F412169

General Info

Members Datasets Scaffolds Average Seq Length
335 168 670 147

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10275455|Ga0081455_102754552
Length 146
Sequence MPTVRGCAFPDHLRYDVPNHLWYEPLGDGTARIGMTVVAVALAGEVLAFTPKRVGRRFDAGRSCATIESGKWVGPARAAFAGTVVAVNDALIQRPALANRDPYGQGWMLIARPDDPTALAALPEGAAIASTYEAWMVAEVFAGCDV

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
21 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
24 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
25 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
26 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
30 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
31 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
32 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
42 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
43 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
44 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
45 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
50 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
53 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
54 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
55 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
56 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
57 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
58 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
59 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
60 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
61 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
62 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
65 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
66 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
67 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
68 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
69 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
70 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
71 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
72 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
73 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
74 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
75 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
76 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
77 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
78 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
79 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
80 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
81 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
82 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
83 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
89 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
90 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
91 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
92 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
93 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
94 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
97 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
98 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
99 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
100 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
101 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
102 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
103 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
104 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
105 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
106 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
107 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
108 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
109 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
110 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
111 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
112 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
113 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
114 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
115 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
116 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
117 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
118 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
119 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
120 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
121 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
122 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
123 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
124 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
125 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
126 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
127 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
128 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
129 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
130 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
131 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
132 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
133 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
134 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
135 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
139 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
150 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
151 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
152 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
153 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
154 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
155 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
156 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
157 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
160 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
161 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
162 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
163 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
164 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
165 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
166 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
167 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
168 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.91
Metatranscriptomes 2.09
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.49
Rhizosphere 98.51
Stem 0
Stem Tuber 0
Unclassified 22.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10275455 3300005937 Bacteria 1218
2 Ga0070658_10019157 3300005327 Bacteria 5482
3 Ga0070683_100809369 3300005329 Bacteria 898
4 Ga0070660_100085481 3300005339 Bacteria 2481
5 Ga0070668_100262378 3300005347 Unclassified 1437
6 Ga0070688_101476561 3300005365 Unclassified 553
7 Ga0070659_100126196 3300005366 Bacteria 2076
8 Ga0070659_100304638 3300005366 Bacteria 1329
9 Ga0070709_10198075 3300005434 Bacteria 1421
10 Ga0070710_10669564 3300005437 Bacteria 729
11 Ga0070700_100288200 3300005441 Unclassified 1193
12 Ga0070663_101363080 3300005455 Unclassified 627
13 Ga0070681_10975040 3300005458 Bacteria 767
14 Ga0070698_100025731 3300005471 Bacteria 6130
15 Ga0070699_100793741 3300005518 Unclassified 866
16 Ga0070679_100254915 3300005530 Bacteria 1710
17 Ga0068853_100162974 3300005539 Bacteria 2013
18 Ga0070704_100655083 3300005549 Bacteria 927
19 Ga0068855_100027603 3300005563 Bacteria 6791
20 Ga0070717_10181908 3300006028 Bacteria 1833
21 Ga0075430_100638439 3300006846 Unclassified 878
22 Ga0111539_12175267 3300009094 Unclassified 644
23 Ga0114129_10186112 3300009147 Bacteria 2822
24 Ga0114129_12953102 3300009147 Unclassified 561
25 Ga0105243_12903687 3300009148 Unclassified 520
26 Ga0105241_10879571 3300009174 Bacteria 831
27 Ga0105239_12646240 3300010375 Unclassified 585
28 Ga0157370_10009868 3300013104 Bacteria 10119
29 Ga0157369_10016208 3300013105 Bacteria 8387
30 Ga0157372_10000388 3300013307 Bacteria 48764
31 Ga0157372_11326366 3300013307 Bacteria 830
32 Ga0157380_10120419 3300014326 Bacteria 2222
33 Ga0206354_10706396 3300020081 Bacteria 1032
34 Ga0206353_10067957 3300020082 Bacteria 1292
35 Ga0207692_10614993 3300025898 Bacteria 699
36 Ga0207654_10097130 3300025911 Unclassified 1808
37 Ga0207707_11482406 3300025912 Bacteria 538
38 Ga0207652_10686806 3300025921 Bacteria 914
39 Ga0207690_10281172 3300025932 Bacteria 1296
40 Ga0207690_11709582 3300025932 Unclassified 526
41 Ga0207661_10682522 3300025944 Bacteria 944
42 Ga0207667_10018962 3300025949 Bacteria 7692
43 Ga0207708_10675047 3300026075 Unclassified 881
44 Ga0207698_10001847 3300026142 Bacteria 12367
45 Ga0209969_1002085 3300027360 Bacteria 2757
46 Ga0209969_1005725 3300027360 Bacteria 1749
47 Ga0209967_1007497 3300027364 Bacteria 1493
48 Ga0209967_1009633 3300027364 Bacteria 1341
49 Ga0209981_1016917 3300027378 Bacteria 1027
50 Ga0209981_1025419 3300027378 Unclassified 857
51 Ga0209981_1030320 3300027378 Bacteria 792
52 Ga0210000_1000551 3300027462 Bacteria 5112
53 Ga0210000_1000755 3300027462 Bacteria 4482
54 Ga0209995_1003379 3300027471 Bacteria 2542
55 Ga0209968_1085046 3300027526 Bacteria 571
56 Ga0209999_1016116 3300027543 Bacteria 1360
57 Ga0209970_1016024 3300027614 Bacteria 1249
58 Ga0209983_1003968 3300027665 Bacteria 3125
59 Ga0209971_1012974 3300027682 Bacteria 1975
60 Ga0209998_10014434 3300027717 Bacteria 1649
61 Ga0209974_10000722 3300027876 Bacteria 11301
62 Ga0209974_10001876 3300027876 Bacteria 7685
63 Ga0307408_100520260 3300031548 Bacteria 1045
64 Ga0316575_10077174 3300031665 Bacteria 1342
65 Ga0316576_10024744 3300031727 Bacteria 4196
66 Ga0316576_10111225 3300031727 Unclassified 2053
67 Ga0316576_10141458 3300031727 Bacteria 1812
68 Ga0316576_10197777 3300031727 Unclassified 1514
69 Ga0316576_10459057 3300031727 Bacteria 940
70 Ga0316576_11104136 3300031727 Bacteria 562
71 Ga0316578_10158227 3300031728 Bacteria 1365
72 Ga0316578_10325986 3300031728 Bacteria 916
73 Ga0316578_10502659 3300031728 Unclassified 714
74 Ga0316578_10588722 3300031728 Unclassified 652
75 Ga0307405_11255908 3300031731 Unclassified 643
76 Ga0316577_10189527 3300031733 Bacteria 1162
77 Ga0307412_10730157 3300031911 Bacteria 853
78 Ga0307416_100113819 3300032002 Bacteria 2392
79 Ga0307416_100266912 3300032002 Bacteria 1677
80 Ga0307416_100652573 3300032002 Bacteria 1137
81 Ga0316583_10044992 3300032133 Bacteria 1560
82 Ga0316583_10249249 3300032133 Unclassified 615
83 Ga0316593_10000219 3300032168 Bacteria 9093
84 Ga0316593_10000506 3300032168 Bacteria 7210
85 Ga0316593_10185097 3300032168 Bacteria 766
86 Ga0316596_1005447 3300033541 Bacteria 2908
87 Ga0316596_1118903 3300033541 Bacteria 719
88 Ga0373934_0006008 3300035086 Bacteria 4496
89 Ga0373934_0118099 3300035086 Bacteria 1078
90 Ga0373934_0146814 3300035086 Unclassified 965
91 Ga0373923_0056674 3300035111 Unclassified 1655
92 Ga0373923_0081871 3300035111 Bacteria 1401
93 Ga0373923_0178075 3300035111 Bacteria 976
94 Ga0373945_0214606 3300035116 Unclassified 803
95 Ga0373953_0077309 3300035117 Unclassified 1380
96 Ga0373953_0212236 3300035117 Bacteria 838
97 Ga0373953_0284637 3300035117 Unclassified 720
98 Ga0373954_0134953 3300035118 Bacteria 1202
99 Ga0373956_0008866 3300035119 Bacteria 4075
100 Ga0373956_0071110 3300035119 Bacteria 1588
101 Ga0373956_0100705 3300035119 Bacteria 1340
102 Ga0373956_0326541 3300035119 Unclassified 731
103 Ga0373956_0328800 3300035119 Bacteria 728
104 Ga0373956_0364279 3300035119 Bacteria 689
105 Ga0373957_0010541 3300035120 Bacteria 3060
106 Ga0373957_0055354 3300035120 Unclassified 1525
107 Ga0373957_0056542 3300035120 Bacteria 1511
108 Ga0373957_0363037 3300035120 Unclassified 620
109 Ga0373943_0046926 3300035170 Bacteria 2110
110 Ga0373943_0188030 3300035170 Bacteria 1138
111 Ga0373946_0145445 3300035171 Bacteria 1102
112 Ga0373955_0014006 3300035172 Bacteria 3893
113 Ga0373955_0123768 3300035172 Bacteria 1505
114 Ga0373955_0130809 3300035172 Bacteria 1465
115 Ga0373955_0213119 3300035172 Bacteria 1152
116 Ga0373955_0681608 3300035172 Unclassified 631
117 Ga0316574_0013465 3300035398 Bacteria 4704
118 Ga0316574_0026127 3300035398 Bacteria 3510
119 Ga0316574_0060361 3300035398 Bacteria 2380
120 Ga0316574_0112124 3300035398 Bacteria 1749
121 Ga0316574_0127970 3300035398 Unclassified 1633
122 Ga0316574_0150068 3300035398 Unclassified 1502
123 Ga0316574_0216497 3300035398 Bacteria 1228
124 Ga0316574_0260416 3300035398 Unclassified 1107
125 Ga0316574_0332319 3300035398 Unclassified 963
126 Ga0316574_0492420 3300035398 Unclassified 765
127 Ga0316574_0500624 3300035398 Unclassified 758
128 Ga0316574_0575314 3300035398 Bacteria 697
129 Ga0373924_0054962 3300035410 Bacteria 1656
130 Ga0373924_0550645 3300035410 Unclassified 519
131 Ga0373935_0147521 3300035692 Unclassified 1594
132 Ga0373935_0405981 3300035692 Bacteria 979
133 Ga0373927_0004652 3300035695 Bacteria 9568
134 Ga0373927_0081430 3300035695 Bacteria 2098
135 Ga0373927_0162133 3300035695 Bacteria 1465
136 Ga0373933_0007837 3300035724 Bacteria 5834
137 Ga0373933_0060926 3300035724 Bacteria 2276
138 Ga0373933_0069745 3300035724 Unclassified 2137
139 Ga0373933_0075513 3300035724 Bacteria 2057
140 Ga0373933_0102043 3300035724 Bacteria 1781
141 Ga0373947_0075440 3300035725 Bacteria 2076
142 Ga0373947_0316211 3300035725 Unclassified 1043
143 Ga0373937_0000503 3300036401 Bacteria 35778
144 Ga0373937_0011061 3300036401 Bacteria 7911
145 Ga0373937_0073281 3300036401 Bacteria 3159
146 Ga0373937_0092661 3300036401 Bacteria 2800
147 Ga0373937_0105997 3300036401 Bacteria 2613
148 Ga0373937_0305543 3300036401 Bacteria 1504
149 Ga0373937_0434358 3300036401 Bacteria 1246
150 Ga0373937_0842688 3300036401 Unclassified 865
151 Ga0373937_1829857 3300036401 Bacteria 553
152 Ga0316582_0060438 3300036647 Bacteria 2429
153 Ga0316582_0145533 3300036647 Unclassified 1599
154 Ga0316582_0152815 3300036647 Bacteria 1561
155 Ga0316582_1120190 3300036647 Unclassified 536
156 Ga0316584_0005585 3300036712 Bacteria 8466
157 Ga0316584_0015777 3300036712 Bacteria 5408
158 Ga0316584_0027693 3300036712 Bacteria 4173
159 Ga0316584_0229984 3300036712 Bacteria 1360
160 Ga0316584_0263491 3300036712 Bacteria 1256
161 Ga0316584_1074329 3300036712 Unclassified 535
162 Ga0373925_0058546 3300037068 Bacteria 2889
163 Ga0373925_0259701 3300037068 Bacteria 1395
164 Ga0395900_1281999 3300037418 Bacteria 647
165 Ga0395905_0456701 3300037471 Bacteria 1176
166 Ga0316581_0110654 3300037588 Bacteria 846
167 Ga0395901_0720001 3300038443 Bacteria 994
168 Ga0242420_006118 3300038996 Bacteria 1892
169 Ga0439434_0304256 3300042435 Bacteria 552
170 Ga0439435_0019858 3300042436 Bacteria 1727
171 Ga0439435_0099964 3300042436 Bacteria 890
172 Ga0439444_0182313 3300042437 Bacteria 522
173 Ga0439460_0048765 3300042461 Bacteria 1264
174 Ga0451577_0102990 3300042876 Bacteria 2551
175 Ga0451577_0786661 3300042876 Bacteria 860
176 Ga0451577_1157473 3300042876 Unclassified 691
177 Ga0453684_1517332 3300044712 Bacteria 691
178 Ga0451576_0639059 3300045051 Bacteria 1118
179 Ga0495592_0005245 3300046454 Bacteria 9554
180 Ga0495592_0011868 3300046454 Bacteria 6602
181 Ga0495629_0020461 3300046459 Bacteria 4725
182 Ga0495629_0025180 3300046459 Bacteria 4233
183 Ga0495629_0087065 3300046459 Bacteria 2179
184 Ga0495629_0179656 3300046459 Unclassified 1467
185 Ga0495651_0000671 3300046462 Bacteria 26614
186 Ga0495651_0005455 3300046462 Bacteria 9704
187 Ga0495651_0053594 3300046462 Bacteria 3104
188 Ga0495651_0150776 3300046462 Bacteria 1676
189 Ga0495651_0170039 3300046462 Bacteria 1553
190 Ga0495651_0200089 3300046462 Bacteria 1398
191 Ga0495653_0009018 3300046463 Bacteria 8158
192 Ga0495653_0028243 3300046463 Bacteria 4486
193 Ga0495653_0262742 3300046463 Bacteria 1140
194 Ga0495580_0402615 3300046472 Bacteria 923
195 Ga0495582_0335072 3300046473 Bacteria 871
196 Ga0495639_0421395 3300046475 Unclassified 676
197 Ga0495664_0066225 3300046477 Bacteria 2154
198 Ga0495594_0435575 3300046499 Unclassified 745
199 Ga0495608_0002007 3300046511 Bacteria 14576
200 Ga0495608_0005083 3300046511 Bacteria 9398
201 Ga0495608_0334941 3300046511 Unclassified 933
202 Ga0495618_0010714 3300046514 Bacteria 5551
203 Ga0495618_0081407 3300046514 Bacteria 2067
204 Ga0495628_0009753 3300046516 Bacteria 8185
205 Ga0495630_0131862 3300046517 Bacteria 1898
206 Ga0495630_0347805 3300046517 Unclassified 1135
207 Ga0495630_0510551 3300046517 Unclassified 922
208 Ga0495643_0123069 3300046522 Unclassified 1309
209 Ga0495652_0011386 3300046529 Bacteria 8044
210 Ga0495652_0093209 3300046529 Bacteria 2459
211 Ga0495640_0002670 3300046533 Bacteria 14332
212 Ga0495640_0015050 3300046533 Bacteria 5829
213 Ga0495587_0003988 3300046536 Bacteria 9784
214 Ga0495587_0029520 3300046536 Bacteria 3329
215 Ga0495587_0074586 3300046536 Bacteria 1970
216 Ga0495587_0295955 3300046536 Unclassified 906
217 Ga0495645_0116064 3300046543 Unclassified 1890
218 Ga0495645_0283717 3300046543 Bacteria 1088
219 Ga0495645_0537861 3300046543 Bacteria 726
220 Ga0495667_0005968 3300046559 Bacteria 8236
221 Ga0495667_0022252 3300046559 Bacteria 4272
222 Ga0495667_0344405 3300046559 Bacteria 942
223 Ga0495667_0615612 3300046559 Unclassified 676
224 Ga0495634_0032280 3300046642 Bacteria 3602
225 Ga0495634_0049597 3300046642 Bacteria 2822
226 Ga0495635_0023007 3300046663 Bacteria 4344
227 Ga0495635_0225858 3300046663 Bacteria 1265
228 Ga0495635_0355879 3300046663 Unclassified 976
229 Ga0495657_0014994 3300046675 Bacteria 5684
230 Ga0495657_0036966 3300046675 Bacteria 3369
231 Ga0495657_0395625 3300046675 Bacteria 814
232 Ga0495657_0399932 3300046675 Bacteria 808
233 Ga0495599_0008722 3300046678 Bacteria 6174
234 Ga0495599_0052468 3300046678 Bacteria 2555
235 Ga0495599_0336137 3300046678 Unclassified 907
236 Ga0495623_0004481 3300046679 Bacteria 9175
237 Ga0495623_0022513 3300046679 Bacteria 4071
238 Ga0495623_0063586 3300046679 Bacteria 2310
239 Ga0495623_0100560 3300046679 Bacteria 1762
240 Ga0495623_0433653 3300046679 Bacteria 702
241 Ga0495646_0031789 3300046680 Bacteria 3287
242 Ga0495646_0051556 3300046680 Bacteria 2490
243 Ga0495647_0285633 3300046681 Unclassified 741
244 Ga0495658_0027089 3300046683 Bacteria 3080
245 Ga0495658_0080478 3300046683 Bacteria 1911
246 Ga0495613_0027751 3300046689 Bacteria 4214
247 Ga0495613_0077252 3300046689 Bacteria 2423
248 Ga0495613_0285210 3300046689 Unclassified 1146
249 Ga0495624_0159327 3300046690 Bacteria 1379
250 Ga0495624_0331301 3300046690 Unclassified 916
251 Ga0495600_0003979 3300046809 Bacteria 8780
252 Ga0495600_0005251 3300046809 Bacteria 7793
253 Ga0495600_0379924 3300046809 Bacteria 881
254 Ga0495604_0000356 3300047317 Bacteria 40982
255 Ga0495604_0146350 3300047317 Bacteria 1683
256 Ga0495674_0008010 3300047319 Bacteria 10088
257 Ga0495674_0023751 3300047319 Bacteria 5645
258 Ga0495676_0047517 3300047321 Bacteria 3469
259 Ga0495680_0003054 3300047322 Bacteria 16684
260 Ga0495680_0010621 3300047322 Bacteria 8210
261 Ga0495680_0373664 3300047322 Bacteria 989
262 Ga0495680_0616189 3300047322 Bacteria 725
263 Ga0495675_0008233 3300047444 Bacteria 6451
264 Ga0495675_0110576 3300047444 Bacteria 1715
265 Ga0495684_0009887 3300047471 Bacteria 7363
266 Ga0495684_0079772 3300047471 Bacteria 2485
267 Ga0495684_0458013 3300047471 Unclassified 885
268 Ga0495593_0041944 3300047673 Bacteria 2458
269 Ga0495602_0023232 3300048088 Bacteria 6048
270 Ga0495602_0102829 3300048088 Bacteria 2340
271 Ga0495602_0214589 3300048088 Bacteria 1457
272 Ga0495602_0449752 3300048088 Bacteria 909
273 Ga0496106_0280578 3300048909 Bacteria 1335
274 Ga0496107_0226364 3300048910 Bacteria 1391
275 Ga0496110_0495356 3300048913 Bacteria 1113
276 Ga0496112_0660169 3300048915 Bacteria 975
277 Ga0496115_0178902 3300048918 Bacteria 1754
278 Ga0501031_0517787 3300049568 Bacteria 769
279 Ga0501032_0514812 3300049569 Bacteria 764
280 Ga0501034_0257120 3300049571 Bacteria 1690
281 Ga0501034_0407108 3300049571 Bacteria 1283
282 Ga0501036_0101172 3300049572 Bacteria 2438
283 Ga0501039_0600758 3300049575 Bacteria 862
284 Ga0501039_0695395 3300049575 Bacteria 795
285 Ga0501040_0012589 3300049576 Bacteria 5546
286 Ga0501047_0089896 3300049581 Bacteria 2948
287 Ga0501047_1145001 3300049581 Bacteria 591
288 Ga0501048_0354542 3300049582 Bacteria 1046
289 Ga0501067_0161134 3300049583 Bacteria 1249
290 Ga0501070_0585108 3300049586 Bacteria 891
291 Ga0501071_0736158 3300049587 Unclassified 760
292 Ga0501072_0426434 3300049588 Unclassified 1051
293 Ga0501072_0429359 3300049588 Bacteria 1047
294 Ga0501072_0451713 3300049588 Unclassified 1018
295 Ga0501074_0205024 3300049590 Bacteria 1405
296 Ga0501075_0423068 3300049591 Unclassified 1016
297 Ga0501075_0600700 3300049591 Bacteria 839
298 Ga0501075_0778043 3300049591 Bacteria 728
299 Ga0501076_1199357 3300049592 Unclassified 625
300 Ga0501077_0057391 3300049593 Bacteria 2472
301 Ga0501077_0067376 3300049593 Bacteria 2270
302 Ga0501077_0128452 3300049593 Bacteria 1607
303 Ga0501077_0233132 3300049593 Bacteria 1170
304 Ga0501079_0504868 3300049741 Bacteria 951
305 Ga0501079_0588061 3300049741 Unclassified 876
306 Ga0501079_0928689 3300049741 Bacteria 685
307 Ga0501080_0510647 3300049742 Unclassified 1073
308 Ga0501080_0630947 3300049742 Unclassified 949
309 Ga0501081_0075113 3300049743 Bacteria 2359
310 Ga0501044_0205931 3300049823 Bacteria 1924
311 Ga0501045_0047372 3300049824 Bacteria 3131
312 nmdc:mga05p37_173820_c1 3300050507 Bacteria 2625
313 nmdc:mga0qj67_712611_c1 3300050509 Unclassified 798
314 nmdc:mga0qj67_740781_c1 3300050509 Bacteria 780
315 nmdc:mga0rr50_858196_c1 3300050513 Bacteria 774
316 Ga0495601_0003206 3300053077 Bacteria 9361
317 Ga0495601_0036738 3300053077 Bacteria 3060
318 Ga0495601_0069331 3300053077 Bacteria 2249
319 Ga0495601_0188399 3300053077 Unclassified 1349
320 Ga0495612_0022645 3300053078 Bacteria 2517
321 Ga0495612_0038187 3300053078 Bacteria 1951
322 Ga0495612_0168721 3300053078 Unclassified 958
323 Ga0495595_0000238 3300053084 Bacteria 21739
324 Ga0495595_0004786 3300053084 Bacteria 5453
325 Ga0495595_0009673 3300053084 Bacteria 3993
326 Ga0495595_0090485 3300053084 Unclassified 1468
327 Ga0495619_0003415 3300053085 Bacteria 10253
328 Ga0495619_0003667 3300053085 Bacteria 9899
329 Ga0495619_0047396 3300053085 Bacteria 2829
330 Ga0495619_0320830 3300053085 Unclassified 1072
331 Ga0495619_0407239 3300053085 Bacteria 939
332 Ga0501084_0380096 3300054114 Bacteria 1194
333 Ga0501084_0453701 3300054114 Unclassified 1084
334 Ga0501084_0931055 3300054114 Unclassified 731
335 Ga0501082_0106560 3300060353 Bacteria 2425
336 Ga0081455_10275455
337 Ga0070658_10019157
338 Ga0070683_100809369
339 Ga0070660_100085481
340 Ga0070668_100262378
341 Ga0070688_101476561
342 Ga0070659_100126196
343 Ga0070659_100304638
344 Ga0070709_10198075
345 Ga0070710_10669564
346 Ga0070700_100288200
347 Ga0070663_101363080
348 Ga0070681_10975040
349 Ga0070698_100025731
350 Ga0070699_100793741
351 Ga0070679_100254915
352 Ga0068853_100162974
353 Ga0070704_100655083
354 Ga0068855_100027603
355 Ga0070717_10181908
356 Ga0075430_100638439
357 Ga0111539_12175267
358 Ga0114129_10186112
359 Ga0114129_12953102
360 Ga0105243_12903687
361 Ga0105241_10879571
362 Ga0105239_12646240
363 Ga0157370_10009868
364 Ga0157369_10016208
365 Ga0157372_10000388
366 Ga0157372_11326366
367 Ga0157380_10120419
368 Ga0206354_10706396
369 Ga0206353_10067957
370 Ga0207692_10614993
371 Ga0207654_10097130
372 Ga0207707_11482406
373 Ga0207652_10686806
374 Ga0207690_10281172
375 Ga0207690_11709582
376 Ga0207661_10682522
377 Ga0207667_10018962
378 Ga0207708_10675047
379 Ga0207698_10001847
380 Ga0209969_1002085
381 Ga0209969_1005725
382 Ga0209967_1007497
383 Ga0209967_1009633
384 Ga0209981_1016917
385 Ga0209981_1025419
386 Ga0209981_1030320
387 Ga0210000_1000551
388 Ga0210000_1000755
389 Ga0209995_1003379
390 Ga0209968_1085046
391 Ga0209999_1016116
392 Ga0209970_1016024
393 Ga0209983_1003968
394 Ga0209971_1012974
395 Ga0209998_10014434
396 Ga0209974_10000722
397 Ga0209974_10001876
398 Ga0307408_100520260
399 Ga0316575_10077174
400 Ga0316576_10024744
401 Ga0316576_10111225
402 Ga0316576_10141458
403 Ga0316576_10197777
404 Ga0316576_10459057
405 Ga0316576_11104136
406 Ga0316578_10158227
407 Ga0316578_10325986
408 Ga0316578_10502659
409 Ga0316578_10588722
410 Ga0307405_11255908
411 Ga0316577_10189527
412 Ga0307412_10730157
413 Ga0307416_100113819
414 Ga0307416_100266912
415 Ga0307416_100652573
416 Ga0316583_10044992
417 Ga0316583_10249249
418 Ga0316593_10000219
419 Ga0316593_10000506
420 Ga0316593_10185097
421 Ga0316596_1005447
422 Ga0316596_1118903
423 Ga0373934_0006008
424 Ga0373934_0118099
425 Ga0373934_0146814
426 Ga0373923_0056674
427 Ga0373923_0081871
428 Ga0373923_0178075
429 Ga0373945_0214606
430 Ga0373953_0077309
431 Ga0373953_0212236
432 Ga0373953_0284637
433 Ga0373954_0134953
434 Ga0373956_0008866
435 Ga0373956_0071110
436 Ga0373956_0100705
437 Ga0373956_0326541
438 Ga0373956_0328800
439 Ga0373956_0364279
440 Ga0373957_0010541
441 Ga0373957_0055354
442 Ga0373957_0056542
443 Ga0373957_0363037
444 Ga0373943_0046926
445 Ga0373943_0188030
446 Ga0373946_0145445
447 Ga0373955_0014006
448 Ga0373955_0123768
449 Ga0373955_0130809
450 Ga0373955_0213119
451 Ga0373955_0681608
452 Ga0316574_0013465
453 Ga0316574_0026127
454 Ga0316574_0060361
455 Ga0316574_0112124
456 Ga0316574_0127970
457 Ga0316574_0150068
458 Ga0316574_0216497
459 Ga0316574_0260416
460 Ga0316574_0332319
461 Ga0316574_0492420
462 Ga0316574_0500624
463 Ga0316574_0575314
464 Ga0373924_0054962
465 Ga0373924_0550645
466 Ga0373935_0147521
467 Ga0373935_0405981
468 Ga0373927_0004652
469 Ga0373927_0081430
470 Ga0373927_0162133
471 Ga0373933_0007837
472 Ga0373933_0060926
473 Ga0373933_0069745
474 Ga0373933_0075513
475 Ga0373933_0102043
476 Ga0373947_0075440
477 Ga0373947_0316211
478 Ga0373937_0000503
479 Ga0373937_0011061
480 Ga0373937_0073281
481 Ga0373937_0092661
482 Ga0373937_0105997
483 Ga0373937_0305543
484 Ga0373937_0434358
485 Ga0373937_0842688
486 Ga0373937_1829857
487 Ga0316582_0060438
488 Ga0316582_0145533
489 Ga0316582_0152815
490 Ga0316582_1120190
491 Ga0316584_0005585
492 Ga0316584_0015777
493 Ga0316584_0027693
494 Ga0316584_0229984
495 Ga0316584_0263491
496 Ga0316584_1074329
497 Ga0373925_0058546
498 Ga0373925_0259701
499 Ga0395900_1281999
500 Ga0395905_0456701
501 Ga0316581_0110654
502 Ga0395901_0720001
503 Ga0242420_006118
504 Ga0439434_0304256
505 Ga0439435_0019858
506 Ga0439435_0099964
507 Ga0439444_0182313
508 Ga0439460_0048765
509 Ga0451577_0102990
510 Ga0451577_0786661
511 Ga0451577_1157473
512 Ga0453684_1517332
513 Ga0451576_0639059
514 Ga0495592_0005245
515 Ga0495592_0011868
516 Ga0495629_0020461
517 Ga0495629_0025180
518 Ga0495629_0087065
519 Ga0495629_0179656
520 Ga0495651_0000671
521 Ga0495651_0005455
522 Ga0495651_0053594
523 Ga0495651_0150776
524 Ga0495651_0170039
525 Ga0495651_0200089
526 Ga0495653_0009018
527 Ga0495653_0028243
528 Ga0495653_0262742
529 Ga0495580_0402615
530 Ga0495582_0335072
531 Ga0495639_0421395
532 Ga0495664_0066225
533 Ga0495594_0435575
534 Ga0495608_0002007
535 Ga0495608_0005083
536 Ga0495608_0334941
537 Ga0495618_0010714
538 Ga0495618_0081407
539 Ga0495628_0009753
540 Ga0495630_0131862
541 Ga0495630_0347805
542 Ga0495630_0510551
543 Ga0495643_0123069
544 Ga0495652_0011386
545 Ga0495652_0093209
546 Ga0495640_0002670
547 Ga0495640_0015050
548 Ga0495587_0003988
549 Ga0495587_0029520
550 Ga0495587_0074586
551 Ga0495587_0295955
552 Ga0495645_0116064
553 Ga0495645_0283717
554 Ga0495645_0537861
555 Ga0495667_0005968
556 Ga0495667_0022252
557 Ga0495667_0344405
558 Ga0495667_0615612
559 Ga0495634_0032280
560 Ga0495634_0049597
561 Ga0495635_0023007
562 Ga0495635_0225858
563 Ga0495635_0355879
564 Ga0495657_0014994
565 Ga0495657_0036966
566 Ga0495657_0395625
567 Ga0495657_0399932
568 Ga0495599_0008722
569 Ga0495599_0052468
570 Ga0495599_0336137
571 Ga0495623_0004481
572 Ga0495623_0022513
573 Ga0495623_0063586
574 Ga0495623_0100560
575 Ga0495623_0433653
576 Ga0495646_0031789
577 Ga0495646_0051556
578 Ga0495647_0285633
579 Ga0495658_0027089
580 Ga0495658_0080478
581 Ga0495613_0027751
582 Ga0495613_0077252
583 Ga0495613_0285210
584 Ga0495624_0159327
585 Ga0495624_0331301
586 Ga0495600_0003979
587 Ga0495600_0005251
588 Ga0495600_0379924
589 Ga0495604_0000356
590 Ga0495604_0146350
591 Ga0495674_0008010
592 Ga0495674_0023751
593 Ga0495676_0047517
594 Ga0495680_0003054
595 Ga0495680_0010621
596 Ga0495680_0373664
597 Ga0495680_0616189
598 Ga0495675_0008233
599 Ga0495675_0110576
600 Ga0495684_0009887
601 Ga0495684_0079772
602 Ga0495684_0458013
603 Ga0495593_0041944
604 Ga0495602_0023232
605 Ga0495602_0102829
606 Ga0495602_0214589
607 Ga0495602_0449752
608 Ga0496106_0280578
609 Ga0496107_0226364
610 Ga0496110_0495356
611 Ga0496112_0660169
612 Ga0496115_0178902
613 Ga0501031_0517787
614 Ga0501032_0514812
615 Ga0501034_0257120
616 Ga0501034_0407108
617 Ga0501036_0101172
618 Ga0501039_0600758
619 Ga0501039_0695395
620 Ga0501040_0012589
621 Ga0501047_0089896
622 Ga0501047_1145001
623 Ga0501048_0354542
624 Ga0501067_0161134
625 Ga0501070_0585108
626 Ga0501071_0736158
627 Ga0501072_0426434
628 Ga0501072_0429359
629 Ga0501072_0451713
630 Ga0501074_0205024
631 Ga0501075_0423068
632 Ga0501075_0600700
633 Ga0501075_0778043
634 Ga0501076_1199357
635 Ga0501077_0057391
636 Ga0501077_0067376
637 Ga0501077_0128452
638 Ga0501077_0233132
639 Ga0501079_0504868
640 Ga0501079_0588061
641 Ga0501079_0928689
642 Ga0501080_0510647
643 Ga0501080_0630947
644 Ga0501081_0075113
645 Ga0501044_0205931
646 Ga0501045_0047372
647 nmdc:mga05p37_173820_c1
648 nmdc:mga0qj67_712611_c1
649 nmdc:mga0qj67_740781_c1
650 nmdc:mga0rr50_858196_c1
651 Ga0495601_0003206
652 Ga0495601_0036738
653 Ga0495601_0069331
654 Ga0495601_0188399
655 Ga0495612_0022645
656 Ga0495612_0038187
657 Ga0495612_0168721
658 Ga0495595_0000238
659 Ga0495595_0004786
660 Ga0495595_0009673
661 Ga0495595_0090485
662 Ga0495619_0003415
663 Ga0495619_0003667
664 Ga0495619_0047396
665 Ga0495619_0320830
666 Ga0495619_0407239
667 Ga0501084_0380096
668 Ga0501084_0453701
669 Ga0501084_0931055
670 Ga0501082_0106560

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01597

GCV_H

Glycine cleavage H-protein

13

135

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3a7a-assembly1.cif.gz_B crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein 0.9527 8 134
3a8k-assembly1.cif.gz_E crystal structure of etd97n-ehred complex 0.9509 8 134
1htp-assembly1.cif.gz_A refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex 0.9463 8 139
3a8k-assembly1.cif.gz_E crystal structure of etd97n-ehred complex 0.9364 8 134
3mxu-assembly1.cif.gz_A crystal structure of glycine cleavage system protein h from bartonella henselae 0.9331 12 121
ID Description Score Start End Superfamily
af_A4IC11_1_107_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9523 27 113 2.40.50.100
af_Q4E4F5_6_138_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.946 12 114 2.40.50.100
af_Q54JV8_6_144_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9419 13 133 2.40.50.100
af_Q20634_6_139_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.941 13 133 2.40.50.100
af_Q54JU3_2_142_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9381 13 127 2.40.50.100
ID Description Score Start End GO Terms
AF-T1AJ70-F1-model_v4 Glycine cleavage system H protein 0.9991 1 109 GO:0005829
GO:0005960
GO:0019464
AF-A0A4S3KPF8-F1-model_v4 Glycine cleavage system protein H 0.994 1 145 GO:0005829
GO:0005960
GO:0019464
AF-A0A1G3FQE9-F1-model_v4 deleted 0.9862 1 128
AF-A0A0P9CE58-F1-model_v4 Glycine cleavage system H protein 0.9853 1 145 GO:0005829
GO:0005960
GO:0019464
AF-A0A3D2FQR8-F1-model_v4 Glycine cleavage system protein H 0.9842 1 145 GO:0005829
GO:0005960
GO:0019464

Map