 1340
316 Ga0500583_0001345 3300053092 Bacteria 7024
317 Ga0500583_0074249 3300053092 Bacteria 1631
318 Ga0500651_0028041 3300053093 Bacteria 3541
319 Ga0500651_0163955 3300053093 Unclassified 1328
320 Ga0500641_0003063 3300053096 Bacteria 5928
321 Ga0500588_0008545 3300053146 Unclassified 2397
322 Ga0500616_0012975 3300053153 Bacteria 4853
323 Ga0500622_0035807 3300053156 Unclassified 2596
324 Ga0500637_0038445 3300053178 Bacteria 2696
325 Ga0466962_0014340 3300061719 Bacteria 3819

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300011119 Ga0105246_10047687 Ga0105246_100476873 270
2 3300005937 Ga0081455_10037419 Ga0081455_100374192 271
3 3300005262 Ga0065165_1000132 Ga0065165_100013299 276
4 3300025284 Ga0209130_1000327 Ga0209130_100032724 276
5 3300025302 Ga0207426_1010390 Ga0207426_10103904 276
6 3300048922 Ga0496119_0052522 Ga0496119_0052522_1639_2472 276
7 3300048922 Ga0496119_0242124 Ga0496119_0242124_24_857 276
8 3300048923 Ga0496120_0089741 Ga0496120_0089741_24_857 276
9 3300048923 Ga0496120_0153418 Ga0496120_0153418_24_857 276
10 3300050511 nmdc:mga08y16_785780_c1 nmdc:mga08y16_785780_c1_58_912 283
11 3300025928 Ga0207700_10098246 Ga0207700_100982464 289
12 3300015262 Ga0182007_10008070 Ga0182007_100080704 290
13 3300010375 Ga0105239_10039820 Ga0105239_100398206 291
14 3300021441 Ga0213871_10003393 Ga0213871_100033932 293
15 3300039438 Ga0436360_1376989 Ga0436360_1376989_3161_4174 293
16 3300046616 Ga0495668_0201330 Ga0495668_0201330_10_897 294
17 3300053088 Ga0500644_0059544 Ga0500644_0059544_439_1329 294
18 3300005548 Ga0070665_100151476 Ga0070665_1001514763 296
19 3300005563 Ga0068855_100000456 Ga0068855_10000045624 296
20 3300009093 Ga0105240_10000420 Ga0105240_1000042057 296
21 3300009545 Ga0105237_10196815 Ga0105237_101968152 296
22 3300010375 Ga0105239_10286479 Ga0105239_102864792 296
23 3300013307 Ga0157372_10519095 Ga0157372_105190951 296
24 3300025913 Ga0207695_10160414 Ga0207695_101604143 296
25 3300025914 Ga0207671_10083552 Ga0207671_100835522 296
26 3300025924 Ga0207694_10154659 Ga0207694_101546592 296
27 3300025949 Ga0207667_10001926 Ga0207667_100019263 296
28 3300028379 Ga0268266_10073944 Ga0268266_100739444 296
29 3300005436 Ga0070713_100000397 Ga0070713_10000039718 297
30 3300014497 Ga0182008_10015029 Ga0182008_100150296 297
31 3300031238 Ga0265332_10034756 Ga0265332_100347562 298
32 3300048906 Ga0496103_0101083 Ga0496103_0101083_254_1228 298
33 3300049569 Ga0501032_0014065 Ga0501032_0014065_239_1225 299
34 3300049573 Ga0501037_0129548 Ga0501037_0129548_812_1798 299
35 3300049579 Ga0501043_0012714 Ga0501043_0012714_3426_4412 299
36 3300049580 Ga0501046_0009097 Ga0501046_0009097_4537_5523 299
37 3300049581 Ga0501047_0024895 Ga0501047_0024895_1647_2633 299
38 3300005327 Ga0070658_10004845 Ga0070658_100048459 301
39 3300005458 Ga0070681_10006133 Ga0070681_100061336 301
40 3300005530 Ga0070679_100028958 Ga0070679_1000289586 301
41 3300005563 Ga0068855_100042393 Ga0068855_1000423936 301
42 3300009093 Ga0105240_10006821 Ga0105240_1000682111 301
43 3300025909 Ga0207705_10031713 Ga0207705_100317135 301
44 3300025921 Ga0207652_10022444 Ga0207652_100224446 301
45 3300025949 Ga0207667_10044995 Ga0207667_100449956 301
46 3300028794 Ga0307515_10068007 Ga0307515_100680075 301
47 3300053153 Ga0500616_0012975 Ga0500616_0012975_2305_3270 301
48 3300031247 Ga0265340_10004596 Ga0265340_100045963 304
49 3300035695 Ga0373927_0135910 Ga0373927_0135910_398_1366 304
50 iso_pu_bacteria 2834578030 2834580959 304
51 3300025250 Ga0209026_1000010 Ga0209026_1000010377 309
52 3300005539 Ga0068853_100326202 Ga0068853_1003262021 311
53 3300005548 Ga0070665_100004850 Ga0070665_10000485014 311
54 3300005548 Ga0070665_100172827 Ga0070665_1001728273 311
55 3300005842 Ga0068858_100226650 Ga0068858_1002266502 311
56 3300028379 Ga0268266_10027913 Ga0268266_100279134 311
57 3300028379 Ga0268266_10447565 Ga0268266_104475652 311
58 3300044901 Ga0466960_0027673 Ga0466960_0027673_449_1423 311
59 3300049581 Ga0501047_0111712 Ga0501047_0111712_1546_2535 311
60 3300053088 Ga0500644_0006737 Ga0500644_0006737_929_1891 311
61 3300053093 Ga0500651_0163955 Ga0500651_0163955_165_1127 311
62 3300005329 Ga0070683_100048777 Ga0070683_1000487775 312
63 3300005344 Ga0070661_100019304 Ga0070661_1000193047 312
64 3300005456 Ga0070678_100011994 Ga0070678_1000119947 312
65 3300005535 Ga0070684_100198238 Ga0070684_1001982383 312
66 3300005548 Ga0070665_100009408 Ga0070665_1000094089 312
67 3300005548 Ga0070665_100266188 Ga0070665_1002661882 312
68 3300005563 Ga0068855_100052408 Ga0068855_1000524085 312
69 3300005563 Ga0068855_100308973 Ga0068855_1003089732 312
70 3300005564 Ga0070664_100065265 Ga0070664_1000652653 312
71 3300005614 Ga0068856_100044148 Ga0068856_1000441487 312
72 3300006038 Ga0075365_10087909 Ga0075365_100879092 312
73 3300006051 Ga0075364_10083393 Ga0075364_100833934 312
74 3300006177 Ga0075362_10011850 Ga0075362_100118502 312
75 3300006178 Ga0075367_10094668 Ga0075367_100946683 312
76 3300006195 Ga0075366_10010533 Ga0075366_100105332 312
77 3300006358 Ga0068871_100063310 Ga0068871_1000633103 312
78 3300009093 Ga0105240_10066081 Ga0105240_100660816 312
79 3300009551 Ga0105238_10056394 Ga0105238_100563942 312
80 3300009988 Ga0105035_101723 Ga0105035_1017232 312
81 3300010375 Ga0105239_10206848 Ga0105239_102068482 312
82 3300020082 Ga0206353_10462851 Ga0206353_104628511 312
83 3300025913 Ga0207695_10044617 Ga0207695_100446177 312
84 3300025920 Ga0207649_10010921 Ga0207649_100109217 312
85 3300025926 Ga0207659_10272656 Ga0207659_102726562 312
86 3300025931 Ga0207644_10228420 Ga0207644_102284202 312
87 3300025932 Ga0207690_10186181 Ga0207690_101861811 312
88 3300025940 Ga0207691_10129865 Ga0207691_101298653 312
89 3300025949 Ga0207667_10026338 Ga0207667_100263387 312
90 3300025949 Ga0207667_10377407 Ga0207667_103774071 312
91 3300026078 Ga0207702_10036824 Ga0207702_100368242 312
92 3300026121 Ga0207683_10018935 Ga0207683_100189357 312
93 3300037312 Ga0395899_0016573 Ga0395899_0016573_1128_2093 312
94 3300037418 Ga0395900_0007979 Ga0395900_0007979_2431_3396 312
95 3300037466 Ga0395898_0006242 Ga0395898_0006242_199_1164 312
96 3300037471 Ga0395905_0174106 Ga0395905_0174106_866_1831 312
97 3300038443 Ga0395901_0003392 Ga0395901_0003392_7470_8435 312
98 3300038443 Ga0395901_0151759 Ga0395901_0151759_545_1510 312
99 3300039447 Ga0436361_0685736 Ga0436361_0685736_1058_2020 312
100 3300045836 Ga0466958_0112415 Ga0466958_0112415_174_1139 312
101 3300049571 Ga0501034_0001246 Ga0501034_0001246_1157_2122 312
102 3300049571 Ga0501034_0001285 Ga0501034_0001285_15072_16037 312
103 3300049571 Ga0501034_0139025 Ga0501034_0139025_1131_2096 312
104 3300049571 Ga0501034_0248718 Ga0501034_0248718_418_1383 312
105 3300049584 Ga0501068_0019566 Ga0501068_0019566_310_1275 312
106 3300049823 Ga0501044_0065928 Ga0501044_0065928_2558_3523 312
107 3300050489 nmdc:mga03683_405_c2 nmdc:mga03683_405_c2_5473_6438 312
108 3300050494 nmdc:mga06z11_77756_c1 nmdc:mga06z11_77756_c1_143_1108 312
109 3300050496 nmdc:mga07m45_62144_c1 nmdc:mga07m45_62144_c1_980_1945 312
110 3300050516 nmdc:mga0sz30_1802_c1 nmdc:mga0sz30_1802_c1_2858_3823 312
111 3300053093 Ga0500651_0028041 Ga0500651_0028041_445_1410 312
112 3300053096 Ga0500641_0003063 Ga0500641_0003063_2018_2983 312
113 3300005445 Ga0070708_100044953 Ga0070708_1000449533 313
114 3300005458 Ga0070681_10029396 Ga0070681_100293966 313
115 3300005467 Ga0070706_100034527 Ga0070706_1000345277 313
116 3300005471 Ga0070698_100005048 Ga0070698_1000050486 313
117 3300005518 Ga0070699_100143135 Ga0070699_1001431353 313
118 3300005518 Ga0070699_100551732 Ga0070699_1005517321 313
119 3300005530 Ga0070679_100148106 Ga0070679_1001481063 313
120 3300005536 Ga0070697_100133115 Ga0070697_1001331152 313
121 3300005563 Ga0068855_100214883 Ga0068855_1002148832 313
122 3300005937 Ga0081455_10001725 Ga0081455_100017253 313
123 3300005937 Ga0081455_10054516 Ga0081455_100545163 313
124 3300005985 Ga0081539_10003921 Ga0081539_100039219 313
125 3300005985 Ga0081539_10004477 Ga0081539_100044775 313
126 3300006177 Ga0075362_10005463 Ga0075362_100054633 313
127 3300006186 Ga0075369_10004840 Ga0075369_100048406 313
128 3300009093 Ga0105240_10018310 Ga0105240_100183107 313
129 3300009093 Ga0105240_10135897 Ga0105240_101358973 313
130 3300009094 Ga0111539_10572683 Ga0111539_105726832 313
131 3300013104 Ga0157370_10055563 Ga0157370_100555635 313
132 3300013105 Ga0157369_10011238 Ga0157369_100112383 313
133 3300013307 Ga0157372_10150017 Ga0157372_101500173 313
134 3300021377 Ga0213874_10000509 Ga0213874_100005096 313
135 3300025906 Ga0207699_10091672 Ga0207699_100916722 313
136 3300025910 Ga0207684_10205849 Ga0207684_102058492 313
137 3300025912 Ga0207707_10080546 Ga0207707_100805463 313
138 3300025913 Ga0207695_10080892 Ga0207695_100808925 313
139 3300025913 Ga0207695_10081416 Ga0207695_100814163 313
140 3300025921 Ga0207652_10136236 Ga0207652_101362363 313
141 3300025939 Ga0207665_10143096 Ga0207665_101430963 313
142 3300025949 Ga0207667_10169519 Ga0207667_101695193 313
143 3300028573 Ga0265334_10015508 Ga0265334_100155083 313
144 3300031507 Ga0307509_10229853 Ga0307509_102298532 313
145 3300035691 Ga0373931_0025111 Ga0373931_0025111_1863_2831 313
146 3300037312 Ga0395899_0009795 Ga0395899_0009795_3769_4737 313
147 3300037312 Ga0395899_0068673 Ga0395899_0068673_447_1415 313
148 3300037418 Ga0395900_0012665 Ga0395900_0012665_3343_4311 313
149 3300037466 Ga0395898_0108924 Ga0395898_0108924_1655_2629 313
150 3300037466 Ga0395898_0247371 Ga0395898_0247371_453_1439 313
151 3300038443 Ga0395901_0002054 Ga0395901_0002054_4432_5400 313
152 3300038443 Ga0395901_0345533 Ga0395901_0345533_162_1130 313
153 3300039450 Ga0436363_1569227 Ga0436363_1569227_5568_6536 313
154 3300044656 Ga0466969_0005906 Ga0466969_0005906_3743_4723 313
155 3300044693 Ga0466961_0003120 Ga0466961_0003120_6371_7351 313
156 3300044706 Ga0466964_0003100 Ga0466964_0003100_1253_2233 313
157 3300044719 Ga0466971_0000538 Ga0466971_0000538_12527_13507 313
158 3300044765 Ga0466970_0018079 Ga0466970_0018079_686_1666 313
159 3300044842 Ga0466957_0053972 Ga0466957_0053972_515_1495 313
160 3300050492 nmdc:mga0yw44_152268_c1 nmdc:mga0yw44_152268_c1_120_1088 313
161 3300050492 nmdc:mga0yw44_21392_c1 nmdc:mga0yw44_21392_c1_324_1292 313
162 3300050516 nmdc:mga0sz30_4471_c2 nmdc:mga0sz30_4471_c2_3073_4041 313
163 3300053146 Ga0500588_0008545 Ga0500588_0008545_1167_2147 313
164 3300061719 Ga0466962_0014340 Ga0466962_0014340_2760_3740 313
165 3300010159 Ga0099796_10034563 Ga0099796_100345632 314
166 3300025912 Ga0207707_10189435 Ga0207707_101894352 314
167 3300030521 Ga0307511_10011017 Ga0307511_100110173 314
168 3300035113 Ga0373936_0001707 Ga0373936_0001707_5795_6769 314
169 3300046519 Ga0495632_0070560 Ga0495632_0070560_664_1638 314
170 3300047443 Ga0495687_043727 Ga0495687_043727_189_1136 314
171 3300053092 Ga0500583_0001345 Ga0500583_0001345_3974_4948 314
172 3300053092 Ga0500583_0074249 Ga0500583_0074249_253_1227 314
173 3300053156 Ga0500622_0035807 Ga0500622_0035807_262_1212 314
174 iso_pu_bacteria 2841760612 2841764601 314
175 iso_pu_bacteria 2844104063 2844107951 314
176 iso_pu_bacteria 2851182111 2851187882 314
177 iso_pu_bacteria 2851246043 2851250057 314
178 iso_pu_bacteria 8057529695 8057533347 314
179 3300005329 Ga0070683_100208036 Ga0070683_1002080362 315
180 3300005335 Ga0070666_10006053 Ga0070666_100060535 315
181 3300005338 Ga0068868_100084470 Ga0068868_1000844702 315
182 3300005355 Ga0070671_100002471 Ga0070671_1000024714 315
183 3300005355 Ga0070671_100052893 Ga0070671_1000528933 315
184 3300005364 Ga0070673_100030920 Ga0070673_1000309202 315
185 3300005367 Ga0070667_100019356 Ga0070667_1000193563 315
186 3300005367 Ga0070667_100094182 Ga0070667_1000941823 315
187 3300005367 Ga0070667_100196671 Ga0070667_1001966711 315
188 3300005435 Ga0070714_100125247 Ga0070714_1001252473 315
189 3300005436 Ga0070713_100051968 Ga0070713_1000519682 315
190 3300005437 Ga0070710_10031700 Ga0070710_100317003 315
191 3300005439 Ga0070711_100095159 Ga0070711_1000951592 315
192 3300005440 Ga0070705_100046086 Ga0070705_1000460863 315
193 3300005458 Ga0070681_10004986 Ga0070681_100049864 315
194 3300005459 Ga0068867_100140656 Ga0068867_1001406562 315
195 3300005518 Ga0070699_100029046 Ga0070699_1000290465 315
196 3300005530 Ga0070679_100053779 Ga0070679_1000537793 315
197 3300005544 Ga0070686_100085638 Ga0070686_1000856382 315
198 3300005545 Ga0070695_100026405 Ga0070695_1000264053 315
199 3300005548 Ga0070665_100061097 Ga0070665_1000610975 315
200 3300005548 Ga0070665_100107949 Ga0070665_1001079492 315
201 3300005617 Ga0068859_100020031 Ga0068859_1000200312 315
202 3300005617 Ga0068859_100409726 Ga0068859_1004097262 315
203 3300005834 Ga0068851_10074340 Ga0068851_100743402 315
204 3300005841 Ga0068863_100007033 Ga0068863_1000070333 315
205 3300005841 Ga0068863_100015599 Ga0068863_1000155994 315
206 3300005841 Ga0068863_100050965 Ga0068863_1000509655 315
207 3300005842 Ga0068858_100000542 Ga0068858_10000054235 315
208 3300005842 Ga0068858_100005019 Ga0068858_10000501913 315
209 3300005842 Ga0068858_100023857 Ga0068858_1000238573 315
210 3300005843 Ga0068860_100001034 Ga0068860_1000010347 315
211 3300005843 Ga0068860_100004915 Ga0068860_10000491516 315
212 3300005843 Ga0068860_100179993 Ga0068860_1001799933 315
213 3300005844 Ga0068862_100032154 Ga0068862_1000321545 315
214 3300006163 Ga0070715_10001423 Ga0070715_100014236 315
215 3300006173 Ga0070716_100044238 Ga0070716_1000442383 315
216 3300006175 Ga0070712_100070729 Ga0070712_1000707293 315
217 3300006175 Ga0070712_100183848 Ga0070712_1001838481 315
218 3300006358 Ga0068871_100062057 Ga0068871_1000620573 315
219 3300006931 Ga0097620_100020032 Ga0097620_1000200325 315
220 3300006931 Ga0097620_100409725 Ga0097620_1004097252 315
221 3300009093 Ga0105240_10015909 Ga0105240_100159092 315
222 3300009093 Ga0105240_10168712 Ga0105240_101687123 315
223 3300009098 Ga0105245_10027152 Ga0105245_100271526 315
224 3300009101 Ga0105247_10000359 Ga0105247_100003596 315
225 3300009101 Ga0105247_10082029 Ga0105247_100820293 315
226 3300009176 Ga0105242_10002762 Ga0105242_100027623 315
227 3300009177 Ga0105248_10035899 Ga0105248_100358996 315
228 3300009177 Ga0105248_10061836 Ga0105248_100618363 315
229 3300009551 Ga0105238_10113339 Ga0105238_101133392 315
230 3300009553 Ga0105249_10018075 Ga0105249_100180752 315
231 3300009553 Ga0105249_10036911 Ga0105249_100369112 315
232 3300013297 Ga0157378_10016752 Ga0157378_100167526 315
233 3300014968 Ga0157379_10067384 Ga0157379_100673843 315
234 3300014968 Ga0157379_10115802 Ga0157379_101158023 315
235 3300014969 Ga0157376_10076274 Ga0157376_100762743 315
236 3300025898 Ga0207692_10045489 Ga0207692_100454892 315
237 3300025900 Ga0207710_10005711 Ga0207710_100057113 315
238 3300025900 Ga0207710_10088233 Ga0207710_100882332 315
239 3300025904 Ga0207647_10084671 Ga0207647_100846712 315
240 3300025905 Ga0207685_10009080 Ga0207685_100090804 315
241 3300025906 Ga0207699_10001022 Ga0207699_1000102211 315
242 3300025912 Ga0207707_10095791 Ga0207707_100957911 315
243 3300025913 Ga0207695_10017905 Ga0207695_100179052 315
244 3300025913 Ga0207695_10032020 Ga0207695_100320205 315
245 3300025915 Ga0207693_10000673 Ga0207693_1000067313 315
246 3300025939 Ga0207665_10013173 Ga0207665_100131732 315
247 3300025941 Ga0207711_10424772 Ga0207711_104247722 315
248 3300025960 Ga0207651_10051268 Ga0207651_100512682 315
249 3300025986 Ga0207658_10075450 Ga0207658_100754502 315
250 3300026035 Ga0207703_10001716 Ga0207703_1000171611 315
251 3300026067 Ga0207678_10284715 Ga0207678_102847151 315
252 3300026078 Ga0207702_10074949 Ga0207702_100749495 315
253 3300026088 Ga0207641_10000106 Ga0207641_1000010655 315
254 3300026089 Ga0207648_10121731 Ga0207648_101217313 315
255 3300028379 Ga0268266_10002158 Ga0268266_100021582 315
256 3300028381 Ga0268264_10000188 Ga0268264_100001888 315
257 3300031507 Ga0307509_10000002 Ga0307509_10000002147 315
258 3300031901 Ga0307406_10096093 Ga0307406_100960933 315
259 3300032002 Ga0307416_100358274 Ga0307416_1003582742 315
260 3300035695 Ga0373927_0077965 Ga0373927_0077965_362_1366 315
261 3300036401 Ga0373937_0026169 Ga0373937_0026169_2323_3327 315
262 3300036401 Ga0373937_0030721 Ga0373937_0030721_210_1187 315
263 3300037068 Ga0373925_0080892 Ga0373925_0080892_903_1877 315
264 3300039438 Ga0436360_1021191 Ga0436360_1021191_174_1163 315
265 3300039453 Ga0436362_1130171 Ga0436362_1130171_1085_2074 315
266 3300044656 Ga0466969_0064552 Ga0466969_0064552_320_1369 315
267 3300046472 Ga0495580_0004619 Ga0495580_0004619_4544_5518 315
268 3300046472 Ga0495580_0090088 Ga0495580_0090088_149_1153 315
269 3300046514 Ga0495618_0147181 Ga0495618_0147181_483_1484 315
270 3300048905 Ga0496102_0006186 Ga0496102_0006186_5406_6404 315
271 3300048905 Ga0496102_0115253 Ga0496102_0115253_768_1772 315
272 3300048906 Ga0496103_0019493 Ga0496103_0019493_2772_3770 315
273 3300048908 Ga0496105_0211780 Ga0496105_0211780_490_1488 315
274 3300048910 Ga0496107_0005388 Ga0496107_0005388_3206_4210 315
275 3300048913 Ga0496110_0010247 Ga0496110_0010247_2109_3113 315
276 3300048914 Ga0496111_0056794 Ga0496111_0056794_156_1160 315
277 3300048915 Ga0496112_0048367 Ga0496112_0048367_759_1733 315
278 3300048917 Ga0496114_0013758 Ga0496114_0013758_736_1740 315
279 3300048918 Ga0496115_0153396 Ga0496115_0153396_501_1505 315
280 3300048919 Ga0496116_0007140 Ga0496116_0007140_7388_8386 315
281 3300048920 Ga0496117_0000110 Ga0496117_0000110_67287_68285 315
282 3300048921 Ga0496118_0000014 Ga0496118_0000014_535437_536435 315
283 3300048922 Ga0496119_0000203 Ga0496119_0000203_57254_58231 315
284 3300048922 Ga0496119_0093099 Ga0496119_0093099_478_1452 315
285 3300048923 Ga0496120_0000018 Ga0496120_0000018_147980_148957 315
286 3300048924 Ga0496121_0001306 Ga0496121_0001306_8487_9461 315
287 3300048924 Ga0496121_0143923 Ga0496121_0143923_372_1370 315
288 3300048927 Ga0496124_0032798 Ga0496124_0032798_3139_4137 315
289 3300048928 Ga0496125_0000568 Ga0496125_0000568_56210_57184 315
290 3300048928 Ga0496125_0005340 Ga0496125_0005340_11314_12288 315
291 3300048928 Ga0496125_0143029 Ga0496125_0143029_216_1214 315
292 3300048929 Ga0496126_0019198 Ga0496126_0019198_5358_6332 315
293 3300003322 rootL2_10082985 rootL2_100829853 316
294 3300005337 Ga0070682_100058587 Ga0070682_1000585873 316
295 3300005436 Ga0070713_100028752 Ga0070713_1000287523 316
296 3300005458 Ga0070681_10192364 Ga0070681_101923642 316
297 3300005539 Ga0068853_100097326 Ga0068853_1000973264 316
298 3300005548 Ga0070665_100019793 Ga0070665_1000197935 316
299 3300005577 Ga0068857_100045550 Ga0068857_1000455504 316
300 3300005842 Ga0068858_100263092 Ga0068858_1002630922 316
301 3300006237 Ga0097621_100062095 Ga0097621_1000620954 316
302 3300006358 Ga0068871_100051163 Ga0068871_1000511632 316
303 3300009093 Ga0105240_10064440 Ga0105240_100644406 316
304 3300009093 Ga0105240_10076621 Ga0105240_100766213 316
305 3300009093 Ga0105240_10090871 Ga0105240_100908711 316
306 3300009174 Ga0105241_10505957 Ga0105241_105059571 316
307 3300009545 Ga0105237_10135637 Ga0105237_101356372 316
308 3300009551 Ga0105238_10001541 Ga0105238_1000154118 316
309 3300009551 Ga0105238_10220777 Ga0105238_102207772 316
310 3300013104 Ga0157370_10017473 Ga0157370_100174733 316
311 3300013105 Ga0157369_10179502 Ga0157369_101795022 316
312 3300013307 Ga0157372_10019757 Ga0157372_100197577 316
313 3300014325 Ga0163163_10062455 Ga0163163_100624553 316
314 3300014968 Ga0157379_10344768 Ga0157379_103447682 316
315 3300025913 Ga0207695_10076166 Ga0207695_100761662 316
316 3300025924 Ga0207694_10029976 Ga0207694_100299763 316
317 3300025924 Ga0207694_10214025 Ga0207694_102140252 316
318 3300025932 Ga0207690_10022316 Ga0207690_100223163 316
319 3300025949 Ga0207667_10051462 Ga0207667_100514625 316
320 3300026116 Ga0207674_10043086 Ga0207674_100430863 316
321 3300028379 Ga0268266_10002983 Ga0268266_100029838 316
322 3300030521 Ga0307511_10000348 Ga0307511_1000034824 316
323 3300031616 Ga0307508_10184778 Ga0307508_101847782 316
324 3300039450 Ga0436363_1676543 Ga0436363_1676543_45_1019 316
325 3300039453 Ga0436362_0082311 Ga0436362_0082311_1217_2194 316
326 3300044656 Ga0466969_0007699 Ga0466969_0007699_2638_3630 316
327 3300044693 Ga0466961_0067386 Ga0466961_0067386_152_1144 316
328 3300045049 Ga0466959_0025140 Ga0466959_0025140_1927_2904 316
329 3300045049 Ga0466959_0118174 Ga0466959_0118174_820_1812 316
330 3300045049 Ga0466959_0151720 Ga0466959_0151720_30_1022 316
331 3300053178 Ga0500637_0038445 Ga0500637_0038445_357_1337 316
332 iso_pu_bacteria 2537561836 2538834080 316
333 iso_pu_bacteria 2643221562 2643828996 316
334 iso_pu_bacteria 2643221577 2643895827 316
335 iso_pu_bacteria 2643221685 2644478019 316

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00899

ThiF

ThiF family

5

217

0.97

PF00581

Rhodanese

Rhodanese-like domain

271

348

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jwa-assembly1.cif.gz_B-2 structure of the atp-bound moeb-moad protein complex 0.969 2 220
7sol-assembly1.cif.gz_A crystal structures of the bispecific ubiquitin/fat10 activating enzyme, uba6 0.9501 11 158
7pvn-assembly1.cif.gz_A crystal structure of human uba6 in complex with atp 0.9499 11 157
6o82-assembly1.cif.gz_A s. pombe ubiquitin e1 complex with a ubiquitin-amp mimic 0.9496 7 156
7pvn-assembly2.cif.gz_B crystal structure of human uba6 in complex with atp 0.949 11 158
ID Description Score Start End Superfamily
af_Q6H7A7_75_268_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9863 2 150 3.40.50.720
af_A0A1D6II59_3_109_3.50.50.80 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;Ubiquitin-activating enzyme E1, inactive adenylation domain, subdomain 1 0.9642 11 94 3.50.50.80
af_L7N674_15_263_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9597 2 222 3.40.50.720
af_O44510_10_262_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9497 2 228 3.40.50.720
1jwbB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9494 2 228 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2J0N1C4-F1-model_v4 Adenylyltransferase 0.9956 2 96 GO:0004792
GO:0005829
GO:0008146
GO:0008641
GO:0016779
AF-A0A356FT47-F1-model_v4 THIF-type NAD/FAD binding fold domain-containing protein 0.9953 2 127 GO:0004792
GO:0005829
GO:0008146
GO:0008641
GO:0016779
AF-A0A2S5NTV2-F1-model_v4 Molybdopterin biosynthesis protein MoeB 0.9951 2 91 GO:0004792
GO:0005737
GO:0016779
GO:0042292
AF-A0A349E792-F1-model_v4 THIF-type NAD/FAD binding fold domain-containing protein 0.9934 2 95 GO:0004792
GO:0005829
GO:0008146
GO:0008641
GO:0016779
AF-A0A3C0GNI2-F1-model_v4 Molybdopterin biosynthesis protein MoeB 0.993 2 135 GO:0004792
GO:0005524
GO:0005829
GO:0008146
GO:0008641
GO:0016779

Feature Viewer

pLDDT pTM Quality
91.67 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map