F412152
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 335 | 184 | 335 | 190 |
Family's Representative Sequence
| Representative Sequence | 3300005549|Ga0070704_100576471|Ga0070704_1005764711 |
| Length | 218 |
| Sequence | LEGVVWRSPETTNRWYTPIESAVRKGLVMAWVNTSPLVKTYTLEEFWELPEPPDGSKIELIAGVLYMTPPPDYTHNNAVSRLNSHLIVHMFTIGDKGRIYIPRAAIWTSPNTYLEPDLFYVSAELLGRQNPVHLTTADLVVEVISPGSAIYDRNTKADTYGALGVRELWLIDEKSQSVEVRNQTGTGFGAGVVFKGSEQIVSQVFPTLDLPVYKLFTD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 50 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 53 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 54 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 55 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 56 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 57 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 58 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 59 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 118 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 121 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 122 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 123 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 124 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 125 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 126 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 127 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 128 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 129 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 130 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 131 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 132 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 133 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 134 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 135 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 136 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 137 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 138 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 139 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 140 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 141 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 142 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 143 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 144 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 145 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 146 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 147 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 148 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 149 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 150 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 151 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 152 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 153 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 154 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 155 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 156 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 157 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 158 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 159 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 160 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 161 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 162 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 163 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 164 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 165 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 166 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 167 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 168 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 169 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 170 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 171 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 172 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 173 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 174 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 175 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 176 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 177 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 178 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.6 |
| Rhizosphere | 99.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_2185856 | 2162886011 | Unclassified | 1531 |
| 2 | JGI25406J46586_10001573 | 3300003203 | Bacteria | 10766 |
| 3 | Ga0065704_10001508 | 3300005289 | Bacteria | 7472 |
| 4 | Ga0065712_10000113 | 3300005290 | Bacteria | 191931 |
| 5 | Ga0065712_10037135 | 3300005290 | Unclassified | 906 |
| 6 | Ga0065712_10068986 | 3300005290 | Bacteria | 8371 |
| 7 | Ga0065715_10040718 | 3300005293 | Unclassified | 1085 |
| 8 | Ga0065715_10099112 | 3300005293 | Bacteria | 3456 |
| 9 | Ga0065715_10143354 | 3300005293 | Bacteria | 1815 |
| 10 | Ga0065715_10279870 | 3300005293 | Bacteria | 1062 |
| 11 | Ga0065707_10002161 | 3300005295 | Bacteria | 6481 |
| 12 | Ga0065707_10128746 | 3300005295 | Unclassified | 1940 |
| 13 | Ga0065707_10134166 | 3300005295 | Bacteria | 1869 |
| 14 | Ga0070677_10268841 | 3300005333 | Unclassified | 854 |
| 15 | Ga0068869_100171435 | 3300005334 | Unclassified | 1695 |
| 16 | Ga0068869_100348343 | 3300005334 | Bacteria | 1207 |
| 17 | Ga0070680_100019946 | 3300005336 | Bacteria | 5314 |
| 18 | Ga0070682_100009886 | 3300005337 | Bacteria | 5402 |
| 19 | Ga0070689_100319633 | 3300005340 | Unclassified | 1296 |
| 20 | Ga0070689_100391334 | 3300005340 | Unclassified | 1173 |
| 21 | Ga0070689_100503644 | 3300005340 | Unclassified | 1038 |
| 22 | Ga0070689_100814903 | 3300005340 | Unclassified | 821 |
| 23 | Ga0070687_100046684 | 3300005343 | Bacteria | 2218 |
| 24 | Ga0070692_10029802 | 3300005345 | Bacteria | 2723 |
| 25 | Ga0070675_100121724 | 3300005354 | Unclassified | 2217 |
| 26 | Ga0070673_100281797 | 3300005364 | Bacteria | 1458 |
| 27 | Ga0070688_100075274 | 3300005365 | Unclassified | 2169 |
| 28 | Ga0070688_100165842 | 3300005365 | Unclassified | 1521 |
| 29 | Ga0070701_10410677 | 3300005438 | Unclassified | 860 |
| 30 | Ga0070705_100042862 | 3300005440 | Bacteria | 2590 |
| 31 | Ga0070700_100064306 | 3300005441 | Bacteria | 2323 |
| 32 | Ga0070694_100120772 | 3300005444 | Unclassified | 1880 |
| 33 | Ga0070694_100521639 | 3300005444 | Unclassified | 948 |
| 34 | Ga0070708_100000257 | 3300005445 | Bacteria | 39748 |
| 35 | Ga0070681_10002499 | 3300005458 | Bacteria | 16842 |
| 36 | Ga0070681_10321599 | 3300005458 | Unclassified | 1457 |
| 37 | Ga0068867_100396356 | 3300005459 | Unclassified | 1163 |
| 38 | Ga0068867_100758367 | 3300005459 | Unclassified | 862 |
| 39 | Ga0070706_100171328 | 3300005467 | Bacteria | 2027 |
| 40 | Ga0070706_100193945 | 3300005467 | Bacteria | 1898 |
| 41 | Ga0070706_101324596 | 3300005467 | Unclassified | 660 |
| 42 | Ga0070707_100052644 | 3300005468 | Bacteria | 3903 |
| 43 | Ga0070698_100048348 | 3300005471 | Unclassified | 4346 |
| 44 | Ga0070699_100000196 | 3300005518 | Bacteria | 59314 |
| 45 | Ga0070699_100351034 | 3300005518 | Unclassified | 1329 |
| 46 | Ga0070679_100230130 | 3300005530 | Bacteria | 1813 |
| 47 | Ga0070697_100059747 | 3300005536 | Bacteria | 3105 |
| 48 | Ga0070697_100226469 | 3300005536 | Bacteria | 1594 |
| 49 | Ga0070697_100671843 | 3300005536 | Unclassified | 913 |
| 50 | Ga0068853_100538922 | 3300005539 | Unclassified | 1105 |
| 51 | Ga0068853_101240928 | 3300005539 | Bacteria | 720 |
| 52 | Ga0070672_100397011 | 3300005543 | Bacteria | 1181 |
| 53 | Ga0070686_100016945 | 3300005544 | Bacteria | 4247 |
| 54 | Ga0070695_100488093 | 3300005545 | Unclassified | 950 |
| 55 | Ga0070696_100056951 | 3300005546 | Bacteria | 2727 |
| 56 | Ga0070696_100165465 | 3300005546 | Unclassified | 1632 |
| 57 | Ga0070696_100459401 | 3300005546 | Unclassified | 1006 |
| 58 | Ga0070696_101067073 | 3300005546 | Unclassified | 678 |
| 59 | Ga0070693_100143455 | 3300005547 | Bacteria | 1506 |
| 60 | Ga0070693_100290577 | 3300005547 | Unclassified | 1098 |
| 61 | Ga0070693_100370921 | 3300005547 | Unclassified | 985 |
| 62 | Ga0070704_100576471 | 3300005549 | Bacteria | 986 |
| 63 | Ga0070664_100135283 | 3300005564 | Unclassified | 2167 |
| 64 | Ga0070664_100576912 | 3300005564 | Unclassified | 1042 |
| 65 | Ga0068857_100203114 | 3300005577 | Unclassified | 1807 |
| 66 | Ga0070702_100097248 | 3300005615 | Unclassified | 1798 |
| 67 | Ga0070702_100117490 | 3300005615 | Unclassified | 1659 |
| 68 | Ga0070702_100254938 | 3300005615 | Bacteria | 1191 |
| 69 | Ga0068852_100136045 | 3300005616 | Unclassified | 2269 |
| 70 | Ga0068852_101185279 | 3300005616 | Unclassified | 785 |
| 71 | Ga0068859_100019346 | 3300005617 | Bacteria | 6841 |
| 72 | Ga0068859_100052354 | 3300005617 | Unclassified | 4104 |
| 73 | Ga0068859_100052957 | 3300005617 | Unclassified | 4081 |
| 74 | Ga0068859_100066256 | 3300005617 | Unclassified | 3646 |
| 75 | Ga0068859_100083521 | 3300005617 | Bacteria | 3237 |
| 76 | Ga0068859_100148037 | 3300005617 | Unclassified | 2423 |
| 77 | Ga0068859_100281227 | 3300005617 | Bacteria | 1757 |
| 78 | Ga0068859_100495027 | 3300005617 | Unclassified | 1318 |
| 79 | Ga0068859_101058987 | 3300005617 | Unclassified | 892 |
| 80 | Ga0068859_102014031 | 3300005617 | Unclassified | 638 |
| 81 | Ga0068864_100062532 | 3300005618 | Unclassified | 3225 |
| 82 | Ga0068864_100288216 | 3300005618 | Unclassified | 1534 |
| 83 | Ga0068864_100292184 | 3300005618 | Bacteria | 1524 |
| 84 | Ga0068864_100344703 | 3300005618 | Bacteria | 1404 |
| 85 | Ga0068864_100801550 | 3300005618 | Bacteria | 926 |
| 86 | Ga0068864_100983977 | 3300005618 | Unclassified | 836 |
| 87 | Ga0068866_10739908 | 3300005718 | Unclassified | 678 |
| 88 | Ga0068861_100240652 | 3300005719 | Bacteria | 1539 |
| 89 | Ga0068863_100050103 | 3300005841 | Unclassified | 3960 |
| 90 | Ga0068863_100061668 | 3300005841 | Bacteria | 3546 |
| 91 | Ga0068863_100111360 | 3300005841 | Unclassified | 2607 |
| 92 | Ga0068863_100233466 | 3300005841 | Unclassified | 1775 |
| 93 | Ga0068863_100302865 | 3300005841 | Bacteria | 1551 |
| 94 | Ga0068858_100057725 | 3300005842 | Bacteria | 3587 |
| 95 | Ga0068858_100075892 | 3300005842 | Unclassified | 3123 |
| 96 | Ga0068858_100386790 | 3300005842 | Bacteria | 1343 |
| 97 | Ga0068858_100864498 | 3300005842 | Unclassified | 883 |
| 98 | Ga0068860_100046825 | 3300005843 | Bacteria | 4122 |
| 99 | Ga0068860_100074096 | 3300005843 | Bacteria | 3236 |
| 100 | Ga0068860_100135372 | 3300005843 | Bacteria | 2366 |
| 101 | Ga0068860_100149376 | 3300005843 | Unclassified | 2249 |
| 102 | Ga0068860_100243234 | 3300005843 | Bacteria | 1751 |
| 103 | Ga0068860_101142532 | 3300005843 | Unclassified | 799 |
| 104 | Ga0068862_100149676 | 3300005844 | Unclassified | 2077 |
| 105 | Ga0068862_101450844 | 3300005844 | Unclassified | 690 |
| 106 | Ga0081539_10000408 | 3300005985 | Bacteria | 91634 |
| 107 | Ga0081539_10177955 | 3300005985 | Unclassified | 1000 |
| 108 | Ga0070715_10498246 | 3300006163 | Bacteria | 697 |
| 109 | Ga0097621_100030189 | 3300006237 | Unclassified | 4288 |
| 110 | Ga0097621_100213178 | 3300006237 | Bacteria | 1680 |
| 111 | Ga0097621_100687031 | 3300006237 | Unclassified | 941 |
| 112 | Ga0068871_100006877 | 3300006358 | Bacteria | 8099 |
| 113 | Ga0075428_100215833 | 3300006844 | Bacteria | 2073 |
| 114 | Ga0075430_100257464 | 3300006846 | Unclassified | 1445 |
| 115 | Ga0075431_100435675 | 3300006847 | Unclassified | 1308 |
| 116 | Ga0075433_10036475 | 3300006852 | Bacteria | 4236 |
| 117 | Ga0075433_10249366 | 3300006852 | Viruses | 1575 |
| 118 | Ga0075433_10445091 | 3300006852 | Unclassified | 1142 |
| 119 | Ga0075434_100268088 | 3300006871 | Bacteria | 1727 |
| 120 | Ga0075429_100392496 | 3300006880 | Unclassified | 1215 |
| 121 | Ga0068865_100124383 | 3300006881 | Unclassified | 1923 |
| 122 | Ga0097620_100019348 | 3300006931 | Bacteria | 6841 |
| 123 | Ga0097620_100052354 | 3300006931 | Unclassified | 4104 |
| 124 | Ga0097620_100052956 | 3300006931 | Unclassified | 4081 |
| 125 | Ga0097620_100066258 | 3300006931 | Unclassified | 3646 |
| 126 | Ga0097620_100083520 | 3300006931 | Bacteria | 3237 |
| 127 | Ga0097620_100148026 | 3300006931 | Unclassified | 2423 |
| 128 | Ga0097620_100281223 | 3300006931 | Bacteria | 1757 |
| 129 | Ga0097620_100494967 | 3300006931 | Unclassified | 1318 |
| 130 | Ga0097620_100900956 | 3300006931 | Unclassified | 969 |
| 131 | Ga0097620_101059014 | 3300006931 | Unclassified | 892 |
| 132 | Ga0097620_102014097 | 3300006931 | Unclassified | 638 |
| 133 | Ga0105247_10076549 | 3300009101 | Unclassified | 2101 |
| 134 | Ga0105247_10444445 | 3300009101 | Unclassified | 933 |
| 135 | Ga0105247_10737466 | 3300009101 | Unclassified | 745 |
| 136 | Ga0114129_10036154 | 3300009147 | Bacteria | 6975 |
| 137 | Ga0114129_10260535 | 3300009147 | Unclassified | 2324 |
| 138 | Ga0105243_10000073 | 3300009148 | Bacteria | 114756 |
| 139 | Ga0105243_10263501 | 3300009148 | Unclassified | 1544 |
| 140 | Ga0105243_10300049 | 3300009148 | Unclassified | 1456 |
| 141 | Ga0105243_10967708 | 3300009148 | Unclassified | 851 |
| 142 | Ga0105243_11213382 | 3300009148 | Bacteria | 768 |
| 143 | Ga0105241_10124210 | 3300009174 | Bacteria | 2082 |
| 144 | Ga0105242_10000043 | 3300009176 | Bacteria | 85748 |
| 145 | Ga0105242_10350941 | 3300009176 | Unclassified | 1362 |
| 146 | Ga0105248_10026801 | 3300009177 | Bacteria | 6411 |
| 147 | Ga0105248_10177178 | 3300009177 | Bacteria | 2403 |
| 148 | Ga0105248_10516102 | 3300009177 | Unclassified | 1347 |
| 149 | Ga0105248_10774844 | 3300009177 | Bacteria | 1082 |
| 150 | Ga0105248_10904016 | 3300009177 | Unclassified | 997 |
| 151 | Ga0105248_10959803 | 3300009177 | Unclassified | 965 |
| 152 | Ga0105237_10269121 | 3300009545 | Bacteria | 1707 |
| 153 | Ga0105238_10074314 | 3300009551 | Bacteria | 3392 |
| 154 | Ga0105249_10014488 | 3300009553 | Bacteria | 6970 |
| 155 | Ga0105249_10485363 | 3300009553 | Unclassified | 1279 |
| 156 | Ga0105239_10639418 | 3300010375 | Unclassified | 1215 |
| 157 | Ga0105246_10072009 | 3300011119 | Unclassified | 2435 |
| 158 | Ga0105246_10504967 | 3300011119 | Unclassified | 1028 |
| 159 | Ga0105246_11462904 | 3300011119 | Unclassified | 640 |
| 160 | Ga0157373_10060200 | 3300013100 | Unclassified | 2690 |
| 161 | Ga0157374_10067013 | 3300013296 | Unclassified | 3374 |
| 162 | Ga0157378_10237382 | 3300013297 | Bacteria | 1740 |
| 163 | Ga0157378_10540643 | 3300013297 | Unclassified | 1169 |
| 164 | Ga0157378_10730996 | 3300013297 | Unclassified | 1011 |
| 165 | Ga0157378_11137101 | 3300013297 | Bacteria | 819 |
| 166 | Ga0157378_12069833 | 3300013297 | Unclassified | 620 |
| 167 | Ga0163162_10708144 | 3300013306 | Unclassified | 1128 |
| 168 | Ga0163162_11232271 | 3300013306 | Unclassified | 849 |
| 169 | Ga0157372_10164612 | 3300013307 | Bacteria | 2564 |
| 170 | Ga0157372_10909688 | 3300013307 | Bacteria | 1021 |
| 171 | Ga0157375_10608974 | 3300013308 | Unclassified | 1251 |
| 172 | Ga0157375_11090228 | 3300013308 | Bacteria | 934 |
| 173 | Ga0157375_12016176 | 3300013308 | Unclassified | 686 |
| 174 | Ga0163163_10482989 | 3300014325 | Unclassified | 1300 |
| 175 | Ga0163163_10487506 | 3300014325 | Bacteria | 1294 |
| 176 | Ga0163163_10953278 | 3300014325 | Unclassified | 921 |
| 177 | Ga0163163_11068070 | 3300014325 | Bacteria | 870 |
| 178 | Ga0157380_10195355 | 3300014326 | Unclassified | 1790 |
| 179 | Ga0157380_10616012 | 3300014326 | Bacteria | 1077 |
| 180 | Ga0157377_10113379 | 3300014745 | Bacteria | 1633 |
| 181 | Ga0157376_10040634 | 3300014969 | Bacteria | 3802 |
| 182 | Ga0163161_10001678 | 3300017792 | Bacteria | 16244 |
| 183 | Ga0163161_10172935 | 3300017792 | Bacteria | 1652 |
| 184 | Ga0207697_10019796 | 3300025315 | Bacteria | 2757 |
| 185 | Ga0207653_10000208 | 3300025885 | Bacteria | 39517 |
| 186 | Ga0207642_10638230 | 3300025899 | Unclassified | 666 |
| 187 | Ga0207710_10087521 | 3300025900 | Bacteria | 1453 |
| 188 | Ga0207710_10196654 | 3300025900 | Unclassified | 994 |
| 189 | Ga0207647_10000801 | 3300025904 | Bacteria | 24373 |
| 190 | Ga0207647_10298697 | 3300025904 | Unclassified | 917 |
| 191 | Ga0207684_11086560 | 3300025910 | Unclassified | 666 |
| 192 | Ga0207707_10000008 | 3300025912 | Bacteria | 330313 |
| 193 | Ga0207660_10001514 | 3300025917 | Bacteria | 15632 |
| 194 | Ga0207662_10013507 | 3300025918 | Bacteria | 4566 |
| 195 | Ga0207662_10323549 | 3300025918 | Unclassified | 1030 |
| 196 | Ga0207652_10000065 | 3300025921 | Bacteria | 111252 |
| 197 | Ga0207646_10185766 | 3300025922 | Bacteria | 1877 |
| 198 | Ga0207694_10015368 | 3300025924 | Bacteria | 5774 |
| 199 | Ga0207659_10240791 | 3300025926 | Bacteria | 1463 |
| 200 | Ga0207687_10030951 | 3300025927 | Bacteria | 3613 |
| 201 | Ga0207686_10000003 | 3300025934 | Bacteria | 376934 |
| 202 | Ga0207709_10391363 | 3300025935 | Unclassified | 1060 |
| 203 | Ga0207709_10403791 | 3300025935 | Unclassified | 1045 |
| 204 | Ga0207709_10448471 | 3300025935 | Unclassified | 997 |
| 205 | Ga0207709_10710704 | 3300025935 | Unclassified | 805 |
| 206 | Ga0207670_10327682 | 3300025936 | Unclassified | 1207 |
| 207 | Ga0207670_10485028 | 3300025936 | Unclassified | 1002 |
| 208 | Ga0207704_10129676 | 3300025938 | Bacteria | 1743 |
| 209 | Ga0207691_10029596 | 3300025940 | Bacteria | 5122 |
| 210 | Ga0207711_10059543 | 3300025941 | Bacteria | 3288 |
| 211 | Ga0207711_10251501 | 3300025941 | Unclassified | 1623 |
| 212 | Ga0207711_10401894 | 3300025941 | Unclassified | 1273 |
| 213 | Ga0207711_10913168 | 3300025941 | Bacteria | 816 |
| 214 | Ga0207711_11114704 | 3300025941 | Unclassified | 730 |
| 215 | Ga0207711_11231430 | 3300025941 | Unclassified | 690 |
| 216 | Ga0207689_10008514 | 3300025942 | Bacteria | 8945 |
| 217 | Ga0207689_10141831 | 3300025942 | Bacteria | 1979 |
| 218 | Ga0207689_10150252 | 3300025942 | Bacteria | 1920 |
| 219 | Ga0207689_10301349 | 3300025942 | Bacteria | 1328 |
| 220 | Ga0207679_10177513 | 3300025945 | Unclassified | 1759 |
| 221 | Ga0207679_10653852 | 3300025945 | Unclassified | 951 |
| 222 | Ga0207651_10426013 | 3300025960 | Unclassified | 1134 |
| 223 | Ga0207712_10022869 | 3300025961 | Bacteria | 4121 |
| 224 | Ga0207712_10039633 | 3300025961 | Unclassified | 3229 |
| 225 | Ga0207712_10145283 | 3300025961 | Bacteria | 1825 |
| 226 | Ga0207640_10583298 | 3300025981 | Bacteria | 944 |
| 227 | Ga0207677_10581379 | 3300026023 | Bacteria | 980 |
| 228 | Ga0207703_10304585 | 3300026035 | Unclassified | 1454 |
| 229 | Ga0207703_10365248 | 3300026035 | Bacteria | 1332 |
| 230 | Ga0207703_10420026 | 3300026035 | Bacteria | 1244 |
| 231 | Ga0207639_10943140 | 3300026041 | Unclassified | 807 |
| 232 | Ga0207708_10063206 | 3300026075 | Bacteria | 2828 |
| 233 | Ga0207708_10136158 | 3300026075 | Unclassified | 1924 |
| 234 | Ga0207641_10033932 | 3300026088 | Bacteria | 4242 |
| 235 | Ga0207641_10136844 | 3300026088 | Bacteria | 2206 |
| 236 | Ga0207641_10381755 | 3300026088 | Unclassified | 1349 |
| 237 | Ga0207641_10695490 | 3300026088 | Unclassified | 1001 |
| 238 | Ga0207641_11059349 | 3300026088 | Unclassified | 809 |
| 239 | Ga0207676_10063861 | 3300026095 | Bacteria | 2925 |
| 240 | Ga0207676_10076070 | 3300026095 | Bacteria | 2711 |
| 241 | Ga0207676_10225795 | 3300026095 | Unclassified | 1671 |
| 242 | Ga0207676_10399439 | 3300026095 | Unclassified | 1284 |
| 243 | Ga0207676_10514473 | 3300026095 | Bacteria | 1139 |
| 244 | Ga0207676_10691133 | 3300026095 | Unclassified | 987 |
| 245 | Ga0207676_10773520 | 3300026095 | Unclassified | 935 |
| 246 | Ga0207676_10791726 | 3300026095 | Bacteria | 924 |
| 247 | Ga0207674_10177167 | 3300026116 | Unclassified | 2084 |
| 248 | Ga0207674_10219843 | 3300026116 | Unclassified | 1848 |
| 249 | Ga0207675_100084200 | 3300026118 | Bacteria | 2984 |
| 250 | Ga0207675_100839519 | 3300026118 | Unclassified | 933 |
| 251 | Ga0207698_10342048 | 3300026142 | Bacteria | 1410 |
| 252 | Ga0207698_10973695 | 3300026142 | Unclassified | 858 |
| 253 | Ga0207428_10006541 | 3300027907 | Bacteria | 10746 |
| 254 | Ga0268265_10305481 | 3300028380 | Unclassified | 1434 |
| 255 | Ga0268265_10519497 | 3300028380 | Unclassified | 1125 |
| 256 | Ga0268264_10056173 | 3300028381 | Bacteria | 3290 |
| 257 | Ga0268264_10767095 | 3300028381 | Bacteria | 962 |
| 258 | Ga0307408_100008536 | 3300031548 | Bacteria | 6765 |
| 259 | Ga0307405_10005314 | 3300031731 | Bacteria | 6197 |
| 260 | Ga0307410_10013332 | 3300031852 | Unclassified | 4792 |
| 261 | Ga0307406_10019733 | 3300031901 | Unclassified | 3959 |
| 262 | Ga0307407_10064842 | 3300031903 | Bacteria | 2148 |
| 263 | Ga0307412_10041141 | 3300031911 | Bacteria | 2993 |
| 264 | Ga0307409_100293769 | 3300031995 | Bacteria | 1508 |
| 265 | Ga0307416_100022011 | 3300032002 | Unclassified | 4590 |
| 266 | Ga0307414_10011521 | 3300032004 | Bacteria | 5190 |
| 267 | Ga0307415_100022075 | 3300032126 | Unclassified | 3923 |
| 268 | Ga0373951_0026780 | 3300035091 | Unclassified | 1345 |
| 269 | Ga0373941_0167208 | 3300035115 | Unclassified | 817 |
| 270 | Ga0373962_0100325 | 3300035242 | Unclassified | 902 |
| 271 | Ga0395901_1100102 | 3300038443 | Bacteria | 765 |
| 272 | Ga0453683_0340894 | 3300044673 | Unclassified | 962 |
| 273 | Ga0451576_0352495 | 3300045051 | Bacteria | 1541 |
| 274 | Ga0496112_0558323 | 3300048915 | Unclassified | 1079 |
| 275 | Ga0496112_0817811 | 3300048915 | Unclassified | 856 |
| 276 | Ga0501291_002547 | 3300049514 | Bacteria | 2191 |
| 277 | Ga0501298_001083 | 3300049521 | Unclassified | 3906 |
| 278 | Ga0501198_001885 | 3300049649 | Bacteria | 2769 |
| 279 | Ga0501202_000580 | 3300049652 | Bacteria | 5329 |
| 280 | Ga0501207_000815 | 3300049654 | Unclassified | 3689 |
| 281 | Ga0501209_041140 | 3300049656 | Bacteria | 1222 |
| 282 | Ga0501209_122612 | 3300049656 | Bacteria | 772 |
| 283 | Ga0501216_000491 | 3300049660 | Unclassified | 4709 |
| 284 | Ga0501217_001018 | 3300049661 | Bacteria | 5083 |
| 285 | Ga0501223_001811 | 3300049663 | Unclassified | 4824 |
| 286 | Ga0501224_000348 | 3300049664 | Bacteria | 5391 |
| 287 | Ga0501224_008620 | 3300049664 | Bacteria | 1487 |
| 288 | Ga0501227_001393 | 3300049665 | Bacteria | 5408 |
| 289 | Ga0501228_002920 | 3300049666 | Unclassified | 1377 |
| 290 | Ga0501230_000408 | 3300049667 | Unclassified | 4189 |
| 291 | Ga0501233_005174 | 3300049668 | Bacteria | 2415 |
| 292 | Ga0501233_008759 | 3300049668 | Bacteria | 1959 |
| 293 | Ga0501236_003196 | 3300049670 | Bacteria | 1900 |
| 294 | Ga0501239_005452 | 3300049672 | Unclassified | 1281 |
| 295 | Ga0501243_007057 | 3300049675 | Bacteria | 1712 |
| 296 | Ga0501246_006398 | 3300049676 | Bacteria | 1009 |
| 297 | Ga0501249_006008 | 3300049679 | Bacteria | 2492 |
| 298 | Ga0501249_013989 | 3300049679 | Bacteria | 1708 |
| 299 | Ga0501250_036011 | 3300049680 | Unclassified | 707 |
| 300 | Ga0501251_017639 | 3300049681 | Unclassified | 919 |
| 301 | Ga0501252_018587 | 3300049682 | Unclassified | 891 |
| 302 | Ga0501253_001693 | 3300049683 | Bacteria | 2315 |
| 303 | Ga0501256_000074 | 3300049685 | Bacteria | 5135 |
| 304 | Ga0501257_012107 | 3300049686 | Bacteria | 1971 |
| 305 | Ga0501259_003107 | 3300049688 | Bacteria | 2657 |
| 306 | Ga0501260_001047 | 3300049689 | Bacteria | 2236 |
| 307 | Ga0501260_001969 | 3300049689 | Bacteria | 1740 |
| 308 | Ga0501221_001028 | 3300049704 | Unclassified | 4585 |
| 309 | Ga0501225_0001087 | 3300049705 | Bacteria | 8532 |
| 310 | Ga0501229_001225 | 3300049706 | Unclassified | 2982 |
| 311 | Ga0501234_000731 | 3300049707 | Bacteria | 5082 |
| 312 | Ga0501245_003157 | 3300049708 | Bacteria | 2226 |
| 313 | Ga0501262_027976 | 3300049759 | Unclassified | 802 |
| 314 | Ga0501268_005113 | 3300049765 | Bacteria | 1871 |
| 315 | Ga0501270_008801 | 3300049767 | Bacteria | 1287 |
| 316 | Ga0501272_012843 | 3300049769 | Unclassified | 954 |
| 317 | Ga0501273_015232 | 3300049770 | Unclassified | 996 |
| 318 | Ga0501283_009319 | 3300049779 | Bacteria | 1429 |
| 319 | Ga0501204_008496 | 3300049850 | Unclassified | 1174 |
| 320 | Ga0501212_001066 | 3300049851 | Bacteria | 2984 |
| 321 | Ga0501226_000806 | 3300049853 | Unclassified | 4216 |
| 322 | nmdc:mga05p37_195978_c1 | 3300050507 | Unclassified | 2449 |
| 323 | nmdc:mga09592_1058102_c1 | 3300050508 | Unclassified | 676 |
| 324 | nmdc:mga09592_672499_c1 | 3300050508 | Unclassified | 883 |
| 325 | nmdc:mga09592_878387_c1 | 3300050508 | Unclassified | 755 |
| 326 | nmdc:mga0qj67_739569_c1 | 3300050509 | Unclassified | 781 |
| 327 | nmdc:mga06r32_1021018_c1 | 3300050510 | Unclassified | 779 |
| 328 | nmdc:mga06r32_364112_c1 | 3300050510 | Unclassified | 1429 |
| 329 | nmdc:mga08y16_88831_c1 | 3300050511 | Bacteria | 3221 |
| 330 | nmdc:mga08y16_98762_c1 | 3300050511 | Bacteria | 3040 |
| 331 | nmdc:mga0n895_1055657_c1 | 3300050512 | Bacteria | 791 |
| 332 | nmdc:mga0n895_172753_c1 | 3300050512 | Bacteria | 2193 |
| 333 | nmdc:mga0a205_166685_c1 | 3300050515 | Unclassified | 2099 |
| 334 | nmdc:mga0a205_206377_c2 | 3300050515 | Bacteria | 1520 |
| 335 | nmdc:mga0a205_297351_c1 | 3300050515 | Bacteria | 1488 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003203 | JGI25406J46586_10001573 | JGI25406J46586_100015737 | 152 |
| 2 | 3300005617 | Ga0068859_100052354 | Ga0068859_1000523541 | 152 |
| 3 | 3300005617 | Ga0068859_100083521 | Ga0068859_1000835214 | 152 |
| 4 | 3300005841 | Ga0068863_100061668 | Ga0068863_1000616681 | 152 |
| 5 | 3300005842 | Ga0068858_100075892 | Ga0068858_1000758924 | 152 |
| 6 | 3300005843 | Ga0068860_100135372 | Ga0068860_1001353722 | 152 |
| 7 | 3300006931 | Ga0097620_100052354 | Ga0097620_1000523547 | 152 |
| 8 | 3300006931 | Ga0097620_100083520 | Ga0097620_1000835204 | 152 |
| 9 | 3300009148 | Ga0105243_10300049 | Ga0105243_103000492 | 152 |
| 10 | 3300011119 | Ga0105246_11462904 | Ga0105246_114629041 | 152 |
| 11 | 3300013100 | Ga0157373_10060200 | Ga0157373_100602004 | 152 |
| 12 | 3300005290 | Ga0065712_10037135 | Ga0065712_100371352 | 176 |
| 13 | 3300013307 | Ga0157372_10909688 | Ga0157372_109096882 | 184 |
| 14 | 3300045051 | Ga0451576_0352495 | Ga0451576_0352495_419_982 | 187 |
| 15 | 3300005293 | Ga0065715_10040718 | Ga0065715_100407182 | 188 |
| 16 | 3300005340 | Ga0070689_100503644 | Ga0070689_1005036441 | 188 |
| 17 | 3300005459 | Ga0068867_100758367 | Ga0068867_1007583671 | 188 |
| 18 | 3300005467 | Ga0070706_101324596 | Ga0070706_1013245961 | 188 |
| 19 | 3300005539 | Ga0068853_100538922 | Ga0068853_1005389222 | 188 |
| 20 | 3300005539 | Ga0068853_101240928 | Ga0068853_1012409282 | 188 |
| 21 | 3300005545 | Ga0070695_100488093 | Ga0070695_1004880932 | 188 |
| 22 | 3300005616 | Ga0068852_100136045 | Ga0068852_1001360453 | 188 |
| 23 | 3300005617 | Ga0068859_101058987 | Ga0068859_1010589872 | 188 |
| 24 | 3300005617 | Ga0068859_102014031 | Ga0068859_1020140311 | 188 |
| 25 | 3300005618 | Ga0068864_100292184 | Ga0068864_1002921841 | 188 |
| 26 | 3300005718 | Ga0068866_10739908 | Ga0068866_107399081 | 188 |
| 27 | 3300005842 | Ga0068858_100057725 | Ga0068858_1000577252 | 188 |
| 28 | 3300005843 | Ga0068860_100149376 | Ga0068860_1001493762 | 188 |
| 29 | 3300005985 | Ga0081539_10000408 | Ga0081539_1000040814 | 188 |
| 30 | 3300006931 | Ga0097620_101059014 | Ga0097620_1010590142 | 188 |
| 31 | 3300006931 | Ga0097620_102014097 | Ga0097620_1020140971 | 188 |
| 32 | 3300009101 | Ga0105247_10737466 | Ga0105247_107374662 | 188 |
| 33 | 3300009174 | Ga0105241_10124210 | Ga0105241_101242102 | 188 |
| 34 | 3300013308 | Ga0157375_11090228 | Ga0157375_110902282 | 188 |
| 35 | 3300014326 | Ga0157380_10195355 | Ga0157380_101953552 | 188 |
| 36 | 3300025910 | Ga0207684_11086560 | Ga0207684_110865601 | 188 |
| 37 | 3300025935 | Ga0207709_10391363 | Ga0207709_103913631 | 188 |
| 38 | 3300025935 | Ga0207709_10448471 | Ga0207709_104484711 | 188 |
| 39 | 3300025941 | Ga0207711_11231430 | Ga0207711_112314301 | 188 |
| 40 | 3300025942 | Ga0207689_10301349 | Ga0207689_103013492 | 188 |
| 41 | 3300025945 | Ga0207679_10653852 | Ga0207679_106538522 | 188 |
| 42 | 3300025981 | Ga0207640_10583298 | Ga0207640_105832982 | 188 |
| 43 | 3300026035 | Ga0207703_10304585 | Ga0207703_103045852 | 188 |
| 44 | 3300026075 | Ga0207708_10136158 | Ga0207708_101361582 | 188 |
| 45 | 3300026095 | Ga0207676_10225795 | Ga0207676_102257952 | 188 |
| 46 | 3300026116 | Ga0207674_10177167 | Ga0207674_101771673 | 188 |
| 47 | 3300026142 | Ga0207698_10342048 | Ga0207698_103420482 | 188 |
| 48 | 3300028380 | Ga0268265_10519497 | Ga0268265_105194972 | 188 |
| 49 | 3300048915 | Ga0496112_0817811 | Ga0496112_0817811_216_791 | 188 |
| 50 | 3300005289 | Ga0065704_10001508 | Ga0065704_100015087 | 189 |
| 51 | 3300005290 | Ga0065712_10068986 | Ga0065712_100689861 | 189 |
| 52 | 3300005293 | Ga0065715_10143354 | Ga0065715_101433541 | 189 |
| 53 | 3300005293 | Ga0065715_10279870 | Ga0065715_102798702 | 189 |
| 54 | 3300005295 | Ga0065707_10002161 | Ga0065707_100021617 | 189 |
| 55 | 3300005295 | Ga0065707_10134166 | Ga0065707_101341663 | 189 |
| 56 | 3300005333 | Ga0070677_10268841 | Ga0070677_102688412 | 189 |
| 57 | 3300005340 | Ga0070689_100814903 | Ga0070689_1008149031 | 189 |
| 58 | 3300005343 | Ga0070687_100046684 | Ga0070687_1000466841 | 189 |
| 59 | 3300005354 | Ga0070675_100121724 | Ga0070675_1001217241 | 189 |
| 60 | 3300005364 | Ga0070673_100281797 | Ga0070673_1002817972 | 189 |
| 61 | 3300005365 | Ga0070688_100075274 | Ga0070688_1000752743 | 189 |
| 62 | 3300005440 | Ga0070705_100042862 | Ga0070705_1000428621 | 189 |
| 63 | 3300005543 | Ga0070672_100397011 | Ga0070672_1003970112 | 189 |
| 64 | 3300005544 | Ga0070686_100016945 | Ga0070686_1000169455 | 189 |
| 65 | 3300005547 | Ga0070693_100290577 | Ga0070693_1002905772 | 189 |
| 66 | 3300005577 | Ga0068857_100203114 | Ga0068857_1002031142 | 189 |
| 67 | 3300005617 | Ga0068859_100019346 | Ga0068859_1000193462 | 189 |
| 68 | 3300005617 | Ga0068859_100148037 | Ga0068859_1001480372 | 189 |
| 69 | 3300005618 | Ga0068864_100801550 | Ga0068864_1008015502 | 189 |
| 70 | 3300005841 | Ga0068863_100050103 | Ga0068863_1000501032 | 189 |
| 71 | 3300005841 | Ga0068863_100302865 | Ga0068863_1003028652 | 189 |
| 72 | 3300005842 | Ga0068858_100864498 | Ga0068858_1008644981 | 189 |
| 73 | 3300005844 | Ga0068862_100149676 | Ga0068862_1001496763 | 189 |
| 74 | 3300006237 | Ga0097621_100030189 | Ga0097621_1000301894 | 189 |
| 75 | 3300006852 | Ga0075433_10445091 | Ga0075433_104450911 | 189 |
| 76 | 3300006931 | Ga0097620_100019348 | Ga0097620_1000193482 | 189 |
| 77 | 3300006931 | Ga0097620_100148026 | Ga0097620_1001480263 | 189 |
| 78 | 3300009101 | Ga0105247_10444445 | Ga0105247_104444452 | 189 |
| 79 | 3300009147 | Ga0114129_10260535 | Ga0114129_102605354 | 189 |
| 80 | 3300009148 | Ga0105243_10967708 | Ga0105243_109677081 | 189 |
| 81 | 3300009177 | Ga0105248_10177178 | Ga0105248_101771783 | 189 |
| 82 | 3300009553 | Ga0105249_10485363 | Ga0105249_104853631 | 189 |
| 83 | 3300010375 | Ga0105239_10639418 | Ga0105239_106394182 | 189 |
| 84 | 3300011119 | Ga0105246_10072009 | Ga0105246_100720093 | 189 |
| 85 | 3300013296 | Ga0157374_10067013 | Ga0157374_100670132 | 189 |
| 86 | 3300013297 | Ga0157378_10540643 | Ga0157378_105406432 | 189 |
| 87 | 3300013306 | Ga0163162_11232271 | Ga0163162_112322712 | 189 |
| 88 | 3300013308 | Ga0157375_12016176 | Ga0157375_120161761 | 189 |
| 89 | 3300014325 | Ga0163163_11068070 | Ga0163163_110680702 | 189 |
| 90 | 3300014745 | Ga0157377_10113379 | Ga0157377_101133791 | 189 |
| 91 | 3300014969 | Ga0157376_10040634 | Ga0157376_100406342 | 189 |
| 92 | 3300017792 | Ga0163161_10001678 | Ga0163161_100016784 | 189 |
| 93 | 3300025315 | Ga0207697_10019796 | Ga0207697_100197961 | 189 |
| 94 | 3300025899 | Ga0207642_10638230 | Ga0207642_106382301 | 189 |
| 95 | 3300025904 | Ga0207647_10298697 | Ga0207647_102986971 | 189 |
| 96 | 3300025918 | Ga0207662_10013507 | Ga0207662_100135075 | 189 |
| 97 | 3300025926 | Ga0207659_10240791 | Ga0207659_102407912 | 189 |
| 98 | 3300025927 | Ga0207687_10030951 | Ga0207687_100309514 | 189 |
| 99 | 3300025940 | Ga0207691_10029596 | Ga0207691_100295962 | 189 |
| 100 | 3300025941 | Ga0207711_11114704 | Ga0207711_111147041 | 189 |
| 101 | 3300025942 | Ga0207689_10008514 | Ga0207689_100085142 | 189 |
| 102 | 3300025960 | Ga0207651_10426013 | Ga0207651_104260132 | 189 |
| 103 | 3300025961 | Ga0207712_10039633 | Ga0207712_100396331 | 189 |
| 104 | 3300025961 | Ga0207712_10145283 | Ga0207712_101452832 | 189 |
| 105 | 3300026023 | Ga0207677_10581379 | Ga0207677_105813791 | 189 |
| 106 | 3300026088 | Ga0207641_10136844 | Ga0207641_101368442 | 189 |
| 107 | 3300026088 | Ga0207641_10695490 | Ga0207641_106954901 | 189 |
| 108 | 3300026095 | Ga0207676_10514473 | Ga0207676_105144732 | 189 |
| 109 | 3300026095 | Ga0207676_10691133 | Ga0207676_106911331 | 189 |
| 110 | 3300026095 | Ga0207676_10791726 | Ga0207676_107917261 | 189 |
| 111 | 3300026116 | Ga0207674_10219843 | Ga0207674_102198432 | 189 |
| 112 | 3300026142 | Ga0207698_10973695 | Ga0207698_109736951 | 189 |
| 113 | 3300027907 | Ga0207428_10006541 | Ga0207428_1000654111 | 189 |
| 114 | 3300028380 | Ga0268265_10305481 | Ga0268265_103054812 | 189 |
| 115 | 3300035242 | Ga0373962_0100325 | Ga0373962_0100325_15_593 | 189 |
| 116 | 3300050507 | nmdc:mga05p37_195978_c1 | nmdc:mga05p37_195978_c1_1761_2330 | 189 |
| 117 | 3300050508 | nmdc:mga09592_1058102_c1 | nmdc:mga09592_1058102_c1_90_659 | 189 |
| 118 | 3300050508 | nmdc:mga09592_878387_c1 | nmdc:mga09592_878387_c1_103_672 | 189 |
| 119 | 3300050511 | nmdc:mga08y16_88831_c1 | nmdc:mga08y16_88831_c1_2476_3054 | 189 |
| 120 | 3300050515 | nmdc:mga0a205_206377_c2 | nmdc:mga0a205_206377_c2_490_1068 | 189 |
| 121 | 2162886011 | MRS1b_contig_2185856 | MRS1b_0630.00002290 | 190 |
| 122 | 3300005290 | Ga0065712_10000113 | Ga0065712_1000011329 | 190 |
| 123 | 3300005293 | Ga0065715_10099112 | Ga0065715_100991122 | 190 |
| 124 | 3300005295 | Ga0065707_10128746 | Ga0065707_101287463 | 190 |
| 125 | 3300005334 | Ga0068869_100171435 | Ga0068869_1001714352 | 190 |
| 126 | 3300005334 | Ga0068869_100348343 | Ga0068869_1003483431 | 190 |
| 127 | 3300005336 | Ga0070680_100019946 | Ga0070680_1000199462 | 190 |
| 128 | 3300005337 | Ga0070682_100009886 | Ga0070682_1000098866 | 190 |
| 129 | 3300005340 | Ga0070689_100319633 | Ga0070689_1003196331 | 190 |
| 130 | 3300005340 | Ga0070689_100391334 | Ga0070689_1003913342 | 190 |
| 131 | 3300005345 | Ga0070692_10029802 | Ga0070692_100298021 | 190 |
| 132 | 3300005365 | Ga0070688_100165842 | Ga0070688_1001658422 | 190 |
| 133 | 3300005438 | Ga0070701_10410677 | Ga0070701_104106772 | 190 |
| 134 | 3300005441 | Ga0070700_100064306 | Ga0070700_1000643064 | 190 |
| 135 | 3300005444 | Ga0070694_100120772 | Ga0070694_1001207722 | 190 |
| 136 | 3300005444 | Ga0070694_100521639 | Ga0070694_1005216391 | 190 |
| 137 | 3300005445 | Ga0070708_100000257 | Ga0070708_10000025736 | 190 |
| 138 | 3300005458 | Ga0070681_10002499 | Ga0070681_1000249917 | 190 |
| 139 | 3300005458 | Ga0070681_10321599 | Ga0070681_103215992 | 190 |
| 140 | 3300005459 | Ga0068867_100396356 | Ga0068867_1003963562 | 190 |
| 141 | 3300005467 | Ga0070706_100171328 | Ga0070706_1001713282 | 190 |
| 142 | 3300005467 | Ga0070706_100193945 | Ga0070706_1001939451 | 190 |
| 143 | 3300005468 | Ga0070707_100052644 | Ga0070707_1000526445 | 190 |
| 144 | 3300005471 | Ga0070698_100048348 | Ga0070698_1000483485 | 190 |
| 145 | 3300005518 | Ga0070699_100000196 | Ga0070699_10000019648 | 190 |
| 146 | 3300005518 | Ga0070699_100351034 | Ga0070699_1003510342 | 190 |
| 147 | 3300005530 | Ga0070679_100230130 | Ga0070679_1002301303 | 190 |
| 148 | 3300005536 | Ga0070697_100059747 | Ga0070697_1000597474 | 190 |
| 149 | 3300005536 | Ga0070697_100226469 | Ga0070697_1002264692 | 190 |
| 150 | 3300005536 | Ga0070697_100671843 | Ga0070697_1006718431 | 190 |
| 151 | 3300005546 | Ga0070696_100056951 | Ga0070696_1000569511 | 190 |
| 152 | 3300005546 | Ga0070696_100165465 | Ga0070696_1001654652 | 190 |
| 153 | 3300005546 | Ga0070696_100459401 | Ga0070696_1004594011 | 190 |
| 154 | 3300005546 | Ga0070696_101067073 | Ga0070696_1010670731 | 190 |
| 155 | 3300005547 | Ga0070693_100143455 | Ga0070693_1001434551 | 190 |
| 156 | 3300005547 | Ga0070693_100370921 | Ga0070693_1003709212 | 190 |
| 157 | 3300005549 | Ga0070704_100576471 | Ga0070704_1005764711 | 190 |
| 158 | 3300005564 | Ga0070664_100135283 | Ga0070664_1001352834 | 190 |
| 159 | 3300005564 | Ga0070664_100576912 | Ga0070664_1005769121 | 190 |
| 160 | 3300005615 | Ga0070702_100097248 | Ga0070702_1000972482 | 190 |
| 161 | 3300005615 | Ga0070702_100117490 | Ga0070702_1001174902 | 190 |
| 162 | 3300005615 | Ga0070702_100254938 | Ga0070702_1002549382 | 190 |
| 163 | 3300005616 | Ga0068852_101185279 | Ga0068852_1011852791 | 190 |
| 164 | 3300005617 | Ga0068859_100052957 | Ga0068859_1000529575 | 190 |
| 165 | 3300005617 | Ga0068859_100066256 | Ga0068859_1000662563 | 190 |
| 166 | 3300005617 | Ga0068859_100281227 | Ga0068859_1002812272 | 190 |
| 167 | 3300005617 | Ga0068859_100495027 | Ga0068859_1004950271 | 190 |
| 168 | 3300005618 | Ga0068864_100062532 | Ga0068864_1000625322 | 190 |
| 169 | 3300005618 | Ga0068864_100288216 | Ga0068864_1002882162 | 190 |
| 170 | 3300005618 | Ga0068864_100344703 | Ga0068864_1003447032 | 190 |
| 171 | 3300005618 | Ga0068864_100983977 | Ga0068864_1009839771 | 190 |
| 172 | 3300005719 | Ga0068861_100240652 | Ga0068861_1002406522 | 190 |
| 173 | 3300005841 | Ga0068863_100111360 | Ga0068863_1001113601 | 190 |
| 174 | 3300005841 | Ga0068863_100233466 | Ga0068863_1002334662 | 190 |
| 175 | 3300005842 | Ga0068858_100386790 | Ga0068858_1003867901 | 190 |
| 176 | 3300005843 | Ga0068860_100046825 | Ga0068860_1000468255 | 190 |
| 177 | 3300005843 | Ga0068860_100074096 | Ga0068860_1000740963 | 190 |
| 178 | 3300005843 | Ga0068860_100243234 | Ga0068860_1002432342 | 190 |
| 179 | 3300005843 | Ga0068860_101142532 | Ga0068860_1011425322 | 190 |
| 180 | 3300005844 | Ga0068862_101450844 | Ga0068862_1014508441 | 190 |
| 181 | 3300005985 | Ga0081539_10177955 | Ga0081539_101779552 | 190 |
| 182 | 3300006163 | Ga0070715_10498246 | Ga0070715_104982461 | 190 |
| 183 | 3300006237 | Ga0097621_100213178 | Ga0097621_1002131782 | 190 |
| 184 | 3300006237 | Ga0097621_100687031 | Ga0097621_1006870311 | 190 |
| 185 | 3300006358 | Ga0068871_100006877 | Ga0068871_1000068774 | 190 |
| 186 | 3300006844 | Ga0075428_100215833 | Ga0075428_1002158332 | 190 |
| 187 | 3300006846 | Ga0075430_100257464 | Ga0075430_1002574642 | 190 |
| 188 | 3300006847 | Ga0075431_100435675 | Ga0075431_1004356752 | 190 |
| 189 | 3300006852 | Ga0075433_10036475 | Ga0075433_100364752 | 190 |
| 190 | 3300006852 | Ga0075433_10249366 | Ga0075433_102493662 | 190 |
| 191 | 3300006871 | Ga0075434_100268088 | Ga0075434_1002680882 | 190 |
| 192 | 3300006880 | Ga0075429_100392496 | Ga0075429_1003924962 | 190 |
| 193 | 3300006881 | Ga0068865_100124383 | Ga0068865_1001243832 | 190 |
| 194 | 3300006931 | Ga0097620_100052956 | Ga0097620_1000529565 | 190 |
| 195 | 3300006931 | Ga0097620_100066258 | Ga0097620_1000662583 | 190 |
| 196 | 3300006931 | Ga0097620_100281223 | Ga0097620_1002812232 | 190 |
| 197 | 3300006931 | Ga0097620_100494967 | Ga0097620_1004949672 | 190 |
| 198 | 3300006931 | Ga0097620_100900956 | Ga0097620_1009009562 | 190 |
| 199 | 3300009101 | Ga0105247_10076549 | Ga0105247_100765491 | 190 |
| 200 | 3300009147 | Ga0114129_10036154 | Ga0114129_100361547 | 190 |
| 201 | 3300009148 | Ga0105243_10000073 | Ga0105243_1000007331 | 190 |
| 202 | 3300009148 | Ga0105243_10263501 | Ga0105243_102635012 | 190 |
| 203 | 3300009148 | Ga0105243_11213382 | Ga0105243_112133821 | 190 |
| 204 | 3300009176 | Ga0105242_10000043 | Ga0105242_1000004352 | 190 |
| 205 | 3300009176 | Ga0105242_10350941 | Ga0105242_103509412 | 190 |
| 206 | 3300009177 | Ga0105248_10026801 | Ga0105248_100268014 | 190 |
| 207 | 3300009177 | Ga0105248_10516102 | Ga0105248_105161022 | 190 |
| 208 | 3300009177 | Ga0105248_10774844 | Ga0105248_107748442 | 190 |
| 209 | 3300009177 | Ga0105248_10904016 | Ga0105248_109040162 | 190 |
| 210 | 3300009177 | Ga0105248_10959803 | Ga0105248_109598032 | 190 |
| 211 | 3300009545 | Ga0105237_10269121 | Ga0105237_102691213 | 190 |
| 212 | 3300009551 | Ga0105238_10074314 | Ga0105238_100743144 | 190 |
| 213 | 3300009553 | Ga0105249_10014488 | Ga0105249_100144886 | 190 |
| 214 | 3300011119 | Ga0105246_10504967 | Ga0105246_105049672 | 190 |
| 215 | 3300013297 | Ga0157378_10237382 | Ga0157378_102373822 | 190 |
| 216 | 3300013297 | Ga0157378_10730996 | Ga0157378_107309962 | 190 |
| 217 | 3300013297 | Ga0157378_11137101 | Ga0157378_111371012 | 190 |
| 218 | 3300013297 | Ga0157378_12069833 | Ga0157378_120698331 | 190 |
| 219 | 3300013306 | Ga0163162_10708144 | Ga0163162_107081442 | 190 |
| 220 | 3300013307 | Ga0157372_10164612 | Ga0157372_101646124 | 190 |
| 221 | 3300013308 | Ga0157375_10608974 | Ga0157375_106089742 | 190 |
| 222 | 3300014325 | Ga0163163_10482989 | Ga0163163_104829892 | 190 |
| 223 | 3300014325 | Ga0163163_10487506 | Ga0163163_104875061 | 190 |
| 224 | 3300014325 | Ga0163163_10953278 | Ga0163163_109532781 | 190 |
| 225 | 3300014326 | Ga0157380_10616012 | Ga0157380_106160121 | 190 |
| 226 | 3300017792 | Ga0163161_10172935 | Ga0163161_101729352 | 190 |
| 227 | 3300025885 | Ga0207653_10000208 | Ga0207653_1000020832 | 190 |
| 228 | 3300025900 | Ga0207710_10087521 | Ga0207710_100875212 | 190 |
| 229 | 3300025900 | Ga0207710_10196654 | Ga0207710_101966542 | 190 |
| 230 | 3300025904 | Ga0207647_10000801 | Ga0207647_100008018 | 190 |
| 231 | 3300025912 | Ga0207707_10000008 | Ga0207707_10000008135 | 190 |
| 232 | 3300025917 | Ga0207660_10001514 | Ga0207660_100015148 | 190 |
| 233 | 3300025918 | Ga0207662_10323549 | Ga0207662_103235492 | 190 |
| 234 | 3300025921 | Ga0207652_10000065 | Ga0207652_1000006535 | 190 |
| 235 | 3300025922 | Ga0207646_10185766 | Ga0207646_101857662 | 190 |
| 236 | 3300025924 | Ga0207694_10015368 | Ga0207694_100153686 | 190 |
| 237 | 3300025934 | Ga0207686_10000003 | Ga0207686_1000000371 | 190 |
| 238 | 3300025935 | Ga0207709_10403791 | Ga0207709_104037912 | 190 |
| 239 | 3300025935 | Ga0207709_10710704 | Ga0207709_107107042 | 190 |
| 240 | 3300025936 | Ga0207670_10327682 | Ga0207670_103276821 | 190 |
| 241 | 3300025936 | Ga0207670_10485028 | Ga0207670_104850282 | 190 |
| 242 | 3300025938 | Ga0207704_10129676 | Ga0207704_101296762 | 190 |
| 243 | 3300025941 | Ga0207711_10059543 | Ga0207711_100595434 | 190 |
| 244 | 3300025941 | Ga0207711_10251501 | Ga0207711_102515012 | 190 |
| 245 | 3300025941 | Ga0207711_10401894 | Ga0207711_104018941 | 190 |
| 246 | 3300025941 | Ga0207711_10913168 | Ga0207711_109131681 | 190 |
| 247 | 3300025942 | Ga0207689_10141831 | Ga0207689_101418312 | 190 |
| 248 | 3300025942 | Ga0207689_10150252 | Ga0207689_101502523 | 190 |
| 249 | 3300025945 | Ga0207679_10177513 | Ga0207679_101775132 | 190 |
| 250 | 3300025961 | Ga0207712_10022869 | Ga0207712_100228693 | 190 |
| 251 | 3300026035 | Ga0207703_10365248 | Ga0207703_103652481 | 190 |
| 252 | 3300026035 | Ga0207703_10420026 | Ga0207703_104200262 | 190 |
| 253 | 3300026041 | Ga0207639_10943140 | Ga0207639_109431402 | 190 |
| 254 | 3300026075 | Ga0207708_10063206 | Ga0207708_100632064 | 190 |
| 255 | 3300026088 | Ga0207641_10033932 | Ga0207641_100339324 | 190 |
| 256 | 3300026088 | Ga0207641_10381755 | Ga0207641_103817552 | 190 |
| 257 | 3300026088 | Ga0207641_11059349 | Ga0207641_110593491 | 190 |
| 258 | 3300026095 | Ga0207676_10063861 | Ga0207676_100638612 | 190 |
| 259 | 3300026095 | Ga0207676_10076070 | Ga0207676_100760702 | 190 |
| 260 | 3300026095 | Ga0207676_10399439 | Ga0207676_103994392 | 190 |
| 261 | 3300026095 | Ga0207676_10773520 | Ga0207676_107735201 | 190 |
| 262 | 3300026118 | Ga0207675_100084200 | Ga0207675_1000842002 | 190 |
| 263 | 3300026118 | Ga0207675_100839519 | Ga0207675_1008395191 | 190 |
| 264 | 3300028381 | Ga0268264_10056173 | Ga0268264_100561732 | 190 |
| 265 | 3300028381 | Ga0268264_10767095 | Ga0268264_107670952 | 190 |
| 266 | 3300031548 | Ga0307408_100008536 | Ga0307408_1000085367 | 190 |
| 267 | 3300031731 | Ga0307405_10005314 | Ga0307405_100053147 | 190 |
| 268 | 3300031852 | Ga0307410_10013332 | Ga0307410_100133322 | 190 |
| 269 | 3300031901 | Ga0307406_10019733 | Ga0307406_100197335 | 190 |
| 270 | 3300031903 | Ga0307407_10064842 | Ga0307407_100648423 | 190 |
| 271 | 3300031911 | Ga0307412_10041141 | Ga0307412_100411412 | 190 |
| 272 | 3300031995 | Ga0307409_100293769 | Ga0307409_1002937691 | 190 |
| 273 | 3300032002 | Ga0307416_100022011 | Ga0307416_1000220115 | 190 |
| 274 | 3300032004 | Ga0307414_10011521 | Ga0307414_100115216 | 190 |
| 275 | 3300032126 | Ga0307415_100022075 | Ga0307415_1000220752 | 190 |
| 276 | 3300035091 | Ga0373951_0026780 | Ga0373951_0026780_592_1173 | 190 |
| 277 | 3300035115 | Ga0373941_0167208 | Ga0373941_0167208_193_774 | 190 |
| 278 | 3300038443 | Ga0395901_1100102 | Ga0395901_1100102_156_734 | 190 |
| 279 | 3300044673 | Ga0453683_0340894 | Ga0453683_0340894_40_612 | 190 |
| 280 | 3300048915 | Ga0496112_0558323 | Ga0496112_0558323_305_877 | 190 |
| 281 | 3300049514 | Ga0501291_002547 | Ga0501291_002547_693_1274 | 190 |
| 282 | 3300049521 | Ga0501298_001083 | Ga0501298_001083_2715_3296 | 190 |
| 283 | 3300049649 | Ga0501198_001885 | Ga0501198_001885_1460_2041 | 190 |
| 284 | 3300049652 | Ga0501202_000580 | Ga0501202_000580_2586_3167 | 190 |
| 285 | 3300049654 | Ga0501207_000815 | Ga0501207_000815_436_1017 | 190 |
| 286 | 3300049656 | Ga0501209_041140 | Ga0501209_041140_282_863 | 190 |
| 287 | 3300049656 | Ga0501209_122612 | Ga0501209_122612_118_690 | 190 |
| 288 | 3300049660 | Ga0501216_000491 | Ga0501216_000491_1289_1870 | 190 |
| 289 | 3300049661 | Ga0501217_001018 | Ga0501217_001018_590_1171 | 190 |
| 290 | 3300049663 | Ga0501223_001811 | Ga0501223_001811_3631_4212 | 190 |
| 291 | 3300049664 | Ga0501224_000348 | Ga0501224_000348_1251_1832 | 190 |
| 292 | 3300049664 | Ga0501224_008620 | Ga0501224_008620_216_788 | 190 |
| 293 | 3300049665 | Ga0501227_001393 | Ga0501227_001393_3445_4026 | 190 |
| 294 | 3300049666 | Ga0501228_002920 | Ga0501228_002920_757_1338 | 190 |
| 295 | 3300049667 | Ga0501230_000408 | Ga0501230_000408_836_1417 | 190 |
| 296 | 3300049668 | Ga0501233_005174 | Ga0501233_005174_1090_1671 | 190 |
| 297 | 3300049668 | Ga0501233_008759 | Ga0501233_008759_570_1142 | 190 |
| 298 | 3300049670 | Ga0501236_003196 | Ga0501236_003196_694_1275 | 190 |
| 299 | 3300049672 | Ga0501239_005452 | Ga0501239_005452_648_1229 | 190 |
| 300 | 3300049675 | Ga0501243_007057 | Ga0501243_007057_473_1054 | 190 |
| 301 | 3300049676 | Ga0501246_006398 | Ga0501246_006398_208_789 | 190 |
| 302 | 3300049679 | Ga0501249_006008 | Ga0501249_006008_1372_1953 | 190 |
| 303 | 3300049679 | Ga0501249_013989 | Ga0501249_013989_260_832 | 190 |
| 304 | 3300049680 | Ga0501250_036011 | Ga0501250_036011_63_644 | 190 |
| 305 | 3300049681 | Ga0501251_017639 | Ga0501251_017639_220_801 | 190 |
| 306 | 3300049682 | Ga0501252_018587 | Ga0501252_018587_295_867 | 190 |
| 307 | 3300049683 | Ga0501253_001693 | Ga0501253_001693_501_1082 | 190 |
| 308 | 3300049685 | Ga0501256_000074 | Ga0501256_000074_4077_4658 | 190 |
| 309 | 3300049686 | Ga0501257_012107 | Ga0501257_012107_19_600 | 190 |
| 310 | 3300049688 | Ga0501259_003107 | Ga0501259_003107_1462_2043 | 190 |
| 311 | 3300049689 | Ga0501260_001047 | Ga0501260_001047_1080_1661 | 190 |
| 312 | 3300049689 | Ga0501260_001969 | Ga0501260_001969_296_868 | 190 |
| 313 | 3300049704 | Ga0501221_001028 | Ga0501221_001028_804_1385 | 190 |
| 314 | 3300049705 | Ga0501225_0001087 | Ga0501225_0001087_3241_3822 | 190 |
| 315 | 3300049706 | Ga0501229_001225 | Ga0501229_001225_1327_1908 | 190 |
| 316 | 3300049707 | Ga0501234_000731 | Ga0501234_000731_3644_4225 | 190 |
| 317 | 3300049708 | Ga0501245_003157 | Ga0501245_003157_53_634 | 190 |
| 318 | 3300049759 | Ga0501262_027976 | Ga0501262_027976_150_731 | 190 |
| 319 | 3300049765 | Ga0501268_005113 | Ga0501268_005113_530_1111 | 190 |
| 320 | 3300049767 | Ga0501270_008801 | Ga0501270_008801_423_1004 | 190 |
| 321 | 3300049769 | Ga0501272_012843 | Ga0501272_012843_302_883 | 190 |
| 322 | 3300049770 | Ga0501273_015232 | Ga0501273_015232_65_646 | 190 |
| 323 | 3300049779 | Ga0501283_009319 | Ga0501283_009319_532_1113 | 190 |
| 324 | 3300049850 | Ga0501204_008496 | Ga0501204_008496_473_1054 | 190 |
| 325 | 3300049851 | Ga0501212_001066 | Ga0501212_001066_1766_2338 | 190 |
| 326 | 3300049853 | Ga0501226_000806 | Ga0501226_000806_2696_3277 | 190 |
| 327 | 3300050508 | nmdc:mga09592_672499_c1 | nmdc:mga09592_672499_c1_179_751 | 190 |
| 328 | 3300050509 | nmdc:mga0qj67_739569_c1 | nmdc:mga0qj67_739569_c1_130_708 | 190 |
| 329 | 3300050510 | nmdc:mga06r32_1021018_c1 | nmdc:mga06r32_1021018_c1_101_679 | 190 |
| 330 | 3300050510 | nmdc:mga06r32_364112_c1 | nmdc:mga06r32_364112_c1_343_915 | 190 |
| 331 | 3300050511 | nmdc:mga08y16_98762_c1 | nmdc:mga08y16_98762_c1_171_743 | 190 |
| 332 | 3300050512 | nmdc:mga0n895_1055657_c1 | nmdc:mga0n895_1055657_c1_50_628 | 190 |
| 333 | 3300050512 | nmdc:mga0n895_172753_c1 | nmdc:mga0n895_172753_c1_1198_1779 | 190 |
| 334 | 3300050515 | nmdc:mga0a205_166685_c1 | nmdc:mga0a205_166685_c1_1440_2021 | 190 |
| 335 | 3300050515 | nmdc:mga0a205_297351_c1 | nmdc:mga0a205_297351_c1_11_589 | 190 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4p3n-assembly1.cif.gz_B | structural basis for full-spectrum inhibition of threonyl-trna synthetase by borrelidin 1 | 0.8019 | 123 | 154 |
| 1wdj-assembly1.cif.gz_B | crystal structure of tt1808 from thermus thermophilus hb8 | 0.7724 | 37 | 188 |
| 1wdj-assembly1.cif.gz_B | crystal structure of tt1808 from thermus thermophilus hb8 | 0.7678 | 37 | 188 |
| 6okh-assembly1.cif.gz_B | structure of an uncharacterized protein from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) | 0.7623 | 12 | 190 |
| 6okh-assembly1.cif.gz_B | structure of an uncharacterized protein from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) | 0.7543 | 12 | 190 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AA99_43_186_2.40.440.10 | Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like | 0.8046 | 139 | 163 | 2.40.440.10 |
| 1wdjB00 | Alpha Beta;Alpha-Beta Complex;tt1808, chain A;tt1808, chain A | 0.7724 | 37 | 188 | 3.90.1570.10 |
| 1wdjB00 | Alpha Beta;Alpha-Beta Complex;tt1808, chain A;tt1808, chain A | 0.7678 | 37 | 188 | 3.90.1570.10 |
| af_A0A1D8PRZ3_426_574_3.40.50.800 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain | 0.7669 | 123 | 157 | 3.40.50.800 |
| af_Q4DDN8_1_121_3.30.450.50 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Longin domain | 0.7509 | 138 | 170 | 3.30.450.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9PEV6-F1-model_v4 | Putative restriction endonuclease domain-containing protein | 0.9399 | 78 | 190 |
|
| AF-A0A2V9PEV6-F1-model_v4 | Putative restriction endonuclease domain-containing protein | 0.932 | 78 | 190 |
|
| AF-A0A2V8KWI1-F1-model_v4 | Putative restriction endonuclease domain-containing protein | 0.9187 | 45 | 189 |
|
| AF-X1H0V4-F1-model_v4 | Putative restriction endonuclease domain-containing protein | 0.9167 | 110 | 189 |
|
| AF-A0A2V8KWI1-F1-model_v4 | Putative restriction endonuclease domain-containing protein | 0.9126 | 45 | 189 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar