F412292

General Info

Members Datasets Scaffolds Average Seq Length
335 241 670 354

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10001062|Ga0265338_1000106224
Length 410
Sequence MFHFSRLYFSYSVETVKRLVISMQAFPNKILKINFISLPLYFKNKGHLHMSNNSLIEKLETLVLRYEEAGQQLSDPSVISDSKKFVKLNKEYRELGDVVAAYKEYKNSYDNIQNAKQILAEEKDEELKEMAKMELETLTAGIDEMEQNLKLMLIPADPQDNKNAILEIRGGTGGDEASIFAGELFRMYNRYCEKKGWKVSVNSFSEGTSGGYKEIIAEISGDKVYGTLKYESGVHRVQRVPQTETQGRVHTSAATVAVLPEAEEVDVVLNPNEIRKDTFCSSGPGGQSVNTTYSAIRLTHIPSGIVVSCQDEKSQLKNLDKAMNELRTRLFALEYQKYMDQVASQRKTMVSTGDRSAKIRTYNYPQSRVTDHRINHTMYNLPAVLDGELQETIDKLIMEENAERLRESNI

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
79 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
82 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
83 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
84 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
85 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
86 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
87 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
88 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
125 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
126 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
127 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
130 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
131 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
132 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
133 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
142 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
143 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
144 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
145 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
146 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
147 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
148 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
149 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
152 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
155 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
156 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
157 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
158 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
159 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
160 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
163 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
164 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
165 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
166 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
167 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
168 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
169 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
170 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
171 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
172 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
173 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
174 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
175 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
176 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
177 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
180 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
187 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
188 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
189 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
190 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
191 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
192 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
194 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
195 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
196 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
197 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
201 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
202 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
203 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
204 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
205 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
208 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
209 2643221591 Devosia sp. Root685 Isolate Unclassified
210 2738541283 Pedobacter sp. OK701 Isolate Unclassified
211 2738541284 Pedobacter sp. YR016 Isolate Unclassified
212 2738541302 Pedobacter sp. CF074 Isolate Unclassified
213 2738543023 Pedobacter sp. OK628 Isolate Unclassified
214 2739367651 Pedobacter sp. OK291 Isolate Unclassified
215 2739367656 Pedobacter sp. CF523 Isolate Unclassified
216 2739367663 Pedobacter sp. YR510 Isolate Unclassified
217 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
218 2818991437 Pedobacter terrae 518 Isolate Unclassified
219 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
220 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
221 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
222 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
223 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
224 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
225 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
226 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
227 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
228 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
229 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
230 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
231 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
232 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
233 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
234 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
235 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
236 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
237 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
238 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
239 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
240 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
241 8007371054 Clostridium sp. YIM B02515 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.25
Metatranscriptomes 0.3
Isolates 10.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.85
Nodule 0
Rhizoplane 2.39
Rhizosphere 74.33
Stem 0
Stem Tuber 0
Unclassified 0.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10001062 3300028800 Bacteria 45690
2 SwRhRL2b_contig_242397 2162886007 Bacteria 1331
3 JGI24737J22298_10005409 3300001990 Bacteria 4412
4 JGI24751J29686_10000006 3300002459 Bacteria 134556
5 JGI25162J39368_1000086 3300002737 Bacteria 107401
6 JGI25162J39368_1000306 3300002737 Bacteria 44891
7 JGI25164J39214_1001145 3300002772 Bacteria 7477
8 JGI25150J39212_1000004 3300002774 Bacteria 417320
9 JGI25151J46595_10000002 3300003187 Bacteria 731381
10 JGI25165J46597_1002410 3300003214 Bacteria 6106
11 JGI25153J46596_10000037 3300003215 Bacteria 182199
12 rootH2_10013803 3300003320 Bacteria 16827
13 rootL2_10176074 3300003322 Bacteria 4860
14 rootH1_10011684 3300003323 Bacteria 42276
15 rootH1_10036694 3300003323 Bacteria 8776
16 Ga0055536_1000967 3300003781 Bacteria 18351
17 Ga0055530_10003131 3300003791 Bacteria 9769
18 Ga0058863_11146743 3300004799 Bacteria 1892
19 Ga0065165_1000176 3300005262 Bacteria 113592
20 Ga0065714_10007480 3300005288 Bacteria 3950
21 Ga0065714_10038421 3300005288 Bacteria 1732
22 Ga0065704_10003075 3300005289 Bacteria 5909
23 Ga0065704_10137799 3300005289 Bacteria 1551
24 Ga0065712_10072461 3300005290 Bacteria 4746
25 Ga0065715_10032378 3300005293 Bacteria 1620
26 Ga0065715_10089640 3300005293 Bacteria 9112
27 Ga0065707_10130476 3300005295 Bacteria 1929
28 Ga0070670_100007756 3300005331 Bacteria 9130
29 Ga0070670_100168563 3300005331 Bacteria 1899
30 Ga0068869_100019749 3300005334 Bacteria 4611
31 Ga0068869_100096253 3300005334 Unclassified 2234
32 Ga0070689_100040889 3300005340 Bacteria 3556
33 Ga0070674_100153604 3300005356 Bacteria 1739
34 Ga0070673_100192320 3300005364 Bacteria 1753
35 Ga0070659_100000610 3300005366 Bacteria 26229
36 Ga0070667_100040904 3300005367 Bacteria 3888
37 Ga0070681_10002600 3300005458 Bacteria 16566
38 Ga0070706_100119430 3300005467 Bacteria 2457
39 Ga0070699_100035476 3300005518 Bacteria 4311
40 Ga0070679_100001407 3300005530 Bacteria 21245
41 Ga0070679_100020039 3300005530 Bacteria 6517
42 Ga0068853_100050838 3300005539 Bacteria 3566
43 Ga0068853_100065519 3300005539 Bacteria 3152
44 Ga0070695_100075597 3300005545 Unclassified 2216
45 Ga0070695_100136419 3300005545 Bacteria 1696
46 Ga0070693_100102265 3300005547 Unclassified 1748
47 Ga0070693_100111211 3300005547 Bacteria 1685
48 Ga0070665_100231999 3300005548 Bacteria 1846
49 Ga0070704_100045088 3300005549 Bacteria 3067
50 Ga0068855_100000489 3300005563 Bacteria 48884
51 Ga0068855_100069972 3300005563 Bacteria 4083
52 Ga0068855_100196148 3300005563 Bacteria 2275
53 Ga0068855_100387282 3300005563 Bacteria 1534
54 Ga0068856_100000533 3300005614 Bacteria 41989
55 Ga0068856_100018609 3300005614 Bacteria 6731
56 Ga0068856_100034416 3300005614 Bacteria 4962
57 Ga0070702_100070672 3300005615 Bacteria 2061
58 Ga0068859_100115291 3300005617 Bacteria 2751
59 Ga0068864_100004529 3300005618 Bacteria 11410
60 Ga0068861_100091081 3300005719 Bacteria 2407
61 Ga0068863_100022836 3300005841 Bacteria 5977
62 Ga0068858_100024795 3300005842 Bacteria 5585
63 Ga0068858_100150300 3300005842 Bacteria 2190
64 Ga0081539_10003877 3300005985 Bacteria 17471
65 Ga0075366_10033421 3300006195 Bacteria 3030
66 Ga0075366_10064754 3300006195 Bacteria 2174
67 Ga0097621_100002401 3300006237 Bacteria 12838
68 Ga0068871_100032023 3300006358 Bacteria 4149
69 Ga0075428_100089683 3300006844 Bacteria 3353
70 Ga0075431_100071240 3300006847 Bacteria 3587
71 Ga0075433_10044891 3300006852 Bacteria 3840
72 Ga0075433_10085114 3300006852 Bacteria 2791
73 Ga0075434_100095604 3300006871 Bacteria 2976
74 Ga0097620_100115289 3300006931 Bacteria 2751
75 Ga0105244_10013278 3300009036 Bacteria 4823
76 Ga0105240_10000277 3300009093 Bacteria 101646
77 Ga0105240_10043973 3300009093 Bacteria 5679
78 Ga0111539_10128813 3300009094 Bacteria 2964
79 Ga0105243_10000043 3300009148 Bacteria 158809
80 Ga0105241_10009709 3300009174 Bacteria 7072
81 Ga0105241_10039771 3300009174 Bacteria 3548
82 Ga0105241_10059232 3300009174 Bacteria 2944
83 Ga0105241_10187255 3300009174 Bacteria 1721
84 Ga0105248_10005056 3300009177 Bacteria 14565
85 Ga0105237_10001071 3300009545 Bacteria 36788
86 Ga0105237_10001295 3300009545 Bacteria 33282
87 Ga0105237_10010452 3300009545 Bacteria 9870
88 Ga0105238_10068818 3300009551 Bacteria 3541
89 Ga0105249_10018373 3300009553 Bacteria 6218
90 Ga0105249_10028790 3300009553 Bacteria 5015
91 Ga0105239_10000004 3300010375 Bacteria 532483
92 Ga0105239_10001541 3300010375 Bacteria 30447
93 Ga0105239_10001835 3300010375 Bacteria 27813
94 Ga0105239_10008426 3300010375 Bacteria 11737
95 Ga0105239_10013458 3300010375 Bacteria 9087
96 Ga0157373_10013676 3300013100 Bacteria 5951
97 Ga0157371_10000151 3300013102 Bacteria 101401
98 Ga0157371_10003369 3300013102 Bacteria 14535
99 Ga0157371_10003875 3300013102 Bacteria 13339
100 Ga0157370_10000227 3300013104 Bacteria 71667
101 Ga0157370_10028643 3300013104 Bacteria 5476
102 Ga0157370_10404210 3300013104 Bacteria 1257
103 Ga0157369_10000050 3300013105 Bacteria 167294
104 Ga0157374_10009323 3300013296 Bacteria 8421
105 Ga0157378_10004272 3300013297 Bacteria 12592
106 Ga0157378_10016648 3300013297 Bacteria 6441
107 Ga0163162_10000569 3300013306 Bacteria 34104
108 Ga0163162_10007466 3300013306 Bacteria 10636
109 Ga0163162_10012552 3300013306 Bacteria 8275
110 Ga0157372_10001084 3300013307 Bacteria 29622
111 Ga0157375_10003749 3300013308 Bacteria 13180
112 Ga0163163_10004417 3300014325 Bacteria 11986
113 Ga0163163_10006864 3300014325 Bacteria 9995
114 Ga0163163_10007544 3300014325 Bacteria 9604
115 Ga0182008_10000020 3300014497 Bacteria 228333
116 Ga0157376_10022908 3300014969 Bacteria 4877
117 Ga0182006_1000242 3300015261 Bacteria 50864
118 Ga0182006_1000310 3300015261 Bacteria 42614
119 Ga0182006_1003745 3300015261 Bacteria 7673
120 Ga0182007_10000008 3300015262 Bacteria 332953
121 Ga0182007_10054470 3300015262 Bacteria 1316
122 Ga0163161_10000235 3300017792 Bacteria 51172
123 Ga0163161_10000323 3300017792 Bacteria 40912
124 Ga0163161_10011803 3300017792 Bacteria 6058
125 Ga0163161_10023893 3300017792 Bacteria 4313
126 Ga0213875_10051008 3300021388 Bacteria 1938
127 Ga0207427_100210 3300025231 Bacteria 53314
128 Ga0209437_100021 3300025233 Bacteria 646400
129 Ga0209437_100144 3300025233 Bacteria 164794
130 Ga0207425_1000003 3300025245 Bacteria 1145342
131 Ga0209026_1000282 3300025250 Bacteria 58460
132 Ga0209026_1001262 3300025250 Bacteria 11541
133 Ga0209026_1009472 3300025250 Bacteria 1910
134 Ga0209129_1000022 3300025258 Bacteria 440876
135 Ga0209233_1000035 3300025261 Bacteria 568478
136 Ga0209455_1001648 3300025272 Bacteria 9709
137 Ga0209676_1000022 3300025292 Bacteria 605659
138 Ga0209676_1001043 3300025292 Bacteria 31974
139 Ga0209025_1000007 3300025294 Bacteria 1145109
140 Ga0209758_1000012 3300025297 Bacteria 949866
141 Ga0209050_1000020 3300025298 Bacteria 605671
142 Ga0207647_10044439 3300025904 Bacteria 2775
143 Ga0207684_10050981 3300025910 Bacteria 3511
144 Ga0207654_10020821 3300025911 Bacteria 3482
145 Ga0207654_10031065 3300025911 Bacteria 2938
146 Ga0207654_10033201 3300025911 Bacteria 2859
147 Ga0207654_10057161 3300025911 Bacteria 2266
148 Ga0207707_10091250 3300025912 Bacteria 2662
149 Ga0207707_10240332 3300025912 Bacteria 1575
150 Ga0207695_10000375 3300025913 Bacteria 101654
151 Ga0207695_10038017 3300025913 Bacteria 5188
152 Ga0207695_10038265 3300025913 Bacteria 5167
153 Ga0207671_10001112 3300025914 Bacteria 32446
154 Ga0207671_10001673 3300025914 Bacteria 25188
155 Ga0207671_10004923 3300025914 Bacteria 12535
156 Ga0207671_10020472 3300025914 Bacteria 5034
157 Ga0207660_10014021 3300025917 Bacteria 5260
158 Ga0207657_10105406 3300025919 Bacteria 2334
159 Ga0207652_10001318 3300025921 Bacteria 22041
160 Ga0207652_10092301 3300025921 Bacteria 2663
161 Ga0207681_10195210 3300025923 Bacteria 1551
162 Ga0207694_10406069 3300025924 Bacteria 1133
163 Ga0207650_10000028 3300025925 Bacteria 236867
164 Ga0207687_10000156 3300025927 Bacteria 45731
165 Ga0207690_10000123 3300025932 Bacteria 64409
166 Ga0207709_10000021 3300025935 Bacteria 386722
167 Ga0207711_10014983 3300025941 Bacteria 6440
168 Ga0207689_10098437 3300025942 Bacteria 2403
169 Ga0207661_10079208 3300025944 Bacteria 2708
170 Ga0207667_10000341 3300025949 Bacteria 63843
171 Ga0207667_10000408 3300025949 Bacteria 58389
172 Ga0207667_10132716 3300025949 Bacteria 2565
173 Ga0207667_10317220 3300025949 Bacteria 1592
174 Ga0207651_10192124 3300025960 Bacteria 1629
175 Ga0207712_10109574 3300025961 Bacteria 2068
176 Ga0207712_10177754 3300025961 Bacteria 1669
177 Ga0207703_10108853 3300026035 Bacteria 2361
178 Ga0207639_10125835 3300026041 Bacteria 2114
179 Ga0207639_10227554 3300026041 Bacteria 1614
180 Ga0207708_10005351 3300026075 Bacteria 9454
181 Ga0207702_10000042 3300026078 Bacteria 150673
182 Ga0207702_10008393 3300026078 Bacteria 8716
183 Ga0207702_10021592 3300026078 Bacteria 5331
184 Ga0207641_10005416 3300026088 Bacteria 10899
185 Ga0207641_10300029 3300026088 Bacteria 1517
186 Ga0207648_10245563 3300026089 Bacteria 1595
187 Ga0207675_100132676 3300026118 Bacteria 2362
188 Ga0207698_10305213 3300026142 Bacteria 1484
189 Ga0268266_10176959 3300028379 Bacteria 1940
190 Ga0268264_10003455 3300028381 Bacteria 13625
191 Ga0307515_10004163 3300028794 Bacteria 30110
192 Ga0307515_10010259 3300028794 Bacteria 17987
193 Ga0307515_10013552 3300028794 Bacteria 15220
194 Ga0307515_10142921 3300028794 Bacteria 2555
195 Ga0265327_10005308 3300031251 Bacteria 10809
196 Ga0307513_10012728 3300031456 Bacteria 10359
197 Ga0307509_10008760 3300031507 Bacteria 12794
198 Ga0307509_10106287 3300031507 Bacteria 2826
199 Ga0307408_100000560 3300031548 Bacteria 32128
200 Ga0307408_100003368 3300031548 Bacteria 10965
201 Ga0307508_10023171 3300031616 Bacteria 5639
202 Ga0316579_10048201 3300031691 Bacteria 1990
203 Ga0316576_10062535 3300031727 Bacteria 2730
204 Ga0316578_10073873 3300031728 Bacteria 2021
205 Ga0307516_10009848 3300031730 Bacteria 10597
206 Ga0307405_10000017 3300031731 Bacteria 195149
207 Ga0307405_10291997 3300031731 Bacteria 1233
208 Ga0307407_10000002 3300031903 Bacteria 323084
209 Ga0307412_10001166 3300031911 Bacteria 15044
210 Ga0307412_10152601 3300031911 Bacteria 1706
211 Ga0307409_100062617 3300031995 Bacteria 2913
212 Ga0307409_100086323 3300031995 Bacteria 2554
213 Ga0307416_100000005 3300032002 Bacteria 477728
214 Ga0307414_10000040 3300032004 Bacteria 148876
215 Ga0307414_10030457 3300032004 Bacteria 3525
216 Ga0307411_10006369 3300032005 Bacteria 5903
217 Ga0307507_10000313 3300033179 Bacteria 97672
218 Ga0307507_10112188 3300033179 Bacteria 2222
219 Ga0373934_0001267 3300035086 Bacteria 9199
220 Ga0373949_0000019 3300035090 Bacteria 58927
221 Ga0373953_0002584 3300035117 Bacteria 5478
222 Ga0373957_0000896 3300035120 Bacteria 7798
223 Ga0373942_0010597 3300035207 Bacteria 2171
224 Ga0373961_0000055 3300035241 Bacteria 65341
225 Ga0316574_0002637 3300035398 Bacteria 9050
226 Ga0316574_0027762 3300035398 Bacteria 3411
227 Ga0373933_0000455 3300035724 Bacteria 25629
228 Ga0373937_0004388 3300036401 Bacteria 11985
229 Ga0316582_0092477 3300036647 Bacteria 1993
230 Ga0316584_0003639 3300036712 Bacteria 10086
231 Ga0395899_0000027 3300037312 Bacteria 337387
232 Ga0436364_1085923 3300037853 Bacteria 7578
233 Ga0242422_00044 3300038699 Bacteria 5053
234 Ga0242420_001945 3300038996 Bacteria 2867
235 Ga0436363_1164305 3300039450 Bacteria 2781
236 Ga0451795_1437322 3300041456 Bacteria 4119
237 Ga0453683_0262312 3300044673 Bacteria 1102
238 Ga0453684_0007474 3300044712 Bacteria 20062
239 Ga0453684_0086197 3300044712 Bacteria 3898
240 Ga0453684_0090574 3300044712 Bacteria 3779
241 Ga0453684_0158242 3300044712 Bacteria 2682
242 Ga0453684_0654876 3300044712 Bacteria 1146
243 Ga0451576_0017598 3300045051 Bacteria 7854
244 Ga0451576_0025167 3300045051 Bacteria 6416
245 Ga0451576_0052154 3300045051 Bacteria 4287
246 Ga0451576_0170252 3300045051 Bacteria 2273
247 Ga0451576_0315151 3300045051 Bacteria 1637
248 Ga0495627_036275 3300046453 Bacteria 1533
249 Ga0495638_0036640 3300046460 Bacteria 3124
250 Ga0495650_0077693 3300046471 Bacteria 1287
251 Ga0495585_0000477 3300046492 Bacteria 38276
252 Ga0495607_0128962 3300046501 Bacteria 1319
253 Ga0495606_0006345 3300046507 Bacteria 10940
254 Ga0495606_0014752 3300046507 Bacteria 6071
255 Ga0495606_0026698 3300046507 Bacteria 4111
256 Ga0495610_0000048 3300046512 Bacteria 150249
257 Ga0495648_0024943 3300046524 Bacteria 4058
258 Ga0495587_0003446 3300046536 Bacteria 10547
259 Ga0495633_0000295 3300046558 Bacteria 56870
260 Ga0495668_0000121 3300046616 Bacteria 116234
261 Ga0495625_0000316 3300046660 Bacteria 73939
262 Ga0495661_0003468 3300046665 Bacteria 11639
263 Ga0495661_0018046 3300046665 Bacteria 4647
264 Ga0495623_0005574 3300046679 Bacteria 8219
265 Ga0495604_0001995 3300047317 Bacteria 16484
266 Ga0495680_0318928 3300047322 Bacteria 1088
267 Ga0495684_0108635 3300047471 Bacteria 2095
268 Ga0495686_0000306 3300047472 Bacteria 83341
269 Ga0495602_0012995 3300048088 Bacteria 8522
270 Ga0496102_0128393 3300048905 Bacteria 2371
271 Ga0496104_0014821 3300048907 Bacteria 7045
272 Ga0496106_0042200 3300048909 Bacteria 3421
273 Ga0496106_0147618 3300048909 Bacteria 1853
274 Ga0496108_0084557 3300048911 Bacteria 2693
275 Ga0496108_0252574 3300048911 Bacteria 1534
276 Ga0496112_0361218 3300048915 Bacteria 1394
277 Ga0496116_0002134 3300048919 Bacteria 21041
278 Ga0496116_0007404 3300048919 Bacteria 9745
279 Ga0496117_0008971 3300048920 Bacteria 9412
280 Ga0496122_0008567 3300048925 Bacteria 10995
281 Ga0496123_0008661 3300048926 Bacteria 9299
282 Ga0496124_0231005 3300048927 Bacteria 1383
283 Ga0496125_0003031 3300048928 Bacteria 21013
284 Ga0501031_0026967 3300049568 Bacteria 3745
285 Ga0501075_0037157 3300049591 Bacteria 3637
286 Ga0501225_0008824 3300049705 Bacteria 2886
287 Ga0501241_003407 3300049758 Bacteria 3000
288 nmdc:mga0k408_275_c2 3300050493 Bacteria 24277
289 nmdc:mga07m45_11723_c1 3300050496 Bacteria 4612
290 nmdc:mga0n895_248385_c1 3300050512 Bacteria 1806
291 nmdc:mga0a205_151597_c1 3300050515 Bacteria 2217
292 nmdc:mga0a205_32359_c1 3300050515 Bacteria 5015
293 Ga0500635_0002241 3300053080 Bacteria 4759
294 Ga0500651_0009393 3300053093 Bacteria 5807
295 Ga0500608_054478 3300053122 Bacteria 1919
296 Ga0500618_000033 3300053125 Bacteria 121886
297 Ga0500568_0016890 3300053139 Bacteria 3232
298 Ga0500568_0022776 3300053139 Bacteria 2673
299 Ga0500616_0045963 3300053153 Bacteria 2323
300 Ga0501084_0143490 3300054114 Bacteria 2011
301 2522549177 2522125168 Bacteria 7376607
302 2586206856 2585427687 Bacteria 5544917
303 2643966295 2643221591 Bacteria 4397626
304 2738755982 2738541283 Bacteria 7222293
305 2738761359 2738541284 Bacteria 5199923
306 2738856833 2738541302 Bacteria 5944758
307 2739304382 2738543023 Bacteria 6767879
308 2739586849 2739367651 Bacteria 6359826
309 2739615165 2739367656 Bacteria 5152243
310 2739645697 2739367663 Bacteria 5040914
311 2776616029 2775506987 Bacteria 5373360
312 2819547270 2818991437 Bacteria 5805520
313 2842726955 2842722452 Bacteria 6263924
314 2842911036 2842909656 Bacteria 6185908
315 2849283904 2849281842 Bacteria 6065644
316 2852626265 2852623160 Bacteria 4376875
317 2852632231 2852627209 Bacteria 5896285
318 2857627893 2857627736 Bacteria 5625397
319 2884635851 2884634485 Bacteria 3928637
320 2884934716 2884933994 Bacteria 4535041
321 2890740045 2890737413 Bacteria 4269751
322 2898716484 2898713307 Bacteria 4110805
323 2902050411 2902048731 Bacteria 4976191
324 2904447750 2904445276 Bacteria 5310396
325 2904783803 2904780799 Bacteria 5840761
326 2911139733 2911138879 Bacteria 5811561
327 2919181948 2919177583 Bacteria 5641607
328 2919188635 2919186247 Bacteria 6244071
329 2919696626 2919692658 Bacteria 5943958
330 2939667210 2939664404 Bacteria 6364494
331 2945997843 2945997725 Bacteria 6404843
332 2954020325 2954016120 Bacteria 6446024
333 2977234955 2977232053 Bacteria 5485925
334 3003234020 3003233435 Bacteria 4458031
335 8007374242 8007371054 Bacteria 4849201
336 Ga0265338_10001062
337 SwRhRL2b_contig_242397
338 JGI24737J22298_10005409
339 JGI24751J29686_10000006
340 JGI25162J39368_1000086
341 JGI25162J39368_1000306
342 JGI25164J39214_1001145
343 JGI25150J39212_1000004
344 JGI25151J46595_10000002
345 JGI25165J46597_1002410
346 JGI25153J46596_10000037
347 rootH2_10013803
348 rootL2_10176074
349 rootH1_10011684
350 rootH1_10036694
351 Ga0055536_1000967
352 Ga0055530_10003131
353 Ga0058863_11146743
354 Ga0065165_1000176
355 Ga0065714_10007480
356 Ga0065714_10038421
357 Ga0065704_10003075
358 Ga0065704_10137799
359 Ga0065712_10072461
360 Ga0065715_10032378
361 Ga0065715_10089640
362 Ga0065707_10130476
363 Ga0070670_100007756
364 Ga0070670_100168563
365 Ga0068869_100019749
366 Ga0068869_100096253
367 Ga0070689_100040889
368 Ga0070674_100153604
369 Ga0070673_100192320
370 Ga0070659_100000610
371 Ga0070667_100040904
372 Ga0070681_10002600
373 Ga0070706_100119430
374 Ga0070699_100035476
375 Ga0070679_100001407
376 Ga0070679_100020039
377 Ga0068853_100050838
378 Ga0068853_100065519
379 Ga0070695_100075597
380 Ga0070695_100136419
381 Ga0070693_100102265
382 Ga0070693_100111211
383 Ga0070665_100231999
384 Ga0070704_100045088
385 Ga0068855_100000489
386 Ga0068855_100069972
387 Ga0068855_100196148
388 Ga0068855_100387282
389 Ga0068856_100000533
390 Ga0068856_100018609
391 Ga0068856_100034416
392 Ga0070702_100070672
393 Ga0068859_100115291
394 Ga0068864_100004529
395 Ga0068861_100091081
396 Ga0068863_100022836
397 Ga0068858_100024795
398 Ga0068858_100150300
399 Ga0081539_10003877
400 Ga0075366_10033421
401 Ga0075366_10064754
402 Ga0097621_100002401
403 Ga0068871_100032023
404 Ga0075428_100089683
405 Ga0075431_100071240
406 Ga0075433_10044891
407 Ga0075433_10085114
408 Ga0075434_100095604
409 Ga0097620_100115289
410 Ga0105244_10013278
411 Ga0105240_10000277
412 Ga0105240_10043973
413 Ga0111539_10128813
414 Ga0105243_10000043
415 Ga0105241_10009709
416 Ga0105241_10039771
417 Ga0105241_10059232
418 Ga0105241_10187255
419 Ga0105248_10005056
420 Ga0105237_10001071
421 Ga0105237_10001295
422 Ga0105237_10010452
423 Ga0105238_10068818
424 Ga0105249_10018373
425 Ga0105249_10028790
426 Ga0105239_10000004
427 Ga0105239_10001541
428 Ga0105239_10001835
429 Ga0105239_10008426
430 Ga0105239_10013458
431 Ga0157373_10013676
432 Ga0157371_10000151
433 Ga0157371_10003369
434 Ga0157371_10003875
435 Ga0157370_10000227
436 Ga0157370_10028643
437 Ga0157370_10404210
438 Ga0157369_10000050
439 Ga0157374_10009323
440 Ga0157378_10004272
441 Ga0157378_10016648
442 Ga0163162_10000569
443 Ga0163162_10007466
444 Ga0163162_10012552
445 Ga0157372_10001084
446 Ga0157375_10003749
447 Ga0163163_10004417
448 Ga0163163_10006864
449 Ga0163163_10007544
450 Ga0182008_10000020
451 Ga0157376_10022908
452 Ga0182006_1000242
453 Ga0182006_1000310
454 Ga0182006_1003745
455 Ga0182007_10000008
456 Ga0182007_10054470
457 Ga0163161_10000235
458 Ga0163161_10000323
459 Ga0163161_10011803
460 Ga0163161_10023893
461 Ga0213875_10051008
462 Ga0207427_100210
463 Ga0209437_100021
464 Ga0209437_100144
465 Ga0207425_1000003
466 Ga0209026_1000282
467 Ga0209026_1001262
468 Ga0209026_1009472
469 Ga0209129_1000022
470 Ga0209233_1000035
471 Ga0209455_1001648
472 Ga0209676_1000022
473 Ga0209676_1001043
474 Ga0209025_1000007
475 Ga0209758_1000012
476 Ga0209050_1000020
477 Ga0207647_10044439
478 Ga0207684_10050981
479 Ga0207654_10020821
480 Ga0207654_10031065
481 Ga0207654_10033201
482 Ga0207654_10057161
483 Ga0207707_10091250
484 Ga0207707_10240332
485 Ga0207695_10000375
486 Ga0207695_10038017
487 Ga0207695_10038265
488 Ga0207671_10001112
489 Ga0207671_10001673
490 Ga0207671_10004923
491 Ga0207671_10020472
492 Ga0207660_10014021
493 Ga0207657_10105406
494 Ga0207652_10001318
495 Ga0207652_10092301
496 Ga0207681_10195210
497 Ga0207694_10406069
498 Ga0207650_10000028
499 Ga0207687_10000156
500 Ga0207690_10000123
501 Ga0207709_10000021
502 Ga0207711_10014983
503 Ga0207689_10098437
504 Ga0207661_10079208
505 Ga0207667_10000341
506 Ga0207667_10000408
507 Ga0207667_10132716
508 Ga0207667_10317220
509 Ga0207651_10192124
510 Ga0207712_10109574
511 Ga0207712_10177754
512 Ga0207703_10108853
513 Ga0207639_10125835
514 Ga0207639_10227554
515 Ga0207708_10005351
516 Ga0207702_10000042
517 Ga0207702_10008393
518 Ga0207702_10021592
519 Ga0207641_10005416
520 Ga0207641_10300029
521 Ga0207648_10245563
522 Ga0207675_100132676
523 Ga0207698_10305213
524 Ga0268266_10176959
525 Ga0268264_10003455
526 Ga0307515_10004163
527 Ga0307515_10010259
528 Ga0307515_10013552
529 Ga0307515_10142921
530 Ga0265327_10005308
531 Ga0307513_10012728
532 Ga0307509_10008760
533 Ga0307509_10106287
534 Ga0307408_100000560
535 Ga0307408_100003368
536 Ga0307508_10023171
537 Ga0316579_10048201
538 Ga0316576_10062535
539 Ga0316578_10073873
540 Ga0307516_10009848
541 Ga0307405_10000017
542 Ga0307405_10291997
543 Ga0307407_10000002
544 Ga0307412_10001166
545 Ga0307412_10152601
546 Ga0307409_100062617
547 Ga0307409_100086323
548 Ga0307416_100000005
549 Ga0307414_10000040
550 Ga0307414_10030457
551 Ga0307411_10006369
552 Ga0307507_10000313
553 Ga0307507_10112188
554 Ga0373934_0001267
555 Ga0373949_0000019
556 Ga0373953_0002584
557 Ga0373957_0000896
558 Ga0373942_0010597
559 Ga0373961_0000055
560 Ga0316574_0002637
561 Ga0316574_0027762
562 Ga0373933_0000455
563 Ga0373937_0004388
564 Ga0316582_0092477
565 Ga0316584_0003639
566 Ga0395899_0000027
567 Ga0436364_1085923
568 Ga0242422_00044
569 Ga0242420_001945
570 Ga0436363_1164305
571 Ga0451795_1437322
572 Ga0453683_0262312
573 Ga0453684_0007474
574 Ga0453684_0086197
575 Ga0453684_0090574
576 Ga0453684_0158242
577 Ga0453684_0654876
578 Ga0451576_0017598
579 Ga0451576_0025167
580 Ga0451576_0052154
581 Ga0451576_0170252
582 Ga0451576_0315151
583 Ga0495627_036275
584 Ga0495638_0036640
585 Ga0495650_0077693
586 Ga0495585_0000477
587 Ga0495607_0128962
588 Ga0495606_0006345
589 Ga0495606_0014752
590 Ga0495606_0026698
591 Ga0495610_0000048
592 Ga0495648_0024943
593 Ga0495587_0003446
594 Ga0495633_0000295
595 Ga0495668_0000121
596 Ga0495625_0000316
597 Ga0495661_0003468
598 Ga0495661_0018046
599 Ga0495623_0005574
600 Ga0495604_0001995
601 Ga0495680_0318928
602 Ga0495684_0108635
603 Ga0495686_0000306
604 Ga0495602_0012995
605 Ga0496102_0128393
606 Ga0496104_0014821
607 Ga0496106_0042200
608 Ga0496106_0147618
609 Ga0496108_0084557
610 Ga0496108_0252574
611 Ga0496112_0361218
612 Ga0496116_0002134
613 Ga0496116_0007404
614 Ga0496117_0008971
615 Ga0496122_0008567
616 Ga0496123_0008661
617 Ga0496124_0231005
618 Ga0496125_0003031
619 Ga0501031_0026967
620 Ga0501075_0037157
621 Ga0501225_0008824
622 Ga0501241_003407
623 nmdc:mga0k408_275_c2
624 nmdc:mga07m45_11723_c1
625 nmdc:mga0n895_248385_c1
626 nmdc:mga0a205_151597_c1
627 nmdc:mga0a205_32359_c1
628 Ga0500635_0002241
629 Ga0500651_0009393
630 Ga0500608_054478
631 Ga0500618_000033
632 Ga0500568_0016890
633 Ga0500568_0022776
634 Ga0500616_0045963
635 Ga0501084_0143490
636 2522549177
637 2586206856
638 2643966295
639 2738755982
640 2738761359
641 2738856833
642 2739304382
643 2739586849
644 2739615165
645 2739645697
646 2776616029
647 2819547270
648 2842726955
649 2842911036
650 2849283904
651 2852626265
652 2852632231
653 2857627893
654 2884635851
655 2884934716
656 2890740045
657 2898716484
658 2902050411
659 2904447750
660 2904783803
661 2911139733
662 2919181948
663 2919188635
664 2919696626
665 2939667210
666 2945997843
667 2954020325
668 2977234955
669 3003234020
670 8007374242

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03462

PCRF

PCRF domain

62

256

0.99

PF00472

RF-1

RF-1 domain

263

373

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5u4j-assembly1.cif.gz_v structural basis of co-translational quality control by arfa and rf2 bound to ribosome 0.9565 91 189
6boh-assembly2.cif.gz_OC antibiotic blasticidin s and e. coli release factor 1 (containing deletion 302-304) bound to the 70s ribosome 0.9388 87 191
5o2r-assembly1.cif.gz_v cryo-em structure of the proline-rich antimicrobial peptide api137 bound to the terminating ribosome 0.91 91 329
5j30-assembly1.cif.gz_QY thermus thermophilus 70s termination complex containing e. coli rf1 0.9052 87 329
7nqh-assembly1.cif.gz_BL 55s mammalian mitochondrial ribosome with mtrf1a and p-site trnamet 0.9051 91 334
ID Description Score Start End Superfamily
af_Q54RE7_180_291_3.30.70.1660 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9872 88 197 3.30.70.1660
1gqeA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.978 88 327 3.30.70.1660
af_A0A1D6IEG8_11_112_3.30.70.1660 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9741 89 189 3.30.70.1660
2b3tB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9717 88 332 3.30.70.1660
af_P30775_152_262_3.30.70.1660 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9673 89 192 3.30.70.1660
ID Description Score Start End GO Terms
AF-X1A613-F1-model_v4 Peptide chain release factor domain-containing protein 0.9706 85 182 GO:0006415
AF-A0A353RCV6-F1-model_v4 Peptide chain release factor 2 0.9663 85 177 GO:0006415
AF-D8LY84-F1-model_v4 Prokaryotic-type class I peptide chain release factors domain-containing protein 0.945 87 336 GO:0003747
GO:0005737
AF-A0A2M7M5B0-F1-model_v4 Peptide chain release factor 1 0.9394 87 324 GO:0003747
GO:0005737
AF-A0A532EW81-F1-model_v4 PCRF domain-containing protein 0.9389 116 330 GO:0003747
GO:0005737

Map