F412232

General Info

Members Datasets Scaffolds Average Seq Length
335 239 670 163

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10902539|Ga0105249_109025391
Length 186
Sequence MTEFRPSWSHLHGYLKGHQMSVTDTLLENARSYGEAFDKGHLPMPPALHLAVVACMDARLNLYGLLGLREGDAHVIRNAGGVITEDEVRSLVISQRLLGTREIILIHHTDCGMLTFTDDAFKRQIQDEVGIKPPWSAESFPELDEDVRQSIGRILASPFVPVKDSVRGFVFDVATGLLDEVLPAAG

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
3 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
39 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
64 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
104 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
106 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
107 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
108 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
109 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
110 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
119 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
120 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
121 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
122 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
123 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
124 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
125 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
128 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
129 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
130 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
131 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
132 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
133 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
134 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
142 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
143 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
144 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
145 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
146 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
150 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
151 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
152 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
153 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
154 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
158 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
159 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
160 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
161 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
162 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
163 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
164 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
165 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
169 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
170 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
171 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
172 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
173 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
191 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
192 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
199 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
200 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
205 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
206 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
207 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
208 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
214 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
215 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
216 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
217 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
218 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
219 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
220 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
221 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
222 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
223 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
224 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
225 2619618881 Frankia sp. ACN1ag Isolate Unclassified
226 2619619003 Frankia sp. CpI1-P Isolate Nodule
227 2626541554 Frankia sp. AvcI.1 Isolate Nodule
228 2671180195 Frankia sp. CcI49 Isolate Nodule
229 2773857922 Frankia sp. CcI49 Isolate Nodule
230 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
231 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
232 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
233 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
234 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
235 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
236 2920879853 Kocuria salina CV6 Isolate Unclassified
237 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
238 8054920844 Frankia tisae Agncl-8 Isolate Nodule
239 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.63
Metatranscriptomes 0.3
Isolates 5.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.18
Nodule 2.09
Rhizoplane 11.04
Rhizosphere 78.81
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_10902539 3300009553 Bacteria 951
2 Ga0055540_1011522 3300003792 Bacteria 2843
3 Ga0070668_100000264 3300005347 Bacteria 34698
4 Ga0070674_100006933 3300005356 Bacteria 6644
5 Ga0070674_100342516 3300005356 Bacteria 1205
6 Ga0070714_100067117 3300005435 Bacteria 3092
7 Ga0070714_100482953 3300005435 Bacteria 1180
8 Ga0070714_101269275 3300005435 Bacteria 719
9 Ga0070713_100022312 3300005436 Bacteria 4890
10 Ga0070710_10000806 3300005437 Bacteria 15034
11 Ga0070710_10036355 3300005437 Bacteria 2692
12 Ga0070710_10066037 3300005437 Bacteria 2073
13 Ga0070711_100003671 3300005439 Bacteria 8982
14 Ga0070711_100295362 3300005439 Bacteria 1286
15 Ga0070705_100154653 3300005440 Bacteria 1526
16 Ga0070708_100000416 3300005445 Bacteria 31952
17 Ga0070708_100241091 3300005445 Bacteria 1697
18 Ga0070708_101010516 3300005445 Bacteria 780
19 Ga0070663_101076408 3300005455 Bacteria 702
20 Ga0070678_100510518 3300005456 Bacteria 1062
21 Ga0070678_100647175 3300005456 Bacteria 948
22 Ga0070681_10335162 3300005458 Bacteria 1422
23 Ga0070681_11505035 3300005458 Bacteria 598
24 Ga0070685_10074562 3300005466 Bacteria 2019
25 Ga0070706_100000231 3300005467 Bacteria 68414
26 Ga0070706_100043300 3300005467 Bacteria 4160
27 Ga0070706_100980369 3300005467 Bacteria 780
28 Ga0070707_100009772 3300005468 Bacteria 8919
29 Ga0070707_100480011 3300005468 Bacteria 1205
30 Ga0070707_100604809 3300005468 Bacteria 1059
31 Ga0070707_100713815 3300005468 Bacteria 965
32 Ga0070698_100009359 3300005471 Bacteria 10506
33 Ga0070699_100000387 3300005518 Bacteria 42737
34 Ga0070699_100097841 3300005518 Bacteria 2571
35 Ga0070697_100060888 3300005536 Bacteria 3078
36 Ga0070696_100082068 3300005546 Bacteria 2285
37 Ga0070696_100162999 3300005546 Bacteria 1644
38 Ga0070693_100049548 3300005547 Bacteria 2397
39 Ga0070702_100000675 3300005615 Bacteria 12793
40 Ga0068863_100259351 3300005841 Bacteria 1680
41 Ga0068860_100765039 3300005843 Bacteria 978
42 Ga0068862_100854404 3300005844 Bacteria 892
43 Ga0081455_10130108 3300005937 Bacteria 1970
44 Ga0070717_10053527 3300006028 Bacteria 3327
45 Ga0075363_100121588 3300006048 Bacteria 1458
46 Ga0075364_10487427 3300006051 Bacteria 843
47 Ga0070716_100000111 3300006173 Bacteria 32186
48 Ga0070712_100000561 3300006175 Bacteria 21600
49 Ga0070712_100033221 3300006175 Bacteria 3489
50 Ga0097621_100677595 3300006237 Bacteria 948
51 Ga0075428_100042306 3300006844 Bacteria 5009
52 Ga0075430_100077884 3300006846 Bacteria 2779
53 Ga0075431_101385441 3300006847 Bacteria 663
54 Ga0068865_100104194 3300006881 Bacteria 2082
55 Ga0075435_100577077 3300007076 Bacteria 975
56 Ga0075435_101251269 3300007076 Bacteria 650
57 Ga0099794_10222969 3300007265 Bacteria 969
58 Ga0105251_10015748 3300009011 Bacteria 4118
59 Ga0105251_10402069 3300009011 Bacteria 630
60 Ga0111539_11294584 3300009094 Bacteria 846
61 Ga0105245_10047026 3300009098 Bacteria 3857
62 Ga0105245_10076325 3300009098 Bacteria 3053
63 Ga0105245_10212726 3300009098 Bacteria 1862
64 Ga0105247_10000013 3300009101 Bacteria 287863
65 Ga0105247_10730738 3300009101 Bacteria 748
66 Ga0114129_10255236 3300009147 Bacteria 2352
67 Ga0105243_10007981 3300009148 Bacteria 8131
68 Ga0105243_10103381 3300009148 Bacteria 2369
69 Ga0105242_10002484 3300009176 Bacteria 14462
70 Ga0105242_10005555 3300009176 Bacteria 9731
71 Ga0105248_10002880 3300009177 Bacteria 19080
72 Ga0105248_10007260 3300009177 Bacteria 12161
73 Ga0105237_10955697 3300009545 Bacteria 864
74 Ga0105249_10102358 3300009553 Bacteria 2695
75 Ga0105239_11393678 3300010375 Bacteria 809
76 Ga0105246_10078467 3300011119 Bacteria 2345
77 Ga0105246_10660453 3300011119 Bacteria 911
78 Ga0105246_10775793 3300011119 Bacteria 848
79 Ga0157342_1005964 3300012507 Bacteria 1137
80 Ga0157370_10386144 3300013104 Bacteria 1289
81 Ga0157369_10014092 3300013105 Bacteria 9036
82 Ga0157378_10022126 3300013297 Bacteria 5595
83 Ga0163162_10463713 3300013306 Bacteria 1398
84 Ga0157375_10049623 3300013308 Bacteria 4113
85 Ga0157375_10827753 3300013308 Bacteria 1073
86 Ga0163163_10597097 3300014325 Bacteria 1167
87 Ga0157380_10431298 3300014326 Bacteria 1260
88 Ga0157377_10344573 3300014745 Bacteria 998
89 Ga0157379_10000621 3300014968 Bacteria 28649
90 Ga0157379_10329783 3300014968 Bacteria 1394
91 Ga0157376_10138725 3300014969 Bacteria 2179
92 Ga0157376_10516618 3300014969 Bacteria 1176
93 Ga0163161_10073353 3300017792 Bacteria 2508
94 Ga0206354_10405656 3300020081 Bacteria 1004
95 Ga0213875_10028913 3300021388 Bacteria 2628
96 Ga0209051_1024452 3300025303 Bacteria 2483
97 Ga0207713_1053441 3300025735 Bacteria 1591
98 Ga0207653_10002602 3300025885 Bacteria 5730
99 Ga0207692_10004801 3300025898 Bacteria 5373
100 Ga0207692_10047588 3300025898 Bacteria 2154
101 Ga0207692_10163012 3300025898 Bacteria 1286
102 Ga0207692_10525769 3300025898 Bacteria 753
103 Ga0207710_10000030 3300025900 Bacteria 287870
104 Ga0207688_10081825 3300025901 Bacteria 1845
105 Ga0207684_10000010 3300025910 Bacteria 552805
106 Ga0207684_10056468 3300025910 Bacteria 3330
107 Ga0207684_10336421 3300025910 Bacteria 1300
108 Ga0207684_11062916 3300025910 Bacteria 675
109 Ga0207707_10885075 3300025912 Bacteria 739
110 Ga0207707_11269697 3300025912 Bacteria 593
111 Ga0207693_10001129 3300025915 Bacteria 23929
112 Ga0207693_10045642 3300025915 Bacteria 3443
113 Ga0207663_10006396 3300025916 Bacteria 6024
114 Ga0207663_10434341 3300025916 Bacteria 1010
115 Ga0207646_10009668 3300025922 Bacteria 9512
116 Ga0207646_10183367 3300025922 Bacteria 1890
117 Ga0207646_10357681 3300025922 Bacteria 1319
118 Ga0207687_10565947 3300025927 Bacteria 955
119 Ga0207700_10004664 3300025928 Bacteria 8120
120 Ga0207700_10192072 3300025928 Bacteria 1716
121 Ga0207664_10000196 3300025929 Bacteria 45388
122 Ga0207664_10047533 3300025929 Bacteria 3371
123 Ga0207664_10184815 3300025929 Bacteria 1791
124 Ga0207709_10073261 3300025935 Bacteria 2182
125 Ga0207669_10029062 3300025937 Bacteria 3051
126 Ga0207669_10862090 3300025937 Bacteria 754
127 Ga0207704_10130671 3300025938 Bacteria 1738
128 Ga0207665_10001554 3300025939 Bacteria 15460
129 Ga0207711_10000920 3300025941 Bacteria 28367
130 Ga0207689_10646516 3300025942 Bacteria 891
131 Ga0207668_10002021 3300025972 Bacteria 11840
132 Ga0207668_10092435 3300025972 Bacteria 2227
133 Ga0207668_10279359 3300025972 Bacteria 1369
134 Ga0207678_10233899 3300026067 Bacteria 1573
135 Ga0207702_10599150 3300026078 Bacteria 1081
136 Ga0207641_10134593 3300026088 Bacteria 2223
137 Ga0207683_10506760 3300026121 Bacteria 1115
138 Ga0207683_11163781 3300026121 Bacteria 715
139 Ga0207698_10108773 3300026142 Bacteria 2318
140 Ga0209813_10125357 3300027866 Bacteria 898
141 Ga0268265_12224154 3300028380 Bacteria 555
142 Ga0307511_10026319 3300030521 Bacteria 5337
143 Ga0307405_10008346 3300031731 Bacteria 5242
144 Ga0307413_10090344 3300031824 Bacteria 1992
145 Ga0307410_10260798 3300031852 Bacteria 1351
146 Ga0307406_10075296 3300031901 Bacteria 2226
147 Ga0307407_10146997 3300031903 Bacteria 1527
148 Ga0307412_10012288 3300031911 Bacteria 4986
149 Ga0307409_100268593 3300031995 Bacteria 1569
150 Ga0307414_10249135 3300032004 Bacteria 1475
151 Ga0307411_10809687 3300032005 Bacteria 825
152 Ga0307415_100222003 3300032126 Bacteria 1515
153 Ga0373926_0191390 3300035083 Bacteria 786
154 Ga0373923_0077595 3300035111 Bacteria 1436
155 Ga0373936_0152227 3300035113 Bacteria 1003
156 Ga0373953_0046047 3300035117 Bacteria 1750
157 Ga0373955_0042430 3300035172 Bacteria 2442
158 Ga0373924_0055250 3300035410 Bacteria 1652
159 Ga0373927_0120316 3300035695 Bacteria 1714
160 Ga0373927_0147310 3300035695 Bacteria 1541
161 Ga0373933_0070541 3300035724 Bacteria 2126
162 Ga0373947_0346579 3300035725 Bacteria 996
163 Ga0373925_0021602 3300037068 Bacteria 4691
164 Ga0373925_0281079 3300037068 Bacteria 1340
165 Ga0373925_0381050 3300037068 Bacteria 1148
166 Ga0395900_0030027 3300037418 Bacteria 5579
167 Ga0395900_0061597 3300037418 Bacteria 3857
168 Ga0395900_0259708 3300037418 Bacteria 1735
169 Ga0395898_0232684 3300037466 Bacteria 1757
170 Ga0395905_0940046 3300037471 Bacteria 767
171 Ga0436364_0775871 3300037853 Bacteria 1182
172 Ga0395901_0011032 3300038443 Bacteria 9153
173 Ga0395901_0065433 3300038443 Bacteria 3785
174 Ga0395901_0099794 3300038443 Bacteria 3045
175 Ga0436365_0130516 3300039437 Bacteria 2238
176 Ga0436361_0606588 3300039447 Bacteria 681
177 Ga0451853_0911227 3300041512 Bacteria 712
178 Ga0439459_0209323 3300042438 Bacteria 536
179 Ga0451577_0210558 3300042876 Bacteria 1756
180 Ga0466969_0005774 3300044656 Bacteria 6576
181 Ga0466972_0033057 3300044658 Bacteria 2537
182 Ga0466972_0108722 3300044658 Bacteria 1311
183 Ga0466965_0037776 3300044683 Bacteria 2371
184 Ga0466965_0083320 3300044683 Bacteria 1619
185 Ga0466965_0309300 3300044683 Bacteria 859
186 Ga0466966_0612301 3300044684 Bacteria 656
187 Ga0466961_0046889 3300044693 Bacteria 2764
188 Ga0466971_0258203 3300044719 Bacteria 831
189 Ga0466968_0034805 3300044735 Bacteria 2104
190 Ga0466968_0072772 3300044735 Bacteria 1499
191 Ga0466970_0258970 3300044765 Bacteria 976
192 Ga0466970_0291236 3300044765 Bacteria 919
193 Ga0466957_0051293 3300044842 Bacteria 2511
194 Ga0466960_0001328 3300044901 Bacteria 8977
195 Ga0466960_0047342 3300044901 Bacteria 2062
196 Ga0466959_0263436 3300045049 Bacteria 1186
197 Ga0466958_0264532 3300045836 Bacteria 1101
198 Ga0466958_0273514 3300045836 Bacteria 1082
199 Ga0466967_0082902 3300045976 Bacteria 2899
200 Ga0495592_0005898 3300046454 Bacteria 9092
201 Ga0495629_0099915 3300046459 Bacteria 2025
202 Ga0495651_0004493 3300046462 Bacteria 10677
203 Ga0495651_0343660 3300046462 Bacteria 988
204 Ga0495653_0368842 3300046463 Bacteria 919
205 Ga0495582_0124043 3300046473 Bacteria 1457
206 Ga0495639_0035657 3300046475 Bacteria 2226
207 Ga0495664_0084823 3300046477 Bacteria 1901
208 Ga0495664_0186763 3300046477 Bacteria 1256
209 Ga0495664_0256638 3300046477 Bacteria 1057
210 Ga0495596_0016975 3300046500 Bacteria 3020
211 Ga0495608_0231499 3300046511 Bacteria 1156
212 Ga0495616_0028441 3300046513 Bacteria 2960
213 Ga0495620_0060740 3300046515 Bacteria 1575
214 Ga0495628_0023519 3300046516 Bacteria 5056
215 Ga0495630_0005307 3300046517 Bacteria 9096
216 Ga0495631_0024382 3300046518 Bacteria 2793
217 Ga0495644_0003206 3300046523 Bacteria 6462
218 Ga0495652_0007116 3300046529 Bacteria 10321
219 Ga0495652_0605935 3300046529 Bacteria 746
220 Ga0495654_0108926 3300046530 Bacteria 1266
221 Ga0495665_0502879 3300046531 Bacteria 610
222 Ga0495587_0002565 3300046536 Bacteria 12136
223 Ga0495645_0022052 3300046543 Bacteria 4606
224 Ga0495645_0309476 3300046543 Bacteria 1029
225 Ga0495645_0709659 3300046543 Bacteria 610
226 Ga0495667_0006664 3300046559 Bacteria 7839
227 Ga0495667_0286828 3300046559 Bacteria 1044
228 Ga0495656_0066160 3300046615 Bacteria 1591
229 Ga0495635_0411318 3300046663 Bacteria 897
230 Ga0495657_0083186 3300046675 Bacteria 2066
231 Ga0495599_0001323 3300046678 Bacteria 14128
232 Ga0495599_0432835 3300046678 Bacteria 780
233 Ga0495623_0232942 3300046679 Bacteria 1044
234 Ga0495647_0473624 3300046681 Bacteria 581
235 Ga0495658_0154007 3300046683 Bacteria 1414
236 Ga0495624_0108062 3300046690 Bacteria 1711
237 Ga0495589_0079806 3300046794 Bacteria 1592
238 Ga0495674_0052073 3300047319 Bacteria 3605
239 Ga0495680_0002986 3300047322 Bacteria 16893
240 Ga0495680_0677294 3300047322 Bacteria 683
241 Ga0495675_0023484 3300047444 Bacteria 3929
242 Ga0495673_0004547 3300047469 Bacteria 8655
243 Ga0495681_0198093 3300047470 Bacteria 816
244 Ga0495684_0003245 3300047471 Bacteria 12770
245 Ga0495686_0003306 3300047472 Bacteria 14072
246 Ga0495686_0006499 3300047472 Bacteria 8935
247 Ga0495602_0252261 3300048088 Bacteria 1314
248 Ga0496100_0001469 3300048903 Bacteria 11539
249 Ga0496100_0105760 3300048903 Bacteria 1947
250 Ga0496101_0042709 3300048904 Bacteria 3237
251 Ga0496101_0072494 3300048904 Bacteria 2528
252 Ga0496102_0778116 3300048905 Bacteria 880
253 Ga0496103_0262483 3300048906 Bacteria 1111
254 Ga0496104_0005056 3300048907 Bacteria 11504
255 Ga0496104_0017818 3300048907 Bacteria 6476
256 Ga0496104_0299121 3300048907 Bacteria 1521
257 Ga0496105_0001664 3300048908 Bacteria 15828
258 Ga0496105_0004243 3300048908 Bacteria 10777
259 Ga0496105_0329157 3300048908 Bacteria 1223
260 Ga0496105_0554990 3300048908 Bacteria 896
261 Ga0496106_0000640 3300048909 Bacteria 25096
262 Ga0496106_0380033 3300048909 Bacteria 1135
263 Ga0496107_0002152 3300048910 Bacteria 12650
264 Ga0496108_0014676 3300048911 Bacteria 6395
265 Ga0496109_0001181 3300048912 Bacteria 21688
266 Ga0496109_0001340 3300048912 Bacteria 20347
267 Ga0496109_0206771 3300048912 Bacteria 1846
268 Ga0496109_1276004 3300048912 Bacteria 671
269 Ga0496110_0005727 3300048913 Bacteria 9759
270 Ga0496110_1249833 3300048913 Bacteria 652
271 Ga0496111_0001238 3300048914 Bacteria 14284
272 Ga0496111_0423896 3300048914 Bacteria 983
273 Ga0496112_0001773 3300048915 Bacteria 16945
274 Ga0496113_0047176 3300048916 Bacteria 3201
275 Ga0496113_0430773 3300048916 Bacteria 1060
276 Ga0496114_0000911 3300048917 Bacteria 22146
277 Ga0496114_0014784 3300048917 Bacteria 6273
278 Ga0496114_0023149 3300048917 Bacteria 5066
279 Ga0496114_0209245 3300048917 Bacteria 1710
280 Ga0496114_0433322 3300048917 Bacteria 1164
281 Ga0496115_0000929 3300048918 Bacteria 21222
282 Ga0496115_0008791 3300048918 Bacteria 7483
283 Ga0496115_0087971 3300048918 Bacteria 2535
284 Ga0496115_0226907 3300048918 Bacteria 1540
285 Ga0496119_0000169 3300048922 Bacteria 91606
286 Ga0496120_0000325 3300048923 Bacteria 79080
287 Ga0501032_0058519 3300049569 Bacteria 2587
288 Ga0501034_0522177 3300049571 Bacteria 1099
289 Ga0501037_0014150 3300049573 Bacteria 5874
290 Ga0501037_0733343 3300049573 Bacteria 656
291 Ga0501038_0350536 3300049574 Bacteria 1150
292 Ga0501043_0108761 3300049579 Bacteria 2177
293 Ga0501047_0001896 3300049581 Bacteria 20095
294 Ga0501072_0855821 3300049588 Bacteria 711
295 Ga0501073_0592030 3300049589 Bacteria 766
296 Ga0501079_1096953 3300049741 Bacteria 627
297 Ga0501080_0104853 3300049742 Bacteria 2622
298 Ga0501035_0001619 3300049822 Bacteria 22776
299 Ga0501044_0026379 3300049823 Bacteria 6150
300 nmdc:mga03n38_545559_c1 3300050490 Bacteria 655
301 nmdc:mga00v17_864920_c1 3300050491 Bacteria 574
302 nmdc:mga0yw44_27239_c1 3300050492 Bacteria 3272
303 nmdc:mga04h51_145911_c1 3300050495 Bacteria 901
304 nmdc:mga07m45_558070_c1 3300050496 Bacteria 662
305 nmdc:mga05p37_187349_c1 3300050507 Bacteria 2515
306 nmdc:mga0qj67_109629_c1 3300050509 Bacteria 2228
307 nmdc:mga06r32_1419620_c1 3300050510 Bacteria 636
308 nmdc:mga08y16_966134_c1 3300050511 Bacteria 834
309 nmdc:mga08x19_3399_c1 3300050514 Bacteria 9491
310 Ga0495601_0216998 3300053077 Bacteria 1249
311 Ga0495612_0086874 3300053078 Bacteria 1320
312 Ga0500635_0002098 3300053080 Bacteria 4889
313 Ga0495655_0019883 3300053083 Bacteria 1498
314 Ga0495595_0333541 3300053084 Bacteria 764
315 Ga0500556_0000532 3300053104 Bacteria 26053
316 Ga0500562_109272 3300053108 Bacteria 753
317 Ga0500652_000802 3300053131 Bacteria 10534
318 Ga0466962_0085695 3300061719 Bacteria 1508
319 2579858092 2579778521 Bacteria 7624758
320 2586060709 2585427649 Bacteria 9053857
321 2619853309 2619618881 Bacteria 7521104
322 2620353864 2619619003 Bacteria 7619552
323 2626634071 2626541554 Bacteria 7741902
324 2671833213 2671180195 Bacteria 9757215
325 2774851369 2773857922 Bacteria 9757215
326 2897564648 2897561785 Bacteria 3256946
327 2904765848 2904765812 Bacteria 5369154
328 2904773657 2904770941 Bacteria 5580202
329 2908814949 2908811453 Bacteria 5478616
330 2919424257 2919420072 Bacteria 5390363
331 2919437159 2919432681 Bacteria 5390474
332 2920883841 2920879853 Bacteria 4216831
333 8054918897 8054913762 Bacteria 7713009
334 8054925827 8054920844 Bacteria 7068637
335 8055161718 8055157932 Bacteria 6429399
336 Ga0105249_10902539
337 Ga0055540_1011522
338 Ga0070668_100000264
339 Ga0070674_100006933
340 Ga0070674_100342516
341 Ga0070714_100067117
342 Ga0070714_100482953
343 Ga0070714_101269275
344 Ga0070713_100022312
345 Ga0070710_10000806
346 Ga0070710_10036355
347 Ga0070710_10066037
348 Ga0070711_100003671
349 Ga0070711_100295362
350 Ga0070705_100154653
351 Ga0070708_100000416
352 Ga0070708_100241091
353 Ga0070708_101010516
354 Ga0070663_101076408
355 Ga0070678_100510518
356 Ga0070678_100647175
357 Ga0070681_10335162
358 Ga0070681_11505035
359 Ga0070685_10074562
360 Ga0070706_100000231
361 Ga0070706_100043300
362 Ga0070706_100980369
363 Ga0070707_100009772
364 Ga0070707_100480011
365 Ga0070707_100604809
366 Ga0070707_100713815
367 Ga0070698_100009359
368 Ga0070699_100000387
369 Ga0070699_100097841
370 Ga0070697_100060888
371 Ga0070696_100082068
372 Ga0070696_100162999
373 Ga0070693_100049548
374 Ga0070702_100000675
375 Ga0068863_100259351
376 Ga0068860_100765039
377 Ga0068862_100854404
378 Ga0081455_10130108
379 Ga0070717_10053527
380 Ga0075363_100121588
381 Ga0075364_10487427
382 Ga0070716_100000111
383 Ga0070712_100000561
384 Ga0070712_100033221
385 Ga0097621_100677595
386 Ga0075428_100042306
387 Ga0075430_100077884
388 Ga0075431_101385441
389 Ga0068865_100104194
390 Ga0075435_100577077
391 Ga0075435_101251269
392 Ga0099794_10222969
393 Ga0105251_10015748
394 Ga0105251_10402069
395 Ga0111539_11294584
396 Ga0105245_10047026
397 Ga0105245_10076325
398 Ga0105245_10212726
399 Ga0105247_10000013
400 Ga0105247_10730738
401 Ga0114129_10255236
402 Ga0105243_10007981
403 Ga0105243_10103381
404 Ga0105242_10002484
405 Ga0105242_10005555
406 Ga0105248_10002880
407 Ga0105248_10007260
408 Ga0105237_10955697
409 Ga0105249_10102358
410 Ga0105239_11393678
411 Ga0105246_10078467
412 Ga0105246_10660453
413 Ga0105246_10775793
414 Ga0157342_1005964
415 Ga0157370_10386144
416 Ga0157369_10014092
417 Ga0157378_10022126
418 Ga0163162_10463713
419 Ga0157375_10049623
420 Ga0157375_10827753
421 Ga0163163_10597097
422 Ga0157380_10431298
423 Ga0157377_10344573
424 Ga0157379_10000621
425 Ga0157379_10329783
426 Ga0157376_10138725
427 Ga0157376_10516618
428 Ga0163161_10073353
429 Ga0206354_10405656
430 Ga0213875_10028913
431 Ga0209051_1024452
432 Ga0207713_1053441
433 Ga0207653_10002602
434 Ga0207692_10004801
435 Ga0207692_10047588
436 Ga0207692_10163012
437 Ga0207692_10525769
438 Ga0207710_10000030
439 Ga0207688_10081825
440 Ga0207684_10000010
441 Ga0207684_10056468
442 Ga0207684_10336421
443 Ga0207684_11062916
444 Ga0207707_10885075
445 Ga0207707_11269697
446 Ga0207693_10001129
447 Ga0207693_10045642
448 Ga0207663_10006396
449 Ga0207663_10434341
450 Ga0207646_10009668
451 Ga0207646_10183367
452 Ga0207646_10357681
453 Ga0207687_10565947
454 Ga0207700_10004664
455 Ga0207700_10192072
456 Ga0207664_10000196
457 Ga0207664_10047533
458 Ga0207664_10184815
459 Ga0207709_10073261
460 Ga0207669_10029062
461 Ga0207669_10862090
462 Ga0207704_10130671
463 Ga0207665_10001554
464 Ga0207711_10000920
465 Ga0207689_10646516
466 Ga0207668_10002021
467 Ga0207668_10092435
468 Ga0207668_10279359
469 Ga0207678_10233899
470 Ga0207702_10599150
471 Ga0207641_10134593
472 Ga0207683_10506760
473 Ga0207683_11163781
474 Ga0207698_10108773
475 Ga0209813_10125357
476 Ga0268265_12224154
477 Ga0307511_10026319
478 Ga0307405_10008346
479 Ga0307413_10090344
480 Ga0307410_10260798
481 Ga0307406_10075296
482 Ga0307407_10146997
483 Ga0307412_10012288
484 Ga0307409_100268593
485 Ga0307414_10249135
486 Ga0307411_10809687
487 Ga0307415_100222003
488 Ga0373926_0191390
489 Ga0373923_0077595
490 Ga0373936_0152227
491 Ga0373953_0046047
492 Ga0373955_0042430
493 Ga0373924_0055250
494 Ga0373927_0120316
495 Ga0373927_0147310
496 Ga0373933_0070541
497 Ga0373947_0346579
498 Ga0373925_0021602
499 Ga0373925_0281079
500 Ga0373925_0381050
501 Ga0395900_0030027
502 Ga0395900_0061597
503 Ga0395900_0259708
504 Ga0395898_0232684
505 Ga0395905_0940046
506 Ga0436364_0775871
507 Ga0395901_0011032
508 Ga0395901_0065433
509 Ga0395901_0099794
510 Ga0436365_0130516
511 Ga0436361_0606588
512 Ga0451853_0911227
513 Ga0439459_0209323
514 Ga0451577_0210558
515 Ga0466969_0005774
516 Ga0466972_0033057
517 Ga0466972_0108722
518 Ga0466965_0037776
519 Ga0466965_0083320
520 Ga0466965_0309300
521 Ga0466966_0612301
522 Ga0466961_0046889
523 Ga0466971_0258203
524 Ga0466968_0034805
525 Ga0466968_0072772
526 Ga0466970_0258970
527 Ga0466970_0291236
528 Ga0466957_0051293
529 Ga0466960_0001328
530 Ga0466960_0047342
531 Ga0466959_0263436
532 Ga0466958_0264532
533 Ga0466958_0273514
534 Ga0466967_0082902
535 Ga0495592_0005898
536 Ga0495629_0099915
537 Ga0495651_0004493
538 Ga0495651_0343660
539 Ga0495653_0368842
540 Ga0495582_0124043
541 Ga0495639_0035657
542 Ga0495664_0084823
543 Ga0495664_0186763
544 Ga0495664_0256638
545 Ga0495596_0016975
546 Ga0495608_0231499
547 Ga0495616_0028441
548 Ga0495620_0060740
549 Ga0495628_0023519
550 Ga0495630_0005307
551 Ga0495631_0024382
552 Ga0495644_0003206
553 Ga0495652_0007116
554 Ga0495652_0605935
555 Ga0495654_0108926
556 Ga0495665_0502879
557 Ga0495587_0002565
558 Ga0495645_0022052
559 Ga0495645_0309476
560 Ga0495645_0709659
561 Ga0495667_0006664
562 Ga0495667_0286828
563 Ga0495656_0066160
564 Ga0495635_0411318
565 Ga0495657_0083186
566 Ga0495599_0001323
567 Ga0495599_0432835
568 Ga0495623_0232942
569 Ga0495647_0473624
570 Ga0495658_0154007
571 Ga0495624_0108062
572 Ga0495589_0079806
573 Ga0495674_0052073
574 Ga0495680_0002986
575 Ga0495680_0677294
576 Ga0495675_0023484
577 Ga0495673_0004547
578 Ga0495681_0198093
579 Ga0495684_0003245
580 Ga0495686_0003306
581 Ga0495686_0006499
582 Ga0495602_0252261
583 Ga0496100_0001469
584 Ga0496100_0105760
585 Ga0496101_0042709
586 Ga0496101_0072494
587 Ga0496102_0778116
588 Ga0496103_0262483
589 Ga0496104_0005056
590 Ga0496104_0017818
591 Ga0496104_0299121
592 Ga0496105_0001664
593 Ga0496105_0004243
594 Ga0496105_0329157
595 Ga0496105_0554990
596 Ga0496106_0000640
597 Ga0496106_0380033
598 Ga0496107_0002152
599 Ga0496108_0014676
600 Ga0496109_0001181
601 Ga0496109_0001340
602 Ga0496109_0206771
603 Ga0496109_1276004
604 Ga0496110_0005727
605 Ga0496110_1249833
606 Ga0496111_0001238
607 Ga0496111_0423896
608 Ga0496112_0001773
609 Ga0496113_0047176
610 Ga0496113_0430773
611 Ga0496114_0000911
612 Ga0496114_0014784
613 Ga0496114_0023149
614 Ga0496114_0209245
615 Ga0496114_0433322
616 Ga0496115_0000929
617 Ga0496115_0008791
618 Ga0496115_0087971
619 Ga0496115_0226907
620 Ga0496119_0000169
621 Ga0496120_0000325
622 Ga0501032_0058519
623 Ga0501034_0522177
624 Ga0501037_0014150
625 Ga0501037_0733343
626 Ga0501038_0350536
627 Ga0501043_0108761
628 Ga0501047_0001896
629 Ga0501072_0855821
630 Ga0501073_0592030
631 Ga0501079_1096953
632 Ga0501080_0104853
633 Ga0501035_0001619
634 Ga0501044_0026379
635 nmdc:mga03n38_545559_c1
636 nmdc:mga00v17_864920_c1
637 nmdc:mga0yw44_27239_c1
638 nmdc:mga04h51_145911_c1
639 nmdc:mga07m45_558070_c1
640 nmdc:mga05p37_187349_c1
641 nmdc:mga0qj67_109629_c1
642 nmdc:mga06r32_1419620_c1
643 nmdc:mga08y16_966134_c1
644 nmdc:mga08x19_3399_c1
645 Ga0495601_0216998
646 Ga0495612_0086874
647 Ga0500635_0002098
648 Ga0495655_0019883
649 Ga0495595_0333541
650 Ga0500556_0000532
651 Ga0500562_109272
652 Ga0500652_000802
653 Ga0466962_0085695
654 2579858092
655 2586060709
656 2619853309
657 2620353864
658 2626634071
659 2671833213
660 2774851369
661 2897564648
662 2904765848
663 2904773657
664 2908814949
665 2919424257
666 2919437159
667 2920883841
668 8054918897
669 8054925827
670 8055161718

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00484

Pro_CA

Carbonic anhydrase

50

178

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yf5-assembly1.cif.gz_A crystal structure of rv1284 in the presence of polycarpine at acidic ph 0.9727 1 163
3las-assembly1.cif.gz_B crystal structure of carbonic anhydrase from streptococcus mutans to 1.4 angstrom resolution 0.9323 1 162
3las-assembly1.cif.gz_B crystal structure of carbonic anhydrase from streptococcus mutans to 1.4 angstrom resolution 0.9215 1 162
5ztp-assembly1.cif.gz_B carbonic anhydrase from glaciozyma antarctica 0.911 9 162
6jqc-assembly1.cif.gz_B the structural basis of the beta-carbonic anhydrase cafc (wild type) of the filamentous fungus aspergillus fumigatus 0.9108 3 163
ID Description Score Start End Superfamily
1ylkA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9744 1 163 3.40.1050.10
af_Q5A207_1_162_3.40.1050.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9485 1 162 3.40.1050.10
af_Q5A207_1_162_3.40.1050.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9428 1 162 3.40.1050.10
3lasB00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9323 1 162 3.40.1050.10
3lasB00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9215 1 162 3.40.1050.10
ID Description Score Start End GO Terms
AF-A0A2S9G150-F1-model_v4 Carbonate dehydratase 1 87 163 GO:0004089
GO:0008270
AF-A0A654U667-F1-model_v4 Beta-carbonic anhydrase (EC 4.2.1.-, EC 4.2.1.1) 0.9942 68 163 GO:0004089
GO:0008270
AF-X8C1Z8-F1-model_v4 deleted 0.9864 33 148
AF-A0A7L7MHV6-F1-model_v4 Carbonic anhydrase 0.9845 24 162 GO:0004089
GO:0008270
AF-A0A5N0UMF2-F1-model_v4 Carbonic anhydrase 0.982 36 162 GO:0004089
GO:0008270

Map