F412299

General Info

Members Datasets Scaffolds Average Seq Length
335 206 670 158

Family's Representative Sequence

Representative Sequence 3300031665|Ga0316575_10026552|Ga0316575_100265522
Length 166
Sequence MSGRITMSEDQLRPDPKFNDLVLSKFINCVMHDGRKTSAERCVYDAMTEIDSRLAKDTSESDAKPKDALDLFHRAVDNVKPYVEVRSKRIGGANYQVPIQVNRKRQQSLAFRWIIQSARSEKGRPMAQKLADELWAASRGEGKAMTTRDQTHRMAEANKAFAHFAK

Samples

Sample ID Description Type Environment
1 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
72 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
110 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
113 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
114 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
117 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
118 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
125 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
128 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
136 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
137 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
138 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
139 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
140 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
143 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
144 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
145 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
146 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
147 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
148 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
149 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
150 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
151 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
152 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
153 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
154 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
155 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
156 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
157 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
158 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
159 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
160 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
161 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
162 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
163 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
164 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
165 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
166 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
167 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
168 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
169 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
178 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
179 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
180 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
181 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
182 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
183 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
184 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
185 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
189 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
190 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
191 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.25
Metatranscriptomes 10.75
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.6
Nodule 0
Rhizoplane 1.19
Rhizosphere 97.31
Stem 0
Stem Tuber 0
Unclassified 1.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316575_10026552 3300031665 Bacteria 2250
2 Ga0058863_11742082 3300004799 Bacteria 1088
3 Ga0070658_10063944 3300005327 Bacteria 3001
4 Ga0070683_100466352 3300005329 Bacteria 1206
5 Ga0070683_101287250 3300005329 Bacteria 703
6 Ga0070690_100808250 3300005330 Bacteria 728
7 Ga0070670_100028385 3300005331 Bacteria 4816
8 Ga0070670_100883653 3300005331 Bacteria 810
9 Ga0070670_101769441 3300005331 Bacteria 569
10 Ga0070677_10020720 3300005333 Bacteria 2400
11 Ga0068869_100744151 3300005334 Bacteria 839
12 Ga0070666_11308422 3300005335 Bacteria 541
13 Ga0070687_100265538 3300005343 Bacteria 1073
14 Ga0070669_100201029 3300005353 Bacteria 1568
15 Ga0070675_100460592 3300005354 Bacteria 1141
16 Ga0070675_100635576 3300005354 Bacteria 969
17 Ga0070675_100842787 3300005354 Bacteria 839
18 Ga0070671_100713262 3300005355 Bacteria 870
19 Ga0070674_100383203 3300005356 Bacteria 1144
20 Ga0070673_100738341 3300005364 Bacteria 906
21 Ga0070659_100036928 3300005366 Bacteria 3808
22 Ga0070667_100286825 3300005367 Bacteria 1479
23 Ga0070667_100324381 3300005367 Bacteria 1390
24 Ga0070714_100096912 3300005435 Bacteria 2592
25 Ga0070714_100490324 3300005435 Bacteria 1171
26 Ga0070714_100703888 3300005435 Bacteria 975
27 Ga0070711_100959903 3300005439 Bacteria 732
28 Ga0070708_100740957 3300005445 Bacteria 924
29 Ga0070678_100639029 3300005456 Bacteria 953
30 Ga0068867_100135355 3300005459 Bacteria 1920
31 Ga0068867_100570544 3300005459 Bacteria 983
32 Ga0070679_100014529 3300005530 Bacteria 7563
33 Ga0070684_100754883 3300005535 Unclassified 908
34 Ga0070684_100846601 3300005535 Bacteria 856
35 Ga0070665_100009826 3300005548 Bacteria 9672
36 Ga0068855_100078685 3300005563 Bacteria 3825
37 Ga0068855_100211031 3300005563 Bacteria 2182
38 Ga0068855_100813164 3300005563 Bacteria 992
39 Ga0070664_100117173 3300005564 Bacteria 2330
40 Ga0070664_100258832 3300005564 Bacteria 1565
41 Ga0070664_101818815 3300005564 Bacteria 578
42 Ga0068857_100046748 3300005577 Bacteria 3841
43 Ga0068856_100569789 3300005614 Bacteria 1154
44 Ga0068852_100361035 3300005616 Bacteria 1421
45 Ga0068859_102895162 3300005617 Bacteria 526
46 Ga0068866_10498690 3300005718 Unclassified 805
47 Ga0068863_100507633 3300005841 Bacteria 1188
48 Ga0068858_100354899 3300005842 Bacteria 1405
49 Ga0068860_100025799 3300005843 Bacteria 5669
50 Ga0068860_100143014 3300005843 Bacteria 2300
51 Ga0068862_100568380 3300005844 Bacteria 1085
52 Ga0097621_100218309 3300006237 Bacteria 1661
53 Ga0068871_100173976 3300006358 Bacteria 1847
54 Ga0075428_100105281 3300006844 Bacteria 3077
55 Ga0075428_100231474 3300006844 Bacteria 1994
56 Ga0075428_101359422 3300006844 Bacteria 746
57 Ga0075430_100007993 3300006846 Bacteria 8940
58 Ga0075430_101155205 3300006846 Bacteria 638
59 Ga0075431_100077975 3300006847 Bacteria 3420
60 Ga0075431_100139875 3300006847 Bacteria 2495
61 Ga0075431_100495805 3300006847 Bacteria 1213
62 Ga0075429_100244690 3300006880 Bacteria 1571
63 Ga0097620_102894481 3300006931 Bacteria 526
64 Ga0105240_10097602 3300009093 Bacteria 3580
65 Ga0105240_10358303 3300009093 Bacteria 1653
66 Ga0105240_10431939 3300009093 Bacteria 1478
67 Ga0105240_10519571 3300009093 Bacteria 1321
68 Ga0111539_10073213 3300009094 Bacteria 4039
69 Ga0111539_10597713 3300009094 Bacteria 1285
70 Ga0111539_11258782 3300009094 Bacteria 859
71 Ga0111539_11972639 3300009094 Bacteria 677
72 Ga0105245_10077206 3300009098 Bacteria 3036
73 Ga0105245_10094595 3300009098 Bacteria 2755
74 Ga0105245_10296376 3300009098 Bacteria 1585
75 Ga0114129_12530712 3300009147 Bacteria 613
76 Ga0105243_10081501 3300009148 Bacteria 2642
77 Ga0105241_10362295 3300009174 Bacteria 1262
78 Ga0105241_10394388 3300009174 Bacteria 1212
79 Ga0105241_11143206 3300009174 Bacteria 735
80 Ga0105248_10225495 3300009177 Bacteria 2109
81 Ga0105248_10992430 3300009177 Bacteria 948
82 Ga0105248_12729130 3300009177 Bacteria 563
83 Ga0105237_11275474 3300009545 Bacteria 741
84 Ga0105238_10223174 3300009551 Bacteria 1861
85 Ga0105238_11274525 3300009551 Bacteria 760
86 Ga0105238_11571841 3300009551 Bacteria 687
87 Ga0105249_11070426 3300009553 Bacteria 876
88 Ga0105239_10355134 3300010375 Bacteria 1655
89 Ga0105239_11901976 3300010375 Bacteria 690
90 Ga0105239_12581594 3300010375 Bacteria 592
91 Ga0157371_10213713 3300013102 Bacteria 1384
92 Ga0157371_10285707 3300013102 Bacteria 1192
93 Ga0157371_10435930 3300013102 Bacteria 962
94 Ga0157371_10882929 3300013102 Bacteria 677
95 Ga0157371_11323901 3300013102 Bacteria 558
96 Ga0157370_10035433 3300013104 Bacteria 4850
97 Ga0157370_10139561 3300013104 Bacteria 2258
98 Ga0157370_10672754 3300013104 Bacteria 946
99 Ga0157370_10769768 3300013104 Bacteria 877
100 Ga0157370_10774750 3300013104 Bacteria 873
101 Ga0157370_11194403 3300013104 Bacteria 686
102 Ga0157369_10105915 3300013105 Bacteria 2993
103 Ga0157369_10147587 3300013105 Bacteria 2486
104 Ga0157369_10213086 3300013105 Bacteria 2024
105 Ga0157369_10344375 3300013105 Bacteria 1548
106 Ga0157369_10764831 3300013105 Bacteria 993
107 Ga0157369_10977537 3300013105 Bacteria 867
108 Ga0157369_11134550 3300013105 Bacteria 799
109 Ga0157374_10393610 3300013296 Bacteria 1381
110 Ga0157378_10472904 3300013297 Bacteria 1247
111 Ga0157378_11039297 3300013297 Bacteria 855
112 Ga0163162_10202546 3300013306 Bacteria 2114
113 Ga0163162_10286623 3300013306 Bacteria 1779
114 Ga0163162_10458016 3300013306 Bacteria 1407
115 Ga0163162_11024026 3300013306 Bacteria 934
116 Ga0157372_10204184 3300013307 Bacteria 2290
117 Ga0157372_10315537 3300013307 Bacteria 1820
118 Ga0157372_10363636 3300013307 Bacteria 1686
119 Ga0157372_10587016 3300013307 Bacteria 1299
120 Ga0157372_10854567 3300013307 Bacteria 1056
121 Ga0157372_11658703 3300013307 Bacteria 736
122 Ga0157372_11899465 3300013307 Bacteria 684
123 Ga0157372_11974348 3300013307 Bacteria 671
124 Ga0157375_10357737 3300013308 Bacteria 1626
125 Ga0157375_10585774 3300013308 Bacteria 1275
126 Ga0157375_11475914 3300013308 Bacteria 802
127 Ga0163163_11555004 3300014325 Bacteria 723
128 Ga0163163_12162184 3300014325 Bacteria 616
129 Ga0182008_10441260 3300014497 Bacteria 706
130 Ga0157377_10724667 3300014745 Bacteria 725
131 Ga0157377_10987196 3300014745 Bacteria 636
132 Ga0157379_10205921 3300014968 Bacteria 1779
133 Ga0157379_10498708 3300014968 Bacteria 1128
134 Ga0157379_11989651 3300014968 Bacteria 574
135 Ga0157376_10353849 3300014969 Bacteria 1406
136 Ga0157376_10989274 3300014969 Bacteria 863
137 Ga0157376_11344645 3300014969 Bacteria 745
138 Ga0197907_11070923 3300020069 Bacteria 793
139 Ga0197907_11103808 3300020069 Bacteria 769
140 Ga0206356_11377364 3300020070 Bacteria 690
141 Ga0206349_1400526 3300020075 Bacteria 1148
142 Ga0206355_1040005 3300020076 Bacteria 919
143 Ga0206355_1111271 3300020076 Bacteria 1089
144 Ga0206351_10044906 3300020077 Bacteria 566
145 Ga0206351_10150729 3300020077 Bacteria 872
146 Ga0206352_10230582 3300020078 Bacteria 667
147 Ga0206352_11135315 3300020078 Bacteria 527
148 Ga0206354_11296829 3300020081 Bacteria 836
149 Ga0206353_11152181 3300020082 Bacteria 1134
150 Ga0154015_1390670 3300020610 Bacteria 1121
151 Ga0224712_10090376 3300022467 Bacteria 1281
152 Ga0207682_10313586 3300025893 Bacteria 736
153 Ga0207647_10447918 3300025904 Bacteria 724
154 Ga0207705_10046898 3300025909 Bacteria 3107
155 Ga0207705_10697947 3300025909 Bacteria 789
156 Ga0207695_10000147 3300025913 Bacteria 208929
157 Ga0207660_11188280 3300025917 Bacteria 621
158 Ga0207652_10067825 3300025921 Bacteria 3094
159 Ga0207681_10200494 3300025923 Bacteria 1532
160 Ga0207681_10573938 3300025923 Bacteria 930
161 Ga0207681_11170480 3300025923 Bacteria 646
162 Ga0207694_11656414 3300025924 Bacteria 539
163 Ga0207650_10175878 3300025925 Bacteria 1703
164 Ga0207650_10213689 3300025925 Bacteria 1550
165 Ga0207659_10020377 3300025926 Bacteria 4383
166 Ga0207659_10064290 3300025926 Bacteria 2655
167 Ga0207659_11074551 3300025926 Bacteria 692
168 Ga0207659_11489348 3300025926 Bacteria 579
169 Ga0207687_10074498 3300025927 Bacteria 2433
170 Ga0207687_10096530 3300025927 Bacteria 2166
171 Ga0207687_11391860 3300025927 Bacteria 603
172 Ga0207664_10118841 3300025929 Bacteria 2209
173 Ga0207664_10358014 3300025929 Bacteria 1292
174 Ga0207669_10292766 3300025937 Bacteria 1233
175 Ga0207669_10343236 3300025937 Bacteria 1151
176 Ga0207661_11333891 3300025944 Bacteria 659
177 Ga0207679_10160790 3300025945 Bacteria 1839
178 Ga0207667_10107948 3300025949 Bacteria 2872
179 Ga0207667_10155954 3300025949 Bacteria 2349
180 Ga0207667_11337032 3300025949 Bacteria 692
181 Ga0207667_11435539 3300025949 Bacteria 663
182 Ga0207651_10342362 3300025960 Bacteria 1257
183 Ga0207651_10701195 3300025960 Bacteria 892
184 Ga0207651_11180209 3300025960 Bacteria 687
185 Ga0207651_11448500 3300025960 Bacteria 618
186 Ga0207668_10488696 3300025972 Bacteria 1057
187 Ga0207658_10191733 3300025986 Bacteria 1699
188 Ga0207658_10276038 3300025986 Bacteria 1439
189 Ga0207658_10414814 3300025986 Bacteria 1186
190 Ga0207703_10622857 3300026035 Bacteria 1022
191 Ga0207639_10947107 3300026041 Bacteria 806
192 Ga0207702_10428394 3300026078 Bacteria 1280
193 Ga0207702_10769647 3300026078 Bacteria 951
194 Ga0207641_10415556 3300026088 Bacteria 1294
195 Ga0207648_10320001 3300026089 Bacteria 1394
196 Ga0207648_10692259 3300026089 Bacteria 944
197 Ga0207676_11360668 3300026095 Bacteria 705
198 Ga0207674_10000424 3300026116 Bacteria 55049
199 Ga0207674_11334665 3300026116 Bacteria 687
200 Ga0207675_100459033 3300026118 Bacteria 1263
201 Ga0207683_10047194 3300026121 Bacteria 3772
202 Ga0207698_10079018 3300026142 Bacteria 2644
203 Ga0207698_10786186 3300026142 Bacteria 953
204 Ga0268266_10003524 3300028379 Bacteria 15531
205 Ga0268264_10047918 3300028381 Bacteria 3554
206 Ga0268264_10056909 3300028381 Bacteria 3269
207 Ga0268264_11708770 3300028381 Bacteria 640
208 Ga0265324_10056307 3300029957 Bacteria 1347
209 Ga0265762_1172255 3300030760 Unclassified 528
210 Ga0265777_105206 3300030877 Bacteria 852
211 Ga0265339_10000446 3300031249 Bacteria 32360
212 Ga0265327_10015569 3300031251 Bacteria 4897
213 Ga0265316_10016734 3300031344 Bacteria 6353
214 Ga0307408_100182998 3300031548 Bacteria 1682
215 Ga0316577_10346449 3300031733 Bacteria 843
216 Ga0307413_10480280 3300031824 Bacteria 993
217 Ga0307407_10105854 3300031903 Bacteria 1756
218 Ga0307407_10356172 3300031903 Unclassified 1038
219 Ga0307409_100050924 3300031995 Bacteria 3166
220 Ga0307409_100118670 3300031995 Bacteria 2235
221 Ga0307409_102076990 3300031995 Bacteria 598
222 Ga0307416_100119226 3300032002 Bacteria 2347
223 Ga0307414_10114853 3300032004 Bacteria 2058
224 Ga0307414_10510051 3300032004 Bacteria 1066
225 Ga0307414_10720355 3300032004 Bacteria 905
226 Ga0307411_10471140 3300032005 Bacteria 1055
227 Ga0307411_11552107 3300032005 Bacteria 610
228 Ga0316593_10143052 3300032168 Bacteria 867
229 Ga0373957_0123369 3300035120 Bacteria 1050
230 Ga0373943_0356753 3300035170 Bacteria 839
231 Ga0373937_0015214 3300036401 Bacteria 6800
232 Ga0373937_0334078 3300036401 Bacteria 1435
233 Ga0373937_1090721 3300036401 Bacteria 747
234 Ga0316582_0872799 3300036647 Bacteria 616
235 Ga0316584_0712245 3300036712 Bacteria 687
236 Ga0373925_1260319 3300037068 Bacteria 607
237 Ga0395900_0275001 3300037418 Bacteria 1678
238 Ga0395900_0605649 3300037418 Bacteria 1036
239 Ga0395900_1026758 3300037418 Bacteria 744
240 Ga0395898_0634661 3300037466 Bacteria 1011
241 Ga0395898_1316427 3300037466 Bacteria 652
242 Ga0395905_0217513 3300037471 Bacteria 1789
243 Ga0395905_0693503 3300037471 Bacteria 921
244 Ga0395905_0706012 3300037471 Bacteria 911
245 Ga0395901_0074005 3300038443 Bacteria 3554
246 Ga0436365_1126849 3300039437 Bacteria 1659
247 Ga0436365_1458326 3300039437 Bacteria 624
248 Ga0436363_1090301 3300039450 Bacteria 563
249 Ga0451793_0691481 3300041452 Bacteria 561
250 Ga0451798_0770234 3300041458 Bacteria 506
251 Ga0451577_0172867 3300042876 Bacteria 1947
252 Ga0453684_1100166 3300044712 Bacteria 839
253 Ga0466970_0612821 3300044765 Bacteria 632
254 Ga0451576_1824131 3300045051 Bacteria 628
255 Ga0495580_0391026 3300046472 Bacteria 939
256 Ga0495580_0513123 3300046472 Bacteria 799
257 Ga0495582_0298453 3300046473 Bacteria 926
258 Ga0495639_0487019 3300046475 Bacteria 629
259 Ga0495662_0414371 3300046476 Bacteria 661
260 Ga0495594_0186355 3300046499 Bacteria 1182
261 Ga0495608_0162976 3300046511 Bacteria 1417
262 Ga0495618_0427260 3300046514 Bacteria 807
263 Ga0495628_0163974 3300046516 Bacteria 1688
264 Ga0495630_0019181 3300046517 Bacteria 5026
265 Ga0495630_0127862 3300046517 Bacteria 1929
266 Ga0495665_0047844 3300046531 Bacteria 2269
267 Ga0495640_0711311 3300046533 Bacteria 602
268 Ga0495587_0287571 3300046536 Bacteria 921
269 Ga0495667_0058140 3300046559 Bacteria 2541
270 Ga0495656_0538483 3300046615 Bacteria 622
271 Ga0495634_0322931 3300046642 Bacteria 929
272 Ga0495635_0315815 3300046663 Bacteria 1046
273 Ga0495659_0284484 3300046664 Bacteria 696
274 Ga0495657_0510060 3300046675 Bacteria 701
275 Ga0495599_0818803 3300046678 Bacteria 531
276 Ga0495613_0382284 3300046689 Bacteria 963
277 Ga0495613_0699724 3300046689 Bacteria 667
278 Ga0495581_0033009 3300047315 Bacteria 2997
279 Ga0495604_0855870 3300047317 Bacteria 570
280 Ga0495674_0527156 3300047319 Bacteria 942
281 Ga0495676_0375361 3300047321 Bacteria 947
282 Ga0495675_0675839 3300047444 Bacteria 580
283 Ga0495684_0014589 3300047471 Bacteria 6047
284 Ga0495593_0516968 3300047673 Bacteria 599
285 Ga0495614_0095937 3300048089 Bacteria 1293
286 Ga0496108_0353288 3300048911 Bacteria 1283
287 Ga0496110_0698011 3300048913 Bacteria 916
288 Ga0501310_059671 3300049130 Bacteria 566
289 Ga0501034_0001601 3300049571 Bacteria 29434
290 Ga0501034_0003548 3300049571 Bacteria 17726
291 Ga0501040_0337546 3300049576 Bacteria 1079
292 Ga0501043_0109318 3300049579 Bacteria 2171
293 Ga0501047_0044809 3300049581 Bacteria 4275
294 Ga0501047_0049187 3300049581 Bacteria 4071
295 Ga0501047_0327133 3300049581 Bacteria 1372
296 Ga0501067_0122347 3300049583 Bacteria 1448
297 Ga0501067_0569461 3300049583 Bacteria 635
298 Ga0501067_0705256 3300049583 Bacteria 567
299 Ga0501073_0000001 3300049589 Bacteria 677932
300 Ga0501074_0352592 3300049590 Bacteria 1044
301 Ga0501077_0046144 3300049593 Bacteria 2769
302 Ga0501249_101908 3300049679 Bacteria 688
303 Ga0501080_0000757 3300049742 Bacteria 26177
304 Ga0501080_0053794 3300049742 Bacteria 3749
305 Ga0501083_0040317 3300049744 Bacteria 3170
306 Ga0501083_0436564 3300049744 Bacteria 852
307 Ga0501044_0000139 3300049823 Bacteria 88706
308 Ga0501044_0057045 3300049823 Bacteria 4008
309 nmdc:mga0qj67_502545_c1 3300050509 Bacteria 975
310 nmdc:mga06r32_19211_c1 3300050510 Bacteria 6272
311 nmdc:mga06r32_212087_c1 3300050510 Bacteria 1924
312 nmdc:mga06r32_963575_c1 3300050510 Bacteria 807
313 nmdc:mga08y16_38559_c1 3300050511 Bacteria 5017
314 nmdc:mga08y16_575746_c1 3300050511 Bacteria 1137
315 Ga0495595_0679119 3300053084 Bacteria 528
316 Ga0500556_0186360 3300053104 Bacteria 820
317 Ga0500616_0000490 3300053153 Bacteria 51103
318 Ga0587084_115023 3300059477 Bacteria 560
319 Ga0587070_024756 3300059491 Bacteria 1042
320 Ga0587073_0041366 3300059492 Bacteria 1006
321 Ga0587077_066227 3300059493 Bacteria 796
322 Ga0587080_025288 3300059503 Bacteria 1001
323 Ga0587083_0035545 3300059505 Bacteria 1017
324 Ga0587091_029132 3300059511 Bacteria 1023
325 Ga0587128_124060 3300059630 Bacteria 565
326 Ga0587062_036737 3300059639 Bacteria 777
327 Ga0587075_018222 3300059644 Bacteria 1017
328 Ga0587076_024439 3300059645 Bacteria 1025
329 Ga0587076_034322 3300059645 Bacteria 916
330 Ga0587078_012004 3300059646 Bacteria 1011
331 Ga0587079_029214 3300059647 Bacteria 1048
332 Ga0587102_019671 3300059649 Bacteria 753
333 Ga0587071_029601 3300060344 Bacteria 1048
334 Ga0587071_181298 3300060344 Bacteria 541
335 Ga0501082_0017897 3300060353 Bacteria 6104
336 Ga0316575_10026552
337 Ga0058863_11742082
338 Ga0070658_10063944
339 Ga0070683_100466352
340 Ga0070683_101287250
341 Ga0070690_100808250
342 Ga0070670_100028385
343 Ga0070670_100883653
344 Ga0070670_101769441
345 Ga0070677_10020720
346 Ga0068869_100744151
347 Ga0070666_11308422
348 Ga0070687_100265538
349 Ga0070669_100201029
350 Ga0070675_100460592
351 Ga0070675_100635576
352 Ga0070675_100842787
353 Ga0070671_100713262
354 Ga0070674_100383203
355 Ga0070673_100738341
356 Ga0070659_100036928
357 Ga0070667_100286825
358 Ga0070667_100324381
359 Ga0070714_100096912
360 Ga0070714_100490324
361 Ga0070714_100703888
362 Ga0070711_100959903
363 Ga0070708_100740957
364 Ga0070678_100639029
365 Ga0068867_100135355
366 Ga0068867_100570544
367 Ga0070679_100014529
368 Ga0070684_100754883
369 Ga0070684_100846601
370 Ga0070665_100009826
371 Ga0068855_100078685
372 Ga0068855_100211031
373 Ga0068855_100813164
374 Ga0070664_100117173
375 Ga0070664_100258832
376 Ga0070664_101818815
377 Ga0068857_100046748
378 Ga0068856_100569789
379 Ga0068852_100361035
380 Ga0068859_102895162
381 Ga0068866_10498690
382 Ga0068863_100507633
383 Ga0068858_100354899
384 Ga0068860_100025799
385 Ga0068860_100143014
386 Ga0068862_100568380
387 Ga0097621_100218309
388 Ga0068871_100173976
389 Ga0075428_100105281
390 Ga0075428_100231474
391 Ga0075428_101359422
392 Ga0075430_100007993
393 Ga0075430_101155205
394 Ga0075431_100077975
395 Ga0075431_100139875
396 Ga0075431_100495805
397 Ga0075429_100244690
398 Ga0097620_102894481
399 Ga0105240_10097602
400 Ga0105240_10358303
401 Ga0105240_10431939
402 Ga0105240_10519571
403 Ga0111539_10073213
404 Ga0111539_10597713
405 Ga0111539_11258782
406 Ga0111539_11972639
407 Ga0105245_10077206
408 Ga0105245_10094595
409 Ga0105245_10296376
410 Ga0114129_12530712
411 Ga0105243_10081501
412 Ga0105241_10362295
413 Ga0105241_10394388
414 Ga0105241_11143206
415 Ga0105248_10225495
416 Ga0105248_10992430
417 Ga0105248_12729130
418 Ga0105237_11275474
419 Ga0105238_10223174
420 Ga0105238_11274525
421 Ga0105238_11571841
422 Ga0105249_11070426
423 Ga0105239_10355134
424 Ga0105239_11901976
425 Ga0105239_12581594
426 Ga0157371_10213713
427 Ga0157371_10285707
428 Ga0157371_10435930
429 Ga0157371_10882929
430 Ga0157371_11323901
431 Ga0157370_10035433
432 Ga0157370_10139561
433 Ga0157370_10672754
434 Ga0157370_10769768
435 Ga0157370_10774750
436 Ga0157370_11194403
437 Ga0157369_10105915
438 Ga0157369_10147587
439 Ga0157369_10213086
440 Ga0157369_10344375
441 Ga0157369_10764831
442 Ga0157369_10977537
443 Ga0157369_11134550
444 Ga0157374_10393610
445 Ga0157378_10472904
446 Ga0157378_11039297
447 Ga0163162_10202546
448 Ga0163162_10286623
449 Ga0163162_10458016
450 Ga0163162_11024026
451 Ga0157372_10204184
452 Ga0157372_10315537
453 Ga0157372_10363636
454 Ga0157372_10587016
455 Ga0157372_10854567
456 Ga0157372_11658703
457 Ga0157372_11899465
458 Ga0157372_11974348
459 Ga0157375_10357737
460 Ga0157375_10585774
461 Ga0157375_11475914
462 Ga0163163_11555004
463 Ga0163163_12162184
464 Ga0182008_10441260
465 Ga0157377_10724667
466 Ga0157377_10987196
467 Ga0157379_10205921
468 Ga0157379_10498708
469 Ga0157379_11989651
470 Ga0157376_10353849
471 Ga0157376_10989274
472 Ga0157376_11344645
473 Ga0197907_11070923
474 Ga0197907_11103808
475 Ga0206356_11377364
476 Ga0206349_1400526
477 Ga0206355_1040005
478 Ga0206355_1111271
479 Ga0206351_10044906
480 Ga0206351_10150729
481 Ga0206352_10230582
482 Ga0206352_11135315
483 Ga0206354_11296829
484 Ga0206353_11152181
485 Ga0154015_1390670
486 Ga0224712_10090376
487 Ga0207682_10313586
488 Ga0207647_10447918
489 Ga0207705_10046898
490 Ga0207705_10697947
491 Ga0207695_10000147
492 Ga0207660_11188280
493 Ga0207652_10067825
494 Ga0207681_10200494
495 Ga0207681_10573938
496 Ga0207681_11170480
497 Ga0207694_11656414
498 Ga0207650_10175878
499 Ga0207650_10213689
500 Ga0207659_10020377
501 Ga0207659_10064290
502 Ga0207659_11074551
503 Ga0207659_11489348
504 Ga0207687_10074498
505 Ga0207687_10096530
506 Ga0207687_11391860
507 Ga0207664_10118841
508 Ga0207664_10358014
509 Ga0207669_10292766
510 Ga0207669_10343236
511 Ga0207661_11333891
512 Ga0207679_10160790
513 Ga0207667_10107948
514 Ga0207667_10155954
515 Ga0207667_11337032
516 Ga0207667_11435539
517 Ga0207651_10342362
518 Ga0207651_10701195
519 Ga0207651_11180209
520 Ga0207651_11448500
521 Ga0207668_10488696
522 Ga0207658_10191733
523 Ga0207658_10276038
524 Ga0207658_10414814
525 Ga0207703_10622857
526 Ga0207639_10947107
527 Ga0207702_10428394
528 Ga0207702_10769647
529 Ga0207641_10415556
530 Ga0207648_10320001
531 Ga0207648_10692259
532 Ga0207676_11360668
533 Ga0207674_10000424
534 Ga0207674_11334665
535 Ga0207675_100459033
536 Ga0207683_10047194
537 Ga0207698_10079018
538 Ga0207698_10786186
539 Ga0268266_10003524
540 Ga0268264_10047918
541 Ga0268264_10056909
542 Ga0268264_11708770
543 Ga0265324_10056307
544 Ga0265762_1172255
545 Ga0265777_105206
546 Ga0265339_10000446
547 Ga0265327_10015569
548 Ga0265316_10016734
549 Ga0307408_100182998
550 Ga0316577_10346449
551 Ga0307413_10480280
552 Ga0307407_10105854
553 Ga0307407_10356172
554 Ga0307409_100050924
555 Ga0307409_100118670
556 Ga0307409_102076990
557 Ga0307416_100119226
558 Ga0307414_10114853
559 Ga0307414_10510051
560 Ga0307414_10720355
561 Ga0307411_10471140
562 Ga0307411_11552107
563 Ga0316593_10143052
564 Ga0373957_0123369
565 Ga0373943_0356753
566 Ga0373937_0015214
567 Ga0373937_0334078
568 Ga0373937_1090721
569 Ga0316582_0872799
570 Ga0316584_0712245
571 Ga0373925_1260319
572 Ga0395900_0275001
573 Ga0395900_0605649
574 Ga0395900_1026758
575 Ga0395898_0634661
576 Ga0395898_1316427
577 Ga0395905_0217513
578 Ga0395905_0693503
579 Ga0395905_0706012
580 Ga0395901_0074005
581 Ga0436365_1126849
582 Ga0436365_1458326
583 Ga0436363_1090301
584 Ga0451793_0691481
585 Ga0451798_0770234
586 Ga0451577_0172867
587 Ga0453684_1100166
588 Ga0466970_0612821
589 Ga0451576_1824131
590 Ga0495580_0391026
591 Ga0495580_0513123
592 Ga0495582_0298453
593 Ga0495639_0487019
594 Ga0495662_0414371
595 Ga0495594_0186355
596 Ga0495608_0162976
597 Ga0495618_0427260
598 Ga0495628_0163974
599 Ga0495630_0019181
600 Ga0495630_0127862
601 Ga0495665_0047844
602 Ga0495640_0711311
603 Ga0495587_0287571
604 Ga0495667_0058140
605 Ga0495656_0538483
606 Ga0495634_0322931
607 Ga0495635_0315815
608 Ga0495659_0284484
609 Ga0495657_0510060
610 Ga0495599_0818803
611 Ga0495613_0382284
612 Ga0495613_0699724
613 Ga0495581_0033009
614 Ga0495604_0855870
615 Ga0495674_0527156
616 Ga0495676_0375361
617 Ga0495675_0675839
618 Ga0495684_0014589
619 Ga0495593_0516968
620 Ga0495614_0095937
621 Ga0496108_0353288
622 Ga0496110_0698011
623 Ga0501310_059671
624 Ga0501034_0001601
625 Ga0501034_0003548
626 Ga0501040_0337546
627 Ga0501043_0109318
628 Ga0501047_0044809
629 Ga0501047_0049187
630 Ga0501047_0327133
631 Ga0501067_0122347
632 Ga0501067_0569461
633 Ga0501067_0705256
634 Ga0501073_0000001
635 Ga0501074_0352592
636 Ga0501077_0046144
637 Ga0501249_101908
638 Ga0501080_0000757
639 Ga0501080_0053794
640 Ga0501083_0040317
641 Ga0501083_0436564
642 Ga0501044_0000139
643 Ga0501044_0057045
644 nmdc:mga0qj67_502545_c1
645 nmdc:mga06r32_19211_c1
646 nmdc:mga06r32_212087_c1
647 nmdc:mga06r32_963575_c1
648 nmdc:mga08y16_38559_c1
649 nmdc:mga08y16_575746_c1
650 Ga0495595_0679119
651 Ga0500556_0186360
652 Ga0500616_0000490
653 Ga0587084_115023
654 Ga0587070_024756
655 Ga0587073_0041366
656 Ga0587077_066227
657 Ga0587080_025288
658 Ga0587083_0035545
659 Ga0587091_029132
660 Ga0587128_124060
661 Ga0587062_036737
662 Ga0587075_018222
663 Ga0587076_024439
664 Ga0587076_034322
665 Ga0587078_012004
666 Ga0587079_029214
667 Ga0587102_019671
668 Ga0587071_029601
669 Ga0587071_181298
670 Ga0501082_0017897

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00177

Ribosomal_S7

Ribosomal protein S7p/S5e

2

159

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p7u-assembly1.cif.gz_h e. faecalis 70s ribosome with p-trna, state iv 0.968 14 156
8cdv-assembly1.cif.gz_H rnase r bound to a 30s degradation intermediate (state ii) 0.9667 19 129
1x18-assembly1.cif.gz_F contact sites of era gtpase on the thermus thermophilus 30s subunit 0.964 13 158
8cvo-assembly1.cif.gz_I cutibacterium acnes 30s ribosomal subunit with sarecycline bound, head domain only in the local refined map 0.9639 13 158
7nhl-assembly1.cif.gz_h vgaa-lc, an antibiotic resistance abcf, in complex with 70s ribosome from staphylococcus aureus 0.9634 14 154
ID Description Score Start End Superfamily
af_P48940_2_156_1.10.455.10 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 0.9679 15 158 1.10.455.10
2v48G00 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 0.9453 13 158 1.10.455.10
4qcoG00 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 0.945 13 158 1.10.455.10
af_Q95Q11_55_221_1.10.455.10 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 0.9428 18 156 1.10.455.10
5mmjg00 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 0.9275 5 156 1.10.455.10
ID Description Score Start End GO Terms
AF-A0A7V9G4C9-F1-model_v4 Small ribosomal subunit protein uS7 0.9896 12 156 GO:0000049
GO:0003735
GO:0006412
GO:0015935
GO:0019843
AF-A0A4P5Y9S3-F1-model_v4 Small ribosomal subunit protein uS7 0.9876 12 156 GO:0000049
GO:0003735
GO:0006412
GO:0015935
GO:0019843
AF-A0A3M1MHX5-F1-model_v4 30S ribosomal protein S7 0.9871 44 158 GO:0003735
GO:0006412
GO:0015935
GO:0019843
AF-A0A7X5F8L5-F1-model_v4 Small ribosomal subunit protein uS7 0.9862 14 156 GO:0000049
GO:0003735
GO:0006412
GO:0015935
GO:0019843
AF-A0A7C4AL77-F1-model_v4 30S ribosomal protein S7 0.9852 23 156 GO:0003735
GO:0006412
GO:0015935
GO:0019843

Map