F412156

General Info

Members Datasets Scaffolds Average Seq Length
335 170 327 278

Family's Representative Sequence

Representative Sequence 3300005578|Ga0068854_100060467|Ga0068854_1000604673
Length 325
Sequence MQTTEELKDLVREKYSAIALQDKETNQSSCCGSGCCSNEVYNIMTDDYSNLEGYNAEADLGLGCGLPTQFAQIKKGDVVIDLGSGAGNDCFVARAETGETGKVIGIDFTPAMIDKARANAEKLGFNNVEFRQGDIERMPVTAGVADVIVSNCVLNLVPDKEAVFREIFRVLKPGGHFSISDIVLAGELPGKIREAAELYAGCVAGAIQQSSYMGLISAEGFGNVVIQKEKRIVLPDDILSQYLGAEEIAAFRASGAGIYSITVYAEKPKAEACCAPXXXSQTPSSHENRALFGYTCQSSGAGGLLRQSRAAKTRCRLLPGRPGRL

Samples

Sample ID Description Type Environment
1 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
2 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
3 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
4 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
5 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
6 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
7 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
8 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
9 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
10 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
69 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
103 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
104 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
105 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
106 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
107 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
108 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
109 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
110 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
114 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
115 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
122 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
123 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
124 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
125 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
126 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
127 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
128 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
129 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
130 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
131 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
132 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
133 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
134 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
135 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
138 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
139 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
140 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
141 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
142 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
143 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
154 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
155 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
156 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
162 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
163 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
164 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
165 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
166 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
167 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
168 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
169 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
170 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.01
Metatranscriptomes 0.3
Isolates 2.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.58
Nodule 0
Rhizoplane 0
Rhizosphere 91.64
Stem 0
Stem Tuber 0
Unclassified 4.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10030199 3300001979 Bacteria 1768
2 JGI25406J46586_10007860 3300003203 Bacteria 4852
3 rootH1_10056706 3300003316 Bacteria 1165
4 rootH2_10005790 3300003320 Bacteria 74217
5 rootL2_10135777 3300003322 Bacteria 7046
6 rootH1_10020455 3300003316 Bacteria 7263
7 rootH1_10020455 3300003323 Bacteria 13860
8 rootH1_10053784 3300003323 Bacteria 3067
9 rootH1_10086585 3300003323 Bacteria 15734
10 rootH1_10237376 3300003323 Bacteria 3376
11 Ga0070658_10026226 3300005327 Bacteria 4675
12 Ga0070658_10042691 3300005327 Bacteria 3663
13 Ga0070658_10223266 3300005327 Bacteria 1594
14 Ga0070676_10057307 3300005328 Bacteria 2305
15 Ga0070683_100024487 3300005329 Bacteria 5408
16 Ga0070690_100093474 3300005330 Bacteria 1984
17 Ga0068869_100093388 3300005334 Unclassified 2267
18 Ga0070680_100027733 3300005336 Bacteria 4537
19 Ga0070680_100184488 3300005336 Bacteria 1757
20 Ga0070680_100339082 3300005336 Bacteria 1277
21 Ga0070660_100028312 3300005339 Bacteria 4191
22 Ga0070660_100078079 3300005339 Bacteria 2596
23 Ga0070660_100169115 3300005339 Bacteria 1765
24 Ga0070691_10015049 3300005341 Bacteria 3553
25 Ga0070687_100004972 3300005343 Bacteria 5345
26 Ga0070673_100035011 3300005364 Bacteria 3805
27 Ga0070659_100001238 3300005366 Bacteria 18539
28 Ga0070659_100014292 3300005366 Bacteria 5928
29 Ga0070659_100075476 3300005366 Bacteria 2687
30 Ga0070663_100011905 3300005455 Bacteria 5485
31 Ga0070663_100020487 3300005455 Bacteria 4380
32 Ga0070681_10007952 3300005458 Bacteria 10380
33 Ga0070681_10044228 3300005458 Bacteria 4456
34 Ga0070681_10048847 3300005458 Bacteria 4226
35 Ga0070681_10097788 3300005458 Unclassified 2882
36 Ga0070679_100012320 3300005530 Bacteria 8168
37 Ga0070679_100018424 3300005530 Bacteria 6775
38 Ga0070679_100089545 3300005530 Bacteria 3064
39 Ga0070679_100435272 3300005530 Unclassified 1256
40 Ga0070684_100006927 3300005535 Bacteria 8806
41 Ga0070684_100218345 3300005535 Bacteria 1739
42 Ga0068853_100028149 3300005539 Bacteria 4724
43 Ga0068853_100037849 3300005539 Bacteria 4107
44 Ga0068853_100335384 3300005539 Bacteria 1404
45 Ga0070686_100309897 3300005544 Bacteria 1173
46 Ga0070665_100000189 3300005548 Bacteria 109948
47 Ga0068855_100000226 3300005563 Bacteria 72130
48 Ga0068855_100009031 3300005563 Bacteria 12044
49 Ga0068855_100048332 3300005563 Bacteria 5021
50 Ga0068855_100050232 3300005563 Bacteria 4916
51 Ga0068855_100183292 3300005563 Bacteria 2366
52 Ga0068855_100786561 3300005563 Bacteria 1012
53 Ga0068857_100021263 3300005577 Bacteria 5711
54 Ga0068854_100060467 3300005578 Bacteria 2741
55 Ga0068854_100107485 3300005578 Bacteria 2100
56 Ga0068854_100516050 3300005578 Unclassified 1008
57 Ga0068856_100002800 3300005614 Bacteria 17855
58 Ga0068856_100013747 3300005614 Bacteria 7827
59 Ga0068856_100079012 3300005614 Bacteria 3262
60 Ga0068856_100134736 3300005614 Bacteria 2475
61 Ga0070702_100048453 3300005615 Bacteria 2419
62 Ga0068852_100069192 3300005616 Unclassified 3093
63 Ga0068852_100154534 3300005616 Bacteria 2136
64 Ga0068859_100814661 3300005617 Unclassified 1021
65 Ga0068864_100073638 3300005618 Bacteria 2978
66 Ga0068864_100504844 3300005618 Unclassified 1164
67 Ga0068861_100107511 3300005719 Bacteria 2230
68 Ga0068858_100207795 3300005842 Bacteria 1852
69 Ga0068858_100500539 3300005842 Bacteria 1174
70 Ga0068860_100000005 3300005843 Bacteria 472349
71 Ga0068860_100002921 3300005843 Bacteria 17692
72 Ga0068860_100027661 3300005843 Bacteria 5460
73 Ga0081539_10000876 3300005985 Bacteria 57659
74 Ga0097621_100147590 3300006237 Bacteria 2015
75 Ga0068871_100171667 3300006358 Bacteria 1859
76 Ga0097620_100814764 3300006931 Unclassified 1021
77 Ga0105240_10000023 3300009093 Bacteria 385028
78 Ga0105240_10000276 3300009093 Bacteria 101817
79 Ga0105240_10002010 3300009093 Bacteria 33532
80 Ga0105240_10002198 3300009093 Bacteria 31833
81 Ga0105240_10044728 3300009093 Bacteria 5623
82 Ga0105240_10128920 3300009093 Bacteria 3036
83 Ga0105240_10154853 3300009093 Bacteria 2727
84 Ga0111539_10010834 3300009094 Bacteria 11477
85 Ga0105241_10002217 3300009174 Bacteria 14614
86 Ga0105241_10002608 3300009174 Bacteria 13519
87 Ga0105241_10006070 3300009174 Bacteria 8913
88 Ga0105242_10028342 3300009176 Bacteria 4457
89 Ga0105242_10513154 3300009176 Unclassified 1142
90 Ga0105237_10000143 3300009545 Bacteria 101515
91 Ga0105237_10002459 3300009545 Bacteria 22992
92 Ga0105237_10003402 3300009545 Bacteria 18918
93 Ga0105237_10026390 3300009545 Bacteria 5937
94 Ga0105237_10029828 3300009545 Bacteria 5540
95 Ga0105237_10695262 3300009545 Bacteria 1023
96 Ga0105238_10016912 3300009551 Bacteria 7401
97 Ga0105238_10036985 3300009551 Bacteria 4963
98 Ga0105238_10312615 3300009551 Bacteria 1556
99 Ga0105238_10395708 3300009551 Bacteria 1374
100 Ga0105249_10113036 3300009553 Bacteria 2569
101 Ga0105249_10277460 3300009553 Unclassified 1672
102 Ga0105239_10000195 3300010375 Bacteria 88195
103 Ga0105239_10000267 3300010375 Bacteria 77181
104 Ga0105239_10000433 3300010375 Bacteria 61072
105 Ga0105239_10003037 3300010375 Bacteria 20874
106 Ga0105239_10005136 3300010375 Bacteria 15457
107 Ga0105239_10010145 3300010375 Bacteria 10555
108 Ga0105239_10068134 3300010375 Bacteria 3911
109 Ga0157373_10001468 3300013100 Bacteria 18026
110 Ga0157373_10065607 3300013100 Bacteria 2569
111 Ga0157371_10004775 3300013102 Bacteria 11681
112 Ga0157371_10005627 3300013102 Bacteria 10521
113 Ga0157371_10006480 3300013102 Bacteria 9650
114 Ga0157371_10018706 3300013102 Bacteria 5119
115 Ga0157371_10233346 3300013102 Unclassified 1323
116 Ga0157370_10002875 3300013104 Bacteria 20517
117 Ga0157370_10088078 3300013104 Bacteria 2915
118 Ga0157370_10245118 3300013104 Unclassified 1658
119 Ga0157370_10288137 3300013104 Bacteria 1517
120 Ga0157369_10001726 3300013105 Bacteria 26600
121 Ga0157369_10039461 3300013105 Bacteria 5159
122 Ga0157369_10275980 3300013105 Bacteria 1751
123 Ga0157374_10029851 3300013296 Bacteria 4945
124 Ga0157374_10182996 3300013296 Bacteria 2048
125 Ga0157378_10078718 3300013297 Bacteria 2974
126 Ga0163162_10001420 3300013306 Bacteria 22262
127 Ga0163162_10006637 3300013306 Bacteria 11216
128 Ga0163162_10075859 3300013306 Bacteria 3423
129 Ga0163162_10520204 3300013306 Unclassified 1319
130 Ga0163162_10587444 3300013306 Bacteria 1240
131 Ga0163162_10641148 3300013306 Unclassified 1186
132 Ga0163162_10971103 3300013306 Unclassified 960
133 Ga0157372_10000286 3300013307 Bacteria 56140
134 Ga0157372_10007012 3300013307 Bacteria 12004
135 Ga0157372_10019863 3300013307 Bacteria 7240
136 Ga0157372_10020219 3300013307 Bacteria 7179
137 Ga0157372_10046901 3300013307 Unclassified 4798
138 Ga0157372_10060798 3300013307 Bacteria 4227
139 Ga0157372_10153282 3300013307 Bacteria 2661
140 Ga0157372_10291011 3300013307 Bacteria 1900
141 Ga0157372_10696600 3300013307 Bacteria 1182
142 Ga0163163_10001834 3300014325 Bacteria 17938
143 Ga0163163_10113557 3300014325 Bacteria 2739
144 Ga0182008_10056523 3300014497 Bacteria 1939
145 Ga0157377_10035707 3300014745 Bacteria 2729
146 Ga0157376_10662454 3300014969 Unclassified 1045
147 Ga0182007_10017619 3300015262 Unclassified 2604
148 Ga0182007_10021687 3300015262 Bacteria 2277
149 Ga0209258_100234 3300025242 Bacteria 103648
150 Ga0209148_1000234 3300025254 Bacteria 90627
151 Ga0207688_10102854 3300025901 Bacteria 1651
152 Ga0207645_10172103 3300025907 Bacteria 1420
153 Ga0207705_10000028 3300025909 Bacteria 240636
154 Ga0207705_10016642 3300025909 Bacteria 5266
155 Ga0207705_10032752 3300025909 Bacteria 3714
156 Ga0207705_10214371 3300025909 Bacteria 1461
157 Ga0207654_10001489 3300025911 Bacteria 12377
158 Ga0207654_10053127 3300025911 Bacteria 2337
159 Ga0207654_10069601 3300025911 Bacteria 2086
160 Ga0207707_10019673 3300025912 Bacteria 5892
161 Ga0207707_10034681 3300025912 Bacteria 4414
162 Ga0207707_10150766 3300025912 Bacteria 2033
163 Ga0207707_10306956 3300025912 Unclassified 1371
164 Ga0207695_10000016 3300025913 Bacteria 771991
165 Ga0207695_10000183 3300025913 Bacteria 181350
166 Ga0207695_10000645 3300025913 Bacteria 69294
167 Ga0207695_10001186 3300025913 Bacteria 44969
168 Ga0207695_10033140 3300025913 Bacteria 5641
169 Ga0207695_10046630 3300025913 Unclassified 4593
170 Ga0207671_10000968 3300025914 Bacteria 35551
171 Ga0207671_10009918 3300025914 Bacteria 7916
172 Ga0207671_10012172 3300025914 Bacteria 6940
173 Ga0207671_10043401 3300025914 Bacteria 3325
174 Ga0207671_10108665 3300025914 Bacteria 2108
175 Ga0207660_10013397 3300025917 Bacteria 5375
176 Ga0207662_10013013 3300025918 Bacteria 4647
177 Ga0207657_10039235 3300025919 Bacteria 4211
178 Ga0207657_10047382 3300025919 Bacteria 3759
179 Ga0207657_10130471 3300025919 Bacteria 2060
180 Ga0207652_10002727 3300025921 Bacteria 14815
181 Ga0207652_10108913 3300025921 Bacteria 2455
182 Ga0207652_10201667 3300025921 Bacteria 1790
183 Ga0207694_10013767 3300025924 Bacteria 6097
184 Ga0207694_10227431 3300025924 Bacteria 1523
185 Ga0207644_10221948 3300025931 Bacteria 1498
186 Ga0207690_10000943 3300025932 Bacteria 18615
187 Ga0207690_10364605 3300025932 Bacteria 1145
188 Ga0207691_10165280 3300025940 Bacteria 1940
189 Ga0207689_10053493 3300025942 Bacteria 3326
190 Ga0207661_10028570 3300025944 Bacteria 4273
191 Ga0207661_10045002 3300025944 Bacteria 3491
192 Ga0207667_10000039 3300025949 Bacteria 278843
193 Ga0207667_10003030 3300025949 Bacteria 20857
194 Ga0207667_10026916 3300025949 Bacteria 6274
195 Ga0207668_10492974 3300025972 Bacteria 1053
196 Ga0207640_10400959 3300025981 Bacteria 1117
197 Ga0207677_10070738 3300026023 Unclassified 2460
198 Ga0207639_10171435 3300026041 Bacteria 1838
199 Ga0207639_10264070 3300026041 Bacteria 1507
200 Ga0207639_10335144 3300026041 Bacteria 1347
201 Ga0207678_10004778 3300026067 Bacteria 12159
202 Ga0207678_10040879 3300026067 Bacteria 4020
203 Ga0207708_10373405 3300026075 Bacteria 1174
204 Ga0207702_10013769 3300026078 Bacteria 6718
205 Ga0207702_10059282 3300026078 Bacteria 3260
206 Ga0207702_10093792 3300026078 Bacteria 2633
207 Ga0207702_10103012 3300026078 Bacteria 2524
208 Ga0207702_10169685 3300026078 Bacteria 2000
209 Ga0207648_10017157 3300026089 Bacteria 6598
210 Ga0207674_10026166 3300026116 Bacteria 6207
211 Ga0207674_10099864 3300026116 Bacteria 2884
212 Ga0207698_10535497 3300026142 Bacteria 1145
213 Ga0207428_10071036 3300027907 Unclassified 2735
214 Ga0268266_10000180 3300028379 Bacteria 112295
215 Ga0268264_10000012 3300028381 Bacteria 521740
216 Ga0268264_10005051 3300028381 Bacteria 11170
217 Ga0268264_10019504 3300028381 Bacteria 5540
218 Ga0265326_10019548 3300028558 Bacteria 1945
219 Ga0265322_10000194 3300028654 Bacteria 27357
220 Ga0307517_10017476 3300028786 Bacteria 9348
221 Ga0265338_10122514 3300028800 Bacteria 2069
222 Ga0265327_10000452 3300031251 Bacteria 73846
223 Ga0265327_10002929 3300031251 Bacteria 17084
224 Ga0265327_10003081 3300031251 Bacteria 16450
225 Ga0265327_10035519 3300031251 Bacteria 2753
226 Ga0265327_10041643 3300031251 Bacteria 2474
227 Ga0307513_10208962 3300031456 Unclassified 1785
228 Ga0307508_10000926 3300031616 Bacteria 34077
229 Ga0316576_10046101 3300031727 Bacteria 3154
230 Ga0316578_10011406 3300031728 Unclassified 4648
231 Ga0307405_10040053 3300031731 Bacteria 2836
232 Ga0307412_10024756 3300031911 Bacteria 3709
233 Ga0307414_10080650 3300032004 Bacteria 2380
234 Ga0316574_0093436 3300035398 Bacteria 1920
235 Ga0316582_0360286 3300036647 Bacteria 1001
236 Ga0395899_0000434 3300037312 Bacteria 48146
237 Ga0395899_0009943 3300037312 Bacteria 7296
238 Ga0395899_0053701 3300037312 Bacteria 2982
239 Ga0395900_0018116 3300037418 Bacteria 7186
240 Ga0395900_0043955 3300037418 Bacteria 4604
241 Ga0395898_0059145 3300037466 Bacteria 3729
242 Ga0395898_0436515 3300037466 Unclassified 1247
243 Ga0395905_0183036 3300037471 Unclassified 1967
244 Ga0395905_0218449 3300037471 Unclassified 1784
245 Ga0395901_0077500 3300038443 Bacteria 3469
246 Ga0395901_0256363 3300038443 Bacteria 1821
247 Ga0400483_001423 3300039062 Bacteria 2577
248 Ga0400489_16674 3300039093 Bacteria 1424
249 Ga0436361_0672383 3300039447 Bacteria 9246
250 Ga0451837_1487179 3300041494 Bacteria 4085
251 Ga0451577_0000425 3300042876 Bacteria 75871
252 Ga0451577_0046471 3300042876 Bacteria 3884
253 Ga0451577_0126628 3300042876 Bacteria 2289
254 Ga0451577_0337559 3300042876 Unclassified 1367
255 Ga0466969_0014294 3300044656 Bacteria 4174
256 Ga0466972_0011885 3300044658 Bacteria 4373
257 Ga0453683_0064660 3300044673 Bacteria 2287
258 Ga0466966_0003138 3300044684 Bacteria 10876
259 Ga0466966_0111171 3300044684 Bacteria 1689
260 Ga0466961_0054087 3300044693 Bacteria 2561
261 Ga0466964_0231937 3300044706 Bacteria 901
262 Ga0453684_0001108 3300044712 Bacteria 84688
263 Ga0453684_0001159 3300044712 Bacteria 82240
264 Ga0453684_0001781 3300044712 Bacteria 57459
265 Ga0453684_0007351 3300044712 Bacteria 20336
266 Ga0453684_0007675 3300044712 Bacteria 19728
267 Ga0453684_0049711 3300044712 Bacteria 5525
268 Ga0453684_0054284 3300044712 Bacteria 5221
269 Ga0453684_0083666 3300044712 Bacteria 3970
270 Ga0453684_0128799 3300044712 Bacteria 3040
271 Ga0453684_0203772 3300044712 Bacteria 2304
272 Ga0453684_0319175 3300044712 Bacteria 1760
273 Ga0453684_0522962 3300044712 Bacteria 1310
274 Ga0453684_0745349 3300044712 Bacteria 1061
275 Ga0466968_0049949 3300044735 Bacteria 1783
276 Ga0466960_0025091 3300044901 Bacteria 2695
277 Ga0466959_0001248 3300045049 Bacteria 15359
278 Ga0466959_0172271 3300045049 Bacteria 1518
279 Ga0451576_0000002 3300045051 Bacteria 1670975
280 Ga0451576_0000991 3300045051 Bacteria 52576
281 Ga0451576_0070212 3300045051 Bacteria 3646
282 Ga0451576_0211941 3300045051 Bacteria 2023
283 Ga0451576_0574472 3300045051 Bacteria 1184
284 Ga0466958_0196383 3300045836 Bacteria 1283
285 Ga0495648_0001914 3300046524 Bacteria 19837
286 Ga0495611_0101222 3300046648 Unclassified 1338
287 Ga0495672_0012233 3300047320 Bacteria 6001
288 Ga0495687_005139 3300047443 Bacteria 8471
289 Ga0495686_0062033 3300047472 Bacteria 2319
290 Ga0501335_002643 3300049551 Bacteria 1465
291 Ga0501031_0008646 3300049568 Bacteria 6620
292 Ga0501031_0069170 3300049568 Bacteria 2300
293 Ga0501033_0000061 3300049570 Bacteria 103115
294 Ga0501034_0002106 3300049571 Bacteria 24838
295 Ga0501034_0003261 3300049571 Bacteria 18539
296 Ga0501036_0086630 3300049572 Bacteria 2647
297 Ga0501037_0359541 3300049573 Bacteria 1003
298 Ga0501039_0015357 3300049575 Bacteria 5862
299 Ga0501039_0116646 3300049575 Bacteria 2090
300 Ga0501043_0015222 3300049579 Bacteria 6023
301 Ga0501043_0039397 3300049579 Bacteria 3714
302 Ga0501046_0216840 3300049580 Bacteria 1419
303 Ga0501048_0162014 3300049582 Bacteria 1583
304 Ga0501070_0001260 3300049586 Bacteria 22710
305 Ga0501070_0155151 3300049586 Bacteria 1888
306 Ga0501072_0116108 3300049588 Bacteria 2132
307 Ga0501073_0257294 3300049589 Bacteria 1205
308 Ga0501240_003748 3300049673 Bacteria 1721
309 Ga0501080_0082415 3300049742 Bacteria 2988
310 Ga0501080_0250850 3300049742 Bacteria 1614
311 Ga0501035_0003787 3300049822 Bacteria 14412
312 Ga0501044_0003358 3300049823 Bacteria 18047
313 Ga0501044_0100439 3300049823 Bacteria 2911
314 Ga0501044_0304593 3300049823 Bacteria 1521
315 Ga0501044_0437452 3300049823 Bacteria 1216
316 Ga0501045_0000008 3300049824 Bacteria 76934
317 nmdc:mga08y16_453985_c1 3300050511 Bacteria 1307
318 Ga0500644_0000222 3300053088 Bacteria 32776
319 Ga0500646_0017593 3300053090 Unclassified 1876
320 Ga0500583_0001005 3300053092 Bacteria 8013
321 Ga0500583_0032644 3300053092 Bacteria 2298
322 Ga0500651_0121868 3300053093 Unclassified 1583
323 Ga0500589_099300 3300053147 Bacteria 1267
324 Ga0500622_0000686 3300053156 Bacteria 29937
325 Ga0500634_0043398 3300053161 Bacteria 2437
326 Ga0500636_0042452 3300053177 Bacteria 2688
327 Ga0500637_0238801 3300053178 Bacteria 1020

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009176 Ga0105242_10028342 Ga0105242_100283422 236
2 3300009093 Ga0105240_10128920 Ga0105240_101289204 249
3 3300009545 Ga0105237_10026390 Ga0105237_100263907 249
4 3300010375 Ga0105239_10000267 Ga0105239_1000026727 249
5 3300005336 Ga0070680_100027733 Ga0070680_1000277334 257
6 3300003316 rootH1_10056706 rootH1_100567062 259
7 3300005458 Ga0070681_10097788 Ga0070681_100977883 259
8 3300005563 Ga0068855_100786561 Ga0068855_1007865611 259
9 3300009093 Ga0105240_10000023 Ga0105240_1000002384 259
10 3300014325 Ga0163163_10113557 Ga0163163_101135574 259
11 3300025912 Ga0207707_10150766 Ga0207707_101507663 259
12 3300025913 Ga0207695_10000016 Ga0207695_10000016233 259
13 3300044684 Ga0466966_0111171 Ga0466966_0111171_826_1611 259
14 3300013307 Ga0157372_10696600 Ga0157372_106966002 260
15 3300031727 Ga0316576_10046101 Ga0316576_100461012 260
16 3300031728 Ga0316578_10011406 Ga0316578_100114064 260
17 3300013306 Ga0163162_10001420 Ga0163162_1000142011 262
18 3300025972 Ga0207668_10492974 Ga0207668_104929741 262
19 3300042876 Ga0451577_0126628 Ga0451577_0126628_219_1025 262
20 3300044712 Ga0453684_0007675 Ga0453684_0007675_1188_2015 262
21 3300044712 Ga0453684_0049711 Ga0453684_0049711_818_1702 262
22 3300044712 Ga0453684_0054284 Ga0453684_0054284_3944_4750 262
23 3300053178 Ga0500637_0238801 Ga0500637_0238801_102_944 262
24 3300013306 Ga0163162_10075859 Ga0163162_100758593 263
25 3300025944 Ga0207661_10028570 Ga0207661_100285702 263
26 3300044712 Ga0453684_0319175 Ga0453684_0319175_141_983 263
27 3300035398 Ga0316574_0093436 Ga0316574_0093436_37_843 264
28 3300036647 Ga0316582_0360286 Ga0316582_0360286_150_989 264
29 3300039062 Ga0400483_001423 Ga0400483_001423_1755_2555 265
30 3300039093 Ga0400489_16674 Ga0400489_16674_124_930 266
31 3300044712 Ga0453684_0522962 Ga0453684_0522962_174_980 266
32 3300005548 Ga0070665_100000189 Ga0070665_10000018952 267
33 3300028379 Ga0268266_10000180 Ga0268266_1000018045 267
34 3300042876 Ga0451577_0046471 Ga0451577_0046471_702_1508 267
35 3300044712 Ga0453684_0001108 Ga0453684_0001108_50364_51170 267
36 3300044712 Ga0453684_0083666 Ga0453684_0083666_2417_3223 267
37 3300044712 Ga0453684_0745349 Ga0453684_0745349_27_833 267
38 3300045051 Ga0451576_0070212 Ga0451576_0070212_1528_2334 267
39 3300045051 Ga0451576_0211941 Ga0451576_0211941_818_1624 267
40 3300003203 JGI25406J46586_10007860 JGI25406J46586_100078603 268
41 3300005985 Ga0081539_10000876 Ga0081539_1000087640 268
42 3300013306 Ga0163162_10971103 Ga0163162_109711031 268
43 3300028558 Ga0265326_10019548 Ga0265326_100195482 268
44 3300028654 Ga0265322_10000194 Ga0265322_1000019418 268
45 3300044673 Ga0453683_0064660 Ga0453683_0064660_1335_2159 268
46 3300044706 Ga0466964_0231937 Ga0466964_0231937_79_885 268
47 3300044712 Ga0453684_0001781 Ga0453684_0001781_21997_22815 268
48 3300045051 Ga0451576_0000991 Ga0451576_0000991_17114_17932 268
49 3300005330 Ga0070690_100093474 Ga0070690_1000934742 269
50 3300005343 Ga0070687_100004972 Ga0070687_1000049726 269
51 3300005617 Ga0068859_100814661 Ga0068859_1008146612 269
52 3300006931 Ga0097620_100814764 Ga0097620_1008147642 269
53 3300025907 Ga0207645_10172103 Ga0207645_101721032 269
54 3300025918 Ga0207662_10013013 Ga0207662_100130132 269
55 3300026075 Ga0207708_10373405 Ga0207708_103734052 269
56 3300044712 Ga0453684_0128799 Ga0453684_0128799_2181_2999 269
57 3300009551 Ga0105238_10036985 Ga0105238_100369858 270
58 3300031251 Ga0265327_10002929 Ga0265327_100029296 270
59 3300044712 Ga0453684_0001159 Ga0453684_0001159_38540_39361 270
60 3300044712 Ga0453684_0007351 Ga0453684_0007351_8405_9253 270
61 3300044712 Ga0453684_0203772 Ga0453684_0203772_138_959 270
62 3300003323 rootH1_10053784 rootH1_100537843 271
63 3300005334 Ga0068869_100093388 Ga0068869_1000933883 271
64 3300005578 Ga0068854_100516050 Ga0068854_1005160502 271
65 3300006237 Ga0097621_100147590 Ga0097621_1001475901 271
66 3300014745 Ga0157377_10035707 Ga0157377_100357073 271
67 3300025901 Ga0207688_10102854 Ga0207688_101028542 271
68 3300025942 Ga0207689_10053493 Ga0207689_100534934 271
69 3300042876 Ga0451577_0000425 Ga0451577_0000425_19172_20011 271
70 3300005328 Ga0070676_10057307 Ga0070676_100573072 272
71 3300005364 Ga0070673_100035011 Ga0070673_1000350113 272
72 3300005544 Ga0070686_100309897 Ga0070686_1003098972 272
73 3300005615 Ga0070702_100048453 Ga0070702_1000484533 272
74 3300005616 Ga0068852_100069192 Ga0068852_1000691924 272
75 3300006358 Ga0068871_100171667 Ga0068871_1001716672 272
76 3300009176 Ga0105242_10513154 Ga0105242_105131542 272
77 3300013297 Ga0157378_10078718 Ga0157378_100787182 272
78 3300013306 Ga0163162_10641148 Ga0163162_106411482 272
79 3300025931 Ga0207644_10221948 Ga0207644_102219482 272
80 3300025940 Ga0207691_10165280 Ga0207691_101652802 272
81 3300025981 Ga0207640_10400959 Ga0207640_104009592 272
82 3300026089 Ga0207648_10017157 Ga0207648_100171574 272
83 3300026142 Ga0207698_10535497 Ga0207698_105354972 272
84 iso_pu_bacteria 2523533629 2524006996 272
85 3300005458 Ga0070681_10007952 Ga0070681_100079525 273
86 3300005530 Ga0070679_100018424 Ga0070679_1000184245 273
87 3300005563 Ga0068855_100183292 Ga0068855_1001832923 273
88 3300025912 Ga0207707_10019673 Ga0207707_100196736 273
89 3300025921 Ga0207652_10108913 Ga0207652_101089132 273
90 3300026041 Ga0207639_10335144 Ga0207639_103351442 273
91 iso_pu_bacteria 2910245624 2910245980 273
92 iso_pu_bacteria 2910245624 2910251083 273
93 3300013306 Ga0163162_10520204 Ga0163162_105202042 274
94 3300049568 Ga0501031_0008646 Ga0501031_0008646_4737_5606 274
95 3300049572 Ga0501036_0086630 Ga0501036_0086630_780_1649 274
96 3300049575 Ga0501039_0116646 Ga0501039_0116646_369_1238 274
97 3300049582 Ga0501048_0162014 Ga0501048_0162014_474_1343 274
98 3300049822 Ga0501035_0003787 Ga0501035_0003787_9533_10402 274
99 3300049823 Ga0501044_0100439 Ga0501044_0100439_1996_2865 274
100 3300049824 Ga0501045_0000008 Ga0501045_0000008_9688_10557 274
101 iso_pu_bacteria 2818991460 2819679429 274
102 3300047320 Ga0495672_0012233 Ga0495672_0012233_4095_4937 275
103 3300049551 Ga0501335_002643 Ga0501335_002643_351_1193 275
104 iso_pu_bacteria 2919692658 2919696492 275
105 iso_pu_bacteria 2929239360 2929243156 275
106 3300005530 Ga0070679_100012320 Ga0070679_1000123208 276
107 3300031251 Ga0265327_10035519 Ga0265327_100355192 276
108 3300045049 Ga0466959_0001248 Ga0466959_0001248_5791_6627 276
109 iso_pu_bacteria 2849281842 2849282074 276
110 iso_pu_bacteria 2932082852 2932082913 276
111 3300005618 Ga0068864_100073638 Ga0068864_1000736382 277
112 3300014325 Ga0163163_10001834 Ga0163163_1000183419 277
113 3300031251 Ga0265327_10000452 Ga0265327_1000045242 277
114 3300042876 Ga0451577_0337559 Ga0451577_0337559_413_1252 277
115 iso_pu_bacteria 2929921140 2929925829 277
116 3300003322 rootL2_10135777 rootL2_101357773 278
117 3300003323 rootH1_10020455 rootH1_1002045511 278
118 3300003323 rootH1_10086585 rootH1_1008658511 278
119 3300003323 rootH1_10237376 rootH1_102373762 278
120 3300005327 Ga0070658_10026226 Ga0070658_100262263 278
121 3300005327 Ga0070658_10042691 Ga0070658_100426913 278
122 3300005329 Ga0070683_100024487 Ga0070683_1000244871 278
123 3300005336 Ga0070680_100184488 Ga0070680_1001844883 278
124 3300005336 Ga0070680_100339082 Ga0070680_1003390822 278
125 3300005339 Ga0070660_100078079 Ga0070660_1000780793 278
126 3300005339 Ga0070660_100169115 Ga0070660_1001691151 278
127 3300005366 Ga0070659_100014292 Ga0070659_1000142924 278
128 3300005455 Ga0070663_100011905 Ga0070663_1000119053 278
129 3300005458 Ga0070681_10044228 Ga0070681_100442283 278
130 3300005458 Ga0070681_10048847 Ga0070681_100488473 278
131 3300005530 Ga0070679_100089545 Ga0070679_1000895453 278
132 3300005530 Ga0070679_100435272 Ga0070679_1004352722 278
133 3300005535 Ga0070684_100218345 Ga0070684_1002183452 278
134 3300005539 Ga0068853_100028149 Ga0068853_1000281495 278
135 3300005563 Ga0068855_100048332 Ga0068855_1000483326 278
136 3300005563 Ga0068855_100050232 Ga0068855_1000502327 278
137 3300005577 Ga0068857_100021263 Ga0068857_1000212638 278
138 3300005578 Ga0068854_100107485 Ga0068854_1001074852 278
139 3300005614 Ga0068856_100013747 Ga0068856_10001374711 278
140 3300005614 Ga0068856_100134736 Ga0068856_1001347361 278
141 3300005618 Ga0068864_100504844 Ga0068864_1005048442 278
142 3300009093 Ga0105240_10044728 Ga0105240_100447284 278
143 3300009094 Ga0111539_10010834 Ga0111539_1001083411 278
144 3300009545 Ga0105237_10003402 Ga0105237_1000340212 278
145 3300009545 Ga0105237_10695262 Ga0105237_106952621 278
146 3300010375 Ga0105239_10000195 Ga0105239_1000019527 278
147 3300013100 Ga0157373_10001468 Ga0157373_100014685 278
148 3300013100 Ga0157373_10065607 Ga0157373_100656073 278
149 3300013102 Ga0157371_10006480 Ga0157371_100064804 278
150 3300013102 Ga0157371_10018706 Ga0157371_100187063 278
151 3300013102 Ga0157371_10233346 Ga0157371_102333461 278
152 3300013104 Ga0157370_10002875 Ga0157370_1000287518 278
153 3300013104 Ga0157370_10288137 Ga0157370_102881372 278
154 3300013105 Ga0157369_10039461 Ga0157369_100394615 278
155 3300013105 Ga0157369_10275980 Ga0157369_102759803 278
156 3300013296 Ga0157374_10029851 Ga0157374_100298516 278
157 3300013307 Ga0157372_10007012 Ga0157372_100070124 278
158 3300013307 Ga0157372_10019863 Ga0157372_1001986310 278
159 3300013307 Ga0157372_10020219 Ga0157372_100202191 278
160 3300013307 Ga0157372_10060798 Ga0157372_100607984 278
161 3300013307 Ga0157372_10153282 Ga0157372_101532823 278
162 3300013307 Ga0157372_10291011 Ga0157372_102910112 278
163 3300014969 Ga0157376_10662454 Ga0157376_106624542 278
164 3300025909 Ga0207705_10016642 Ga0207705_100166423 278
165 3300025909 Ga0207705_10032752 Ga0207705_100327523 278
166 3300025912 Ga0207707_10034681 Ga0207707_100346813 278
167 3300025912 Ga0207707_10306956 Ga0207707_103069562 278
168 3300025913 Ga0207695_10033140 Ga0207695_100331404 278
169 3300025914 Ga0207671_10009918 Ga0207671_100099184 278
170 3300025917 Ga0207660_10013397 Ga0207660_100133977 278
171 3300025919 Ga0207657_10047382 Ga0207657_100473824 278
172 3300025919 Ga0207657_10130471 Ga0207657_101304714 278
173 3300025921 Ga0207652_10002727 Ga0207652_100027274 278
174 3300025921 Ga0207652_10201667 Ga0207652_102016672 278
175 3300025932 Ga0207690_10364605 Ga0207690_103646052 278
176 3300025944 Ga0207661_10045002 Ga0207661_100450021 278
177 3300025949 Ga0207667_10026916 Ga0207667_100269165 278
178 3300026041 Ga0207639_10171435 Ga0207639_101714352 278
179 3300026067 Ga0207678_10004778 Ga0207678_100047784 278
180 3300026078 Ga0207702_10093792 Ga0207702_100937921 278
181 3300026078 Ga0207702_10169685 Ga0207702_101696853 278
182 3300026116 Ga0207674_10099864 Ga0207674_100998643 278
183 3300027907 Ga0207428_10071036 Ga0207428_100710363 278
184 3300031251 Ga0265327_10003081 Ga0265327_100030816 278
185 3300031251 Ga0265327_10041643 Ga0265327_100416433 278
186 3300031456 Ga0307513_10208962 Ga0307513_102089623 278
187 3300037312 Ga0395899_0009943 Ga0395899_0009943_569_1408 278
188 3300037312 Ga0395899_0053701 Ga0395899_0053701_714_1553 278
189 3300037418 Ga0395900_0018116 Ga0395900_0018116_5889_6728 278
190 3300037418 Ga0395900_0043955 Ga0395900_0043955_1431_2270 278
191 3300037466 Ga0395898_0059145 Ga0395898_0059145_1027_1866 278
192 3300037466 Ga0395898_0436515 Ga0395898_0436515_397_1236 278
193 3300037471 Ga0395905_0183036 Ga0395905_0183036_425_1264 278
194 3300037471 Ga0395905_0218449 Ga0395905_0218449_17_856 278
195 3300038443 Ga0395901_0077500 Ga0395901_0077500_1212_2051 278
196 3300038443 Ga0395901_0256363 Ga0395901_0256363_283_1122 278
197 3300044658 Ga0466972_0011885 Ga0466972_0011885_2242_3090 278
198 3300044735 Ga0466968_0049949 Ga0466968_0049949_402_1250 278
199 3300044901 Ga0466960_0025091 Ga0466960_0025091_1154_2002 278
200 3300045051 Ga0451576_0574472 Ga0451576_0574472_98_943 278
201 3300049568 Ga0501031_0069170 Ga0501031_0069170_929_1765 278
202 3300049573 Ga0501037_0359541 Ga0501037_0359541_127_963 278
203 3300049575 Ga0501039_0015357 Ga0501039_0015357_757_1593 278
204 3300049579 Ga0501043_0039397 Ga0501043_0039397_621_1457 278
205 3300049580 Ga0501046_0216840 Ga0501046_0216840_381_1217 278
206 3300049586 Ga0501070_0155151 Ga0501070_0155151_940_1776 278
207 3300049588 Ga0501072_0116108 Ga0501072_0116108_1277_2113 278
208 3300049589 Ga0501073_0257294 Ga0501073_0257294_168_1004 278
209 3300049742 Ga0501080_0250850 Ga0501080_0250850_77_913 278
210 3300049823 Ga0501044_0437452 Ga0501044_0437452_17_913 278
211 3300050511 nmdc:mga08y16_453985_c1 nmdc:mga08y16_453985_c1_431_1273 278
212 3300005539 Ga0068853_100037849 Ga0068853_1000378491 279
213 3300005614 Ga0068856_100079012 Ga0068856_1000790124 279
214 3300005719 Ga0068861_100107511 Ga0068861_1001075114 279
215 3300005843 Ga0068860_100002921 Ga0068860_10000292115 279
216 3300005843 Ga0068860_100027661 Ga0068860_1000276618 279
217 3300009093 Ga0105240_10000276 Ga0105240_1000027619 279
218 3300009093 Ga0105240_10002010 Ga0105240_1000201018 279
219 3300009174 Ga0105241_10006070 Ga0105241_100060705 279
220 3300009545 Ga0105237_10002459 Ga0105237_100024592 279
221 3300009551 Ga0105238_10016912 Ga0105238_100169129 279
222 3300009551 Ga0105238_10395708 Ga0105238_103957081 279
223 3300010375 Ga0105239_10000433 Ga0105239_1000043332 279
224 3300013102 Ga0157371_10005627 Ga0157371_100056275 279
225 3300013296 Ga0157374_10182996 Ga0157374_101829963 279
226 3300013306 Ga0163162_10006637 Ga0163162_100066373 279
227 3300013306 Ga0163162_10587444 Ga0163162_105874442 279
228 3300025911 Ga0207654_10069601 Ga0207654_100696012 279
229 3300025913 Ga0207695_10001186 Ga0207695_1000118612 279
230 3300025913 Ga0207695_10046630 Ga0207695_100466302 279
231 3300025914 Ga0207671_10012172 Ga0207671_100121723 279
232 3300025914 Ga0207671_10108665 Ga0207671_101086652 279
233 3300025924 Ga0207694_10013767 Ga0207694_100137674 279
234 3300026023 Ga0207677_10070738 Ga0207677_100707384 279
235 3300026041 Ga0207639_10264070 Ga0207639_102640702 279
236 3300026078 Ga0207702_10103012 Ga0207702_101030122 279
237 3300028381 Ga0268264_10005051 Ga0268264_1000505111 279
238 3300028381 Ga0268264_10019504 Ga0268264_100195043 279
239 3300032004 Ga0307414_10080650 Ga0307414_100806502 279
240 3300041494 Ga0451837_1487179 Ga0451837_1487179_2904_3791 279
241 3300045051 Ga0451576_0000002 Ga0451576_0000002_380633_381484 279
242 3300049570 Ga0501033_0000061 Ga0501033_0000061_66569_67438 279
243 3300049571 Ga0501034_0002106 Ga0501034_0002106_18311_19180 279
244 3300049579 Ga0501043_0015222 Ga0501043_0015222_3884_4753 279
245 3300049823 Ga0501044_0304593 Ga0501044_0304593_402_1241 279
246 3300001979 JGI24740J21852_10030199 JGI24740J21852_100301993 280
247 3300003320 rootH2_10005790 rootH2_1000579054 280
248 3300005327 Ga0070658_10223266 Ga0070658_102232662 280
249 3300005339 Ga0070660_100028312 Ga0070660_1000283127 280
250 3300005341 Ga0070691_10015049 Ga0070691_100150492 280
251 3300005366 Ga0070659_100001238 Ga0070659_1000012389 280
252 3300005366 Ga0070659_100075476 Ga0070659_1000754762 280
253 3300005455 Ga0070663_100020487 Ga0070663_1000204873 280
254 3300005535 Ga0070684_100006927 Ga0070684_1000069274 280
255 3300005539 Ga0068853_100335384 Ga0068853_1003353842 280
256 3300005563 Ga0068855_100000226 Ga0068855_10000022650 280
257 3300005563 Ga0068855_100009031 Ga0068855_10000903110 280
258 3300005578 Ga0068854_100060467 Ga0068854_1000604673 280
259 3300005614 Ga0068856_100002800 Ga0068856_10000280012 280
260 3300005616 Ga0068852_100154534 Ga0068852_1001545342 280
261 3300005842 Ga0068858_100207795 Ga0068858_1002077952 280
262 3300005842 Ga0068858_100500539 Ga0068858_1005005392 280
263 3300005843 Ga0068860_100000005 Ga0068860_100000005118 280
264 3300009093 Ga0105240_10002198 Ga0105240_1000219823 280
265 3300009093 Ga0105240_10154853 Ga0105240_101548532 280
266 3300009174 Ga0105241_10002217 Ga0105241_100022173 280
267 3300009174 Ga0105241_10002608 Ga0105241_100026086 280
268 3300009545 Ga0105237_10000143 Ga0105237_1000014355 280
269 3300009545 Ga0105237_10029828 Ga0105237_100298283 280
270 3300009551 Ga0105238_10312615 Ga0105238_103126152 280
271 3300009553 Ga0105249_10113036 Ga0105249_101130362 280
272 3300009553 Ga0105249_10277460 Ga0105249_102774602 280
273 3300010375 Ga0105239_10003037 Ga0105239_100030374 280
274 3300010375 Ga0105239_10005136 Ga0105239_1000513610 280
275 3300010375 Ga0105239_10010145 Ga0105239_1001014511 280
276 3300010375 Ga0105239_10068134 Ga0105239_100681342 280
277 3300013102 Ga0157371_10004775 Ga0157371_100047755 280
278 3300013104 Ga0157370_10088078 Ga0157370_100880783 280
279 3300013104 Ga0157370_10245118 Ga0157370_102451182 280
280 3300013105 Ga0157369_10001726 Ga0157369_1000172620 280
281 3300013307 Ga0157372_10000286 Ga0157372_1000028638 280
282 3300013307 Ga0157372_10046901 Ga0157372_100469015 280
283 3300014497 Ga0182008_10056523 Ga0182008_100565231 280
284 3300015262 Ga0182007_10017619 Ga0182007_100176192 280
285 3300015262 Ga0182007_10021687 Ga0182007_100216872 280
286 3300025242 Ga0209258_100234 Ga0209258_1002345 280
287 3300025254 Ga0209148_1000234 Ga0209148_10002345 280
288 3300025909 Ga0207705_10000028 Ga0207705_1000002877 280
289 3300025909 Ga0207705_10214371 Ga0207705_102143711 280
290 3300025911 Ga0207654_10001489 Ga0207654_100014899 280
291 3300025911 Ga0207654_10053127 Ga0207654_100531271 280
292 3300025913 Ga0207695_10000183 Ga0207695_1000018370 280
293 3300025913 Ga0207695_10000645 Ga0207695_1000064549 280
294 3300025914 Ga0207671_10000968 Ga0207671_1000096813 280
295 3300025914 Ga0207671_10043401 Ga0207671_100434012 280
296 3300025919 Ga0207657_10039235 Ga0207657_100392352 280
297 3300025924 Ga0207694_10227431 Ga0207694_102274312 280
298 3300025932 Ga0207690_10000943 Ga0207690_1000094318 280
299 3300025949 Ga0207667_10000039 Ga0207667_10000039112 280
300 3300025949 Ga0207667_10003030 Ga0207667_1000303016 280
301 3300026067 Ga0207678_10040879 Ga0207678_100408794 280
302 3300026078 Ga0207702_10013769 Ga0207702_100137697 280
303 3300026078 Ga0207702_10059282 Ga0207702_100592822 280
304 3300026116 Ga0207674_10026166 Ga0207674_100261664 280
305 3300028381 Ga0268264_10000012 Ga0268264_10000012100 280
306 3300028786 Ga0307517_10017476 Ga0307517_100174765 280
307 3300028800 Ga0265338_10122514 Ga0265338_101225143 280
308 3300031616 Ga0307508_10000926 Ga0307508_1000092613 280
309 3300031731 Ga0307405_10040053 Ga0307405_100400532 280
310 3300031911 Ga0307412_10024756 Ga0307412_100247562 280
311 3300037312 Ga0395899_0000434 Ga0395899_0000434_11240_12082 280
312 3300039447 Ga0436361_0672383 Ga0436361_0672383_5408_6253 280
313 3300044656 Ga0466969_0014294 Ga0466969_0014294_2133_2975 280
314 3300044684 Ga0466966_0003138 Ga0466966_0003138_6863_7705 280
315 3300044693 Ga0466961_0054087 Ga0466961_0054087_1163_2005 280
316 3300045049 Ga0466959_0172271 Ga0466959_0172271_146_988 280
317 3300045836 Ga0466958_0196383 Ga0466958_0196383_252_1094 280
318 3300046524 Ga0495648_0001914 Ga0495648_0001914_11059_11904 280
319 3300046648 Ga0495611_0101222 Ga0495611_0101222_330_1175 280
320 3300047443 Ga0495687_005139 Ga0495687_005139_1936_2781 280
321 3300047472 Ga0495686_0062033 Ga0495686_0062033_947_1792 280
322 3300049571 Ga0501034_0003261 Ga0501034_0003261_2926_3774 280
323 3300049586 Ga0501070_0001260 Ga0501070_0001260_11056_11904 280
324 3300049673 Ga0501240_003748 Ga0501240_003748_292_1134 280
325 3300049742 Ga0501080_0082415 Ga0501080_0082415_1189_2037 280
326 3300049823 Ga0501044_0003358 Ga0501044_0003358_7108_7956 280
327 3300053088 Ga0500644_0000222 Ga0500644_0000222_19552_20397 280
328 3300053090 Ga0500646_0017593 Ga0500646_0017593_210_1079 280
329 3300053092 Ga0500583_0001005 Ga0500583_0001005_7049_7894 280
330 3300053092 Ga0500583_0032644 Ga0500583_0032644_230_1075 280
331 3300053093 Ga0500651_0121868 Ga0500651_0121868_674_1543 280
332 3300053147 Ga0500589_099300 Ga0500589_099300_100_945 280
333 3300053156 Ga0500622_0000686 Ga0500622_0000686_19409_20254 280
334 3300053161 Ga0500634_0043398 Ga0500634_0043398_889_1734 280
335 3300053177 Ga0500636_0042452 Ga0500636_0042452_221_1066 280

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

80

179

0.96

PF13649

Methyltransf_25

Methyltransferase domain

79

175

0.95

PF13847

Methyltransf_31

Methyltransferase domain

73

231

0.94

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

67

203

0.93

PF01170

UPF0020

RMKL-like, methyltransferase domain

71

153

0.89

PF08242

Methyltransf_12

Methyltransferase domain

80

177

0.88

PF13489

Methyltransf_23

Methyltransferase domain

54

211

0.87

PF01728

FtsJ

FtsJ-like methyltransferase

65

183

0.81

PF06325

PrmA

Ribosomal protein L11 methyltransferase (PrmA)

66

195

0.81

PF01135

PCMT

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

47

179

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yxe-assembly1.cif.gz_B crystal structure of l-isoaspartyl protein carboxyl methyltranferase 0.8793 68 180
1dl5-assembly1.cif.gz_A protein-l-isoaspartate o-methyltransferase 0.8489 68 179
5evj-assembly2.cif.gz_B x-ray crystal structure of crarsm, an arsenic (iii) s-adenosylmethionine methyltransferase from chlamydomonas reinhardtii 0.844 75 268
6ec3-assembly2.cif.gz_B crystal structure of evdmo1 0.8271 76 267
4pyj-assembly1.cif.gz_A human apo-comt, single domain swap 0.8205 78 150
ID Description Score Start End Superfamily
af_Q4E3J0_145_404_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9456 75 138 3.40.50.150
af_C7J169_1_82_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9441 69 128 3.40.50.150
af_Q55DF6_53_245_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9306 73 134 3.40.50.150
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9271 71 136 3.40.50.150
af_K7LTE4_237_888_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9262 69 136 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2H0AUX0-F1-model_v4 Methyltransferase domain-containing protein 0.9642 68 132 GO:0016020
AF-A0A7W1W703-F1-model_v4 Methyltransferase domain-containing protein 0.9454 68 172 GO:0008168
GO:0032259
AF-A0A536VRK7-F1-model_v4 Class I SAM-dependent methyltransferase 0.9347 67 175 GO:0008168
GO:0032259
AF-J7T967-F1-model_v4 deleted 0.9335 61 201
AF-A0A2Z5JPE9-F1-model_v4 Methyltransferase domain-containing protein 0.9217 72 170 GO:0008168
GO:0009058

Feature Viewer

pLDDT pTM Quality
84.23 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map