F412152

General Info

Members Datasets Scaffolds Average Seq Length
335 184 335 190

Family's Representative Sequence

Representative Sequence 3300005549|Ga0070704_100576471|Ga0070704_1005764711
Length 218
Sequence LEGVVWRSPETTNRWYTPIESAVRKGLVMAWVNTSPLVKTYTLEEFWELPEPPDGSKIELIAGVLYMTPPPDYTHNNAVSRLNSHLIVHMFTIGDKGRIYIPRAAIWTSPNTYLEPDLFYVSAELLGRQNPVHLTTADLVVEVISPGSAIYDRNTKADTYGALGVRELWLIDEKSQSVEVRNQTGTGFGAGVVFKGSEQIVSQVFPTLDLPVYKLFTD

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
131 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
132 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
135 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
138 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
139 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
140 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
141 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
142 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
143 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
144 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
145 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
146 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
147 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
148 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
149 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
150 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
151 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
152 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
153 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
154 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
155 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
156 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
157 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
158 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
159 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
160 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
161 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
162 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
163 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
164 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
165 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
166 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
167 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
168 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
169 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
170 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
171 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
172 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
173 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
174 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
175 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
176 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
177 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
180 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
181 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
184 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.6
Rhizosphere 99.4
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_2185856 2162886011 Unclassified 1531
2 JGI25406J46586_10001573 3300003203 Bacteria 10766
3 Ga0065704_10001508 3300005289 Bacteria 7472
4 Ga0065712_10000113 3300005290 Bacteria 191931
5 Ga0065712_10037135 3300005290 Unclassified 906
6 Ga0065712_10068986 3300005290 Bacteria 8371
7 Ga0065715_10040718 3300005293 Unclassified 1085
8 Ga0065715_10099112 3300005293 Bacteria 3456
9 Ga0065715_10143354 3300005293 Bacteria 1815
10 Ga0065715_10279870 3300005293 Bacteria 1062
11 Ga0065707_10002161 3300005295 Bacteria 6481
12 Ga0065707_10128746 3300005295 Unclassified 1940
13 Ga0065707_10134166 3300005295 Bacteria 1869
14 Ga0070677_10268841 3300005333 Unclassified 854
15 Ga0068869_100171435 3300005334 Unclassified 1695
16 Ga0068869_100348343 3300005334 Bacteria 1207
17 Ga0070680_100019946 3300005336 Bacteria 5314
18 Ga0070682_100009886 3300005337 Bacteria 5402
19 Ga0070689_100319633 3300005340 Unclassified 1296
20 Ga0070689_100391334 3300005340 Unclassified 1173
21 Ga0070689_100503644 3300005340 Unclassified 1038
22 Ga0070689_100814903 3300005340 Unclassified 821
23 Ga0070687_100046684 3300005343 Bacteria 2218
24 Ga0070692_10029802 3300005345 Bacteria 2723
25 Ga0070675_100121724 3300005354 Unclassified 2217
26 Ga0070673_100281797 3300005364 Bacteria 1458
27 Ga0070688_100075274 3300005365 Unclassified 2169
28 Ga0070688_100165842 3300005365 Unclassified 1521
29 Ga0070701_10410677 3300005438 Unclassified 860
30 Ga0070705_100042862 3300005440 Bacteria 2590
31 Ga0070700_100064306 3300005441 Bacteria 2323
32 Ga0070694_100120772 3300005444 Unclassified 1880
33 Ga0070694_100521639 3300005444 Unclassified 948
34 Ga0070708_100000257 3300005445 Bacteria 39748
35 Ga0070681_10002499 3300005458 Bacteria 16842
36 Ga0070681_10321599 3300005458 Unclassified 1457
37 Ga0068867_100396356 3300005459 Unclassified 1163
38 Ga0068867_100758367 3300005459 Unclassified 862
39 Ga0070706_100171328 3300005467 Bacteria 2027
40 Ga0070706_100193945 3300005467 Bacteria 1898
41 Ga0070706_101324596 3300005467 Unclassified 660
42 Ga0070707_100052644 3300005468 Bacteria 3903
43 Ga0070698_100048348 3300005471 Unclassified 4346
44 Ga0070699_100000196 3300005518 Bacteria 59314
45 Ga0070699_100351034 3300005518 Unclassified 1329
46 Ga0070679_100230130 3300005530 Bacteria 1813
47 Ga0070697_100059747 3300005536 Bacteria 3105
48 Ga0070697_100226469 3300005536 Bacteria 1594
49 Ga0070697_100671843 3300005536 Unclassified 913
50 Ga0068853_100538922 3300005539 Unclassified 1105
51 Ga0068853_101240928 3300005539 Bacteria 720
52 Ga0070672_100397011 3300005543 Bacteria 1181
53 Ga0070686_100016945 3300005544 Bacteria 4247
54 Ga0070695_100488093 3300005545 Unclassified 950
55 Ga0070696_100056951 3300005546 Bacteria 2727
56 Ga0070696_100165465 3300005546 Unclassified 1632
57 Ga0070696_100459401 3300005546 Unclassified 1006
58 Ga0070696_101067073 3300005546 Unclassified 678
59 Ga0070693_100143455 3300005547 Bacteria 1506
60 Ga0070693_100290577 3300005547 Unclassified 1098
61 Ga0070693_100370921 3300005547 Unclassified 985
62 Ga0070704_100576471 3300005549 Bacteria 986
63 Ga0070664_100135283 3300005564 Unclassified 2167
64 Ga0070664_100576912 3300005564 Unclassified 1042
65 Ga0068857_100203114 3300005577 Unclassified 1807
66 Ga0070702_100097248 3300005615 Unclassified 1798
67 Ga0070702_100117490 3300005615 Unclassified 1659
68 Ga0070702_100254938 3300005615 Bacteria 1191
69 Ga0068852_100136045 3300005616 Unclassified 2269
70 Ga0068852_101185279 3300005616 Unclassified 785
71 Ga0068859_100019346 3300005617 Bacteria 6841
72 Ga0068859_100052354 3300005617 Unclassified 4104
73 Ga0068859_100052957 3300005617 Unclassified 4081
74 Ga0068859_100066256 3300005617 Unclassified 3646
75 Ga0068859_100083521 3300005617 Bacteria 3237
76 Ga0068859_100148037 3300005617 Unclassified 2423
77 Ga0068859_100281227 3300005617 Bacteria 1757
78 Ga0068859_100495027 3300005617 Unclassified 1318
79 Ga0068859_101058987 3300005617 Unclassified 892
80 Ga0068859_102014031 3300005617 Unclassified 638
81 Ga0068864_100062532 3300005618 Unclassified 3225
82 Ga0068864_100288216 3300005618 Unclassified 1534
83 Ga0068864_100292184 3300005618 Bacteria 1524
84 Ga0068864_100344703 3300005618 Bacteria 1404
85 Ga0068864_100801550 3300005618 Bacteria 926
86 Ga0068864_100983977 3300005618 Unclassified 836
87 Ga0068866_10739908 3300005718 Unclassified 678
88 Ga0068861_100240652 3300005719 Bacteria 1539
89 Ga0068863_100050103 3300005841 Unclassified 3960
90 Ga0068863_100061668 3300005841 Bacteria 3546
91 Ga0068863_100111360 3300005841 Unclassified 2607
92 Ga0068863_100233466 3300005841 Unclassified 1775
93 Ga0068863_100302865 3300005841 Bacteria 1551
94 Ga0068858_100057725 3300005842 Bacteria 3587
95 Ga0068858_100075892 3300005842 Unclassified 3123
96 Ga0068858_100386790 3300005842 Bacteria 1343
97 Ga0068858_100864498 3300005842 Unclassified 883
98 Ga0068860_100046825 3300005843 Bacteria 4122
99 Ga0068860_100074096 3300005843 Bacteria 3236
100 Ga0068860_100135372 3300005843 Bacteria 2366
101 Ga0068860_100149376 3300005843 Unclassified 2249
102 Ga0068860_100243234 3300005843 Bacteria 1751
103 Ga0068860_101142532 3300005843 Unclassified 799
104 Ga0068862_100149676 3300005844 Unclassified 2077
105 Ga0068862_101450844 3300005844 Unclassified 690
106 Ga0081539_10000408 3300005985 Bacteria 91634
107 Ga0081539_10177955 3300005985 Unclassified 1000
108 Ga0070715_10498246 3300006163 Bacteria 697
109 Ga0097621_100030189 3300006237 Unclassified 4288
110 Ga0097621_100213178 3300006237 Bacteria 1680
111 Ga0097621_100687031 3300006237 Unclassified 941
112 Ga0068871_100006877 3300006358 Bacteria 8099
113 Ga0075428_100215833 3300006844 Bacteria 2073
114 Ga0075430_100257464 3300006846 Unclassified 1445
115 Ga0075431_100435675 3300006847 Unclassified 1308
116 Ga0075433_10036475 3300006852 Bacteria 4236
117 Ga0075433_10249366 3300006852 Viruses 1575
118 Ga0075433_10445091 3300006852 Unclassified 1142
119 Ga0075434_100268088 3300006871 Bacteria 1727
120 Ga0075429_100392496 3300006880 Unclassified 1215
121 Ga0068865_100124383 3300006881 Unclassified 1923
122 Ga0097620_100019348 3300006931 Bacteria 6841
123 Ga0097620_100052354 3300006931 Unclassified 4104
124 Ga0097620_100052956 3300006931 Unclassified 4081
125 Ga0097620_100066258 3300006931 Unclassified 3646
126 Ga0097620_100083520 3300006931 Bacteria 3237
127 Ga0097620_100148026 3300006931 Unclassified 2423
128 Ga0097620_100281223 3300006931 Bacteria 1757
129 Ga0097620_100494967 3300006931 Unclassified 1318
130 Ga0097620_100900956 3300006931 Unclassified 969
131 Ga0097620_101059014 3300006931 Unclassified 892
132 Ga0097620_102014097 3300006931 Unclassified 638
133 Ga0105247_10076549 3300009101 Unclassified 2101
134 Ga0105247_10444445 3300009101 Unclassified 933
135 Ga0105247_10737466 3300009101 Unclassified 745
136 Ga0114129_10036154 3300009147 Bacteria 6975
137 Ga0114129_10260535 3300009147 Unclassified 2324
138 Ga0105243_10000073 3300009148 Bacteria 114756
139 Ga0105243_10263501 3300009148 Unclassified 1544
140 Ga0105243_10300049 3300009148 Unclassified 1456
141 Ga0105243_10967708 3300009148 Unclassified 851
142 Ga0105243_11213382 3300009148 Bacteria 768
143 Ga0105241_10124210 3300009174 Bacteria 2082
144 Ga0105242_10000043 3300009176 Bacteria 85748
145 Ga0105242_10350941 3300009176 Unclassified 1362
146 Ga0105248_10026801 3300009177 Bacteria 6411
147 Ga0105248_10177178 3300009177 Bacteria 2403
148 Ga0105248_10516102 3300009177 Unclassified 1347
149 Ga0105248_10774844 3300009177 Bacteria 1082
150 Ga0105248_10904016 3300009177 Unclassified 997
151 Ga0105248_10959803 3300009177 Unclassified 965
152 Ga0105237_10269121 3300009545 Bacteria 1707
153 Ga0105238_10074314 3300009551 Bacteria 3392
154 Ga0105249_10014488 3300009553 Bacteria 6970
155 Ga0105249_10485363 3300009553 Unclassified 1279
156 Ga0105239_10639418 3300010375 Unclassified 1215
157 Ga0105246_10072009 3300011119 Unclassified 2435
158 Ga0105246_10504967 3300011119 Unclassified 1028
159 Ga0105246_11462904 3300011119 Unclassified 640
160 Ga0157373_10060200 3300013100 Unclassified 2690
161 Ga0157374_10067013 3300013296 Unclassified 3374
162 Ga0157378_10237382 3300013297 Bacteria 1740
163 Ga0157378_10540643 3300013297 Unclassified 1169
164 Ga0157378_10730996 3300013297 Unclassified 1011
165 Ga0157378_11137101 3300013297 Bacteria 819
166 Ga0157378_12069833 3300013297 Unclassified 620
167 Ga0163162_10708144 3300013306 Unclassified 1128
168 Ga0163162_11232271 3300013306 Unclassified 849
169 Ga0157372_10164612 3300013307 Bacteria 2564
170 Ga0157372_10909688 3300013307 Bacteria 1021
171 Ga0157375_10608974 3300013308 Unclassified 1251
172 Ga0157375_11090228 3300013308 Bacteria 934
173 Ga0157375_12016176 3300013308 Unclassified 686
174 Ga0163163_10482989 3300014325 Unclassified 1300
175 Ga0163163_10487506 3300014325 Bacteria 1294
176 Ga0163163_10953278 3300014325 Unclassified 921
177 Ga0163163_11068070 3300014325 Bacteria 870
178 Ga0157380_10195355 3300014326 Unclassified 1790
179 Ga0157380_10616012 3300014326 Bacteria 1077
180 Ga0157377_10113379 3300014745 Bacteria 1633
181 Ga0157376_10040634 3300014969 Bacteria 3802
182 Ga0163161_10001678 3300017792 Bacteria 16244
183 Ga0163161_10172935 3300017792 Bacteria 1652
184 Ga0207697_10019796 3300025315 Bacteria 2757
185 Ga0207653_10000208 3300025885 Bacteria 39517
186 Ga0207642_10638230 3300025899 Unclassified 666
187 Ga0207710_10087521 3300025900 Bacteria 1453
188 Ga0207710_10196654 3300025900 Unclassified 994
189 Ga0207647_10000801 3300025904 Bacteria 24373
190 Ga0207647_10298697 3300025904 Unclassified 917
191 Ga0207684_11086560 3300025910 Unclassified 666
192 Ga0207707_10000008 3300025912 Bacteria 330313
193 Ga0207660_10001514 3300025917 Bacteria 15632
194 Ga0207662_10013507 3300025918 Bacteria 4566
195 Ga0207662_10323549 3300025918 Unclassified 1030
196 Ga0207652_10000065 3300025921 Bacteria 111252
197 Ga0207646_10185766 3300025922 Bacteria 1877
198 Ga0207694_10015368 3300025924 Bacteria 5774
199 Ga0207659_10240791 3300025926 Bacteria 1463
200 Ga0207687_10030951 3300025927 Bacteria 3613
201 Ga0207686_10000003 3300025934 Bacteria 376934
202 Ga0207709_10391363 3300025935 Unclassified 1060
203 Ga0207709_10403791 3300025935 Unclassified 1045
204 Ga0207709_10448471 3300025935 Unclassified 997
205 Ga0207709_10710704 3300025935 Unclassified 805
206 Ga0207670_10327682 3300025936 Unclassified 1207
207 Ga0207670_10485028 3300025936 Unclassified 1002
208 Ga0207704_10129676 3300025938 Bacteria 1743
209 Ga0207691_10029596 3300025940 Bacteria 5122
210 Ga0207711_10059543 3300025941 Bacteria 3288
211 Ga0207711_10251501 3300025941 Unclassified 1623
212 Ga0207711_10401894 3300025941 Unclassified 1273
213 Ga0207711_10913168 3300025941 Bacteria 816
214 Ga0207711_11114704 3300025941 Unclassified 730
215 Ga0207711_11231430 3300025941 Unclassified 690
216 Ga0207689_10008514 3300025942 Bacteria 8945
217 Ga0207689_10141831 3300025942 Bacteria 1979
218 Ga0207689_10150252 3300025942 Bacteria 1920
219 Ga0207689_10301349 3300025942 Bacteria 1328
220 Ga0207679_10177513 3300025945 Unclassified 1759
221 Ga0207679_10653852 3300025945 Unclassified 951
222 Ga0207651_10426013 3300025960 Unclassified 1134
223 Ga0207712_10022869 3300025961 Bacteria 4121
224 Ga0207712_10039633 3300025961 Unclassified 3229
225 Ga0207712_10145283 3300025961 Bacteria 1825
226 Ga0207640_10583298 3300025981 Bacteria 944
227 Ga0207677_10581379 3300026023 Bacteria 980
228 Ga0207703_10304585 3300026035 Unclassified 1454
229 Ga0207703_10365248 3300026035 Bacteria 1332
230 Ga0207703_10420026 3300026035 Bacteria 1244
231 Ga0207639_10943140 3300026041 Unclassified 807
232 Ga0207708_10063206 3300026075 Bacteria 2828
233 Ga0207708_10136158 3300026075 Unclassified 1924
234 Ga0207641_10033932 3300026088 Bacteria 4242
235 Ga0207641_10136844 3300026088 Bacteria 2206
236 Ga0207641_10381755 3300026088 Unclassified 1349
237 Ga0207641_10695490 3300026088 Unclassified 1001
238 Ga0207641_11059349 3300026088 Unclassified 809
239 Ga0207676_10063861 3300026095 Bacteria 2925
240 Ga0207676_10076070 3300026095 Bacteria 2711
241 Ga0207676_10225795 3300026095 Unclassified 1671
242 Ga0207676_10399439 3300026095 Unclassified 1284
243 Ga0207676_10514473 3300026095 Bacteria 1139
244 Ga0207676_10691133 3300026095 Unclassified 987
245 Ga0207676_10773520 3300026095 Unclassified 935
246 Ga0207676_10791726 3300026095 Bacteria 924
247 Ga0207674_10177167 3300026116 Unclassified 2084
248 Ga0207674_10219843 3300026116 Unclassified 1848
249 Ga0207675_100084200 3300026118 Bacteria 2984
250 Ga0207675_100839519 3300026118 Unclassified 933
251 Ga0207698_10342048 3300026142 Bacteria 1410
252 Ga0207698_10973695 3300026142 Unclassified 858
253 Ga0207428_10006541 3300027907 Bacteria 10746
254 Ga0268265_10305481 3300028380 Unclassified 1434
255 Ga0268265_10519497 3300028380 Unclassified 1125
256 Ga0268264_10056173 3300028381 Bacteria 3290
257 Ga0268264_10767095 3300028381 Bacteria 962
258 Ga0307408_100008536 3300031548 Bacteria 6765
259 Ga0307405_10005314 3300031731 Bacteria 6197
260 Ga0307410_10013332 3300031852 Unclassified 4792
261 Ga0307406_10019733 3300031901 Unclassified 3959
262 Ga0307407_10064842 3300031903 Bacteria 2148
263 Ga0307412_10041141 3300031911 Bacteria 2993
264 Ga0307409_100293769 3300031995 Bacteria 1508
265 Ga0307416_100022011 3300032002 Unclassified 4590
266 Ga0307414_10011521 3300032004 Bacteria 5190
267 Ga0307415_100022075 3300032126 Unclassified 3923
268 Ga0373951_0026780 3300035091 Unclassified 1345
269 Ga0373941_0167208 3300035115 Unclassified 817
270 Ga0373962_0100325 3300035242 Unclassified 902
271 Ga0395901_1100102 3300038443 Bacteria 765
272 Ga0453683_0340894 3300044673 Unclassified 962
273 Ga0451576_0352495 3300045051 Bacteria 1541
274 Ga0496112_0558323 3300048915 Unclassified 1079
275 Ga0496112_0817811 3300048915 Unclassified 856
276 Ga0501291_002547 3300049514 Bacteria 2191
277 Ga0501298_001083 3300049521 Unclassified 3906
278 Ga0501198_001885 3300049649 Bacteria 2769
279 Ga0501202_000580 3300049652 Bacteria 5329
280 Ga0501207_000815 3300049654 Unclassified 3689
281 Ga0501209_041140 3300049656 Bacteria 1222
282 Ga0501209_122612 3300049656 Bacteria 772
283 Ga0501216_000491 3300049660 Unclassified 4709
284 Ga0501217_001018 3300049661 Bacteria 5083
285 Ga0501223_001811 3300049663 Unclassified 4824
286 Ga0501224_000348 3300049664 Bacteria 5391
287 Ga0501224_008620 3300049664 Bacteria 1487
288 Ga0501227_001393 3300049665 Bacteria 5408
289 Ga0501228_002920 3300049666 Unclassified 1377
290 Ga0501230_000408 3300049667 Unclassified 4189
291 Ga0501233_005174 3300049668 Bacteria 2415
292 Ga0501233_008759 3300049668 Bacteria 1959
293 Ga0501236_003196 3300049670 Bacteria 1900
294 Ga0501239_005452 3300049672 Unclassified 1281
295 Ga0501243_007057 3300049675 Bacteria 1712
296 Ga0501246_006398 3300049676 Bacteria 1009
297 Ga0501249_006008 3300049679 Bacteria 2492
298 Ga0501249_013989 3300049679 Bacteria 1708
299 Ga0501250_036011 3300049680 Unclassified 707
300 Ga0501251_017639 3300049681 Unclassified 919
301 Ga0501252_018587 3300049682 Unclassified 891
302 Ga0501253_001693 3300049683 Bacteria 2315
303 Ga0501256_000074 3300049685 Bacteria 5135
304 Ga0501257_012107 3300049686 Bacteria 1971
305 Ga0501259_003107 3300049688 Bacteria 2657
306 Ga0501260_001047 3300049689 Bacteria 2236
307 Ga0501260_001969 3300049689 Bacteria 1740
308 Ga0501221_001028 3300049704 Unclassified 4585
309 Ga0501225_0001087 3300049705 Bacteria 8532
310 Ga0501229_001225 3300049706 Unclassified 2982
311 Ga0501234_000731 3300049707 Bacteria 5082
312 Ga0501245_003157 3300049708 Bacteria 2226
313 Ga0501262_027976 3300049759 Unclassified 802
314 Ga0501268_005113 3300049765 Bacteria 1871
315 Ga0501270_008801 3300049767 Bacteria 1287
316 Ga0501272_012843 3300049769 Unclassified 954
317 Ga0501273_015232 3300049770 Unclassified 996
318 Ga0501283_009319 3300049779 Bacteria 1429
319 Ga0501204_008496 3300049850 Unclassified 1174
320 Ga0501212_001066 3300049851 Bacteria 2984
321 Ga0501226_000806 3300049853 Unclassified 4216
322 nmdc:mga05p37_195978_c1 3300050507 Unclassified 2449
323 nmdc:mga09592_1058102_c1 3300050508 Unclassified 676
324 nmdc:mga09592_672499_c1 3300050508 Unclassified 883
325 nmdc:mga09592_878387_c1 3300050508 Unclassified 755
326 nmdc:mga0qj67_739569_c1 3300050509 Unclassified 781
327 nmdc:mga06r32_1021018_c1 3300050510 Unclassified 779
328 nmdc:mga06r32_364112_c1 3300050510 Unclassified 1429
329 nmdc:mga08y16_88831_c1 3300050511 Bacteria 3221
330 nmdc:mga08y16_98762_c1 3300050511 Bacteria 3040
331 nmdc:mga0n895_1055657_c1 3300050512 Bacteria 791
332 nmdc:mga0n895_172753_c1 3300050512 Bacteria 2193
333 nmdc:mga0a205_166685_c1 3300050515 Unclassified 2099
334 nmdc:mga0a205_206377_c2 3300050515 Bacteria 1520
335 nmdc:mga0a205_297351_c1 3300050515 Bacteria 1488

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003203 JGI25406J46586_10001573 JGI25406J46586_100015737 152
2 3300005617 Ga0068859_100052354 Ga0068859_1000523541 152
3 3300005617 Ga0068859_100083521 Ga0068859_1000835214 152
4 3300005841 Ga0068863_100061668 Ga0068863_1000616681 152
5 3300005842 Ga0068858_100075892 Ga0068858_1000758924 152
6 3300005843 Ga0068860_100135372 Ga0068860_1001353722 152
7 3300006931 Ga0097620_100052354 Ga0097620_1000523547 152
8 3300006931 Ga0097620_100083520 Ga0097620_1000835204 152
9 3300009148 Ga0105243_10300049 Ga0105243_103000492 152
10 3300011119 Ga0105246_11462904 Ga0105246_114629041 152
11 3300013100 Ga0157373_10060200 Ga0157373_100602004 152
12 3300005290 Ga0065712_10037135 Ga0065712_100371352 176
13 3300013307 Ga0157372_10909688 Ga0157372_109096882 184
14 3300045051 Ga0451576_0352495 Ga0451576_0352495_419_982 187
15 3300005293 Ga0065715_10040718 Ga0065715_100407182 188
16 3300005340 Ga0070689_100503644 Ga0070689_1005036441 188
17 3300005459 Ga0068867_100758367 Ga0068867_1007583671 188
18 3300005467 Ga0070706_101324596 Ga0070706_1013245961 188
19 3300005539 Ga0068853_100538922 Ga0068853_1005389222 188
20 3300005539 Ga0068853_101240928 Ga0068853_1012409282 188
21 3300005545 Ga0070695_100488093 Ga0070695_1004880932 188
22 3300005616 Ga0068852_100136045 Ga0068852_1001360453 188
23 3300005617 Ga0068859_101058987 Ga0068859_1010589872 188
24 3300005617 Ga0068859_102014031 Ga0068859_1020140311 188
25 3300005618 Ga0068864_100292184 Ga0068864_1002921841 188
26 3300005718 Ga0068866_10739908 Ga0068866_107399081 188
27 3300005842 Ga0068858_100057725 Ga0068858_1000577252 188
28 3300005843 Ga0068860_100149376 Ga0068860_1001493762 188
29 3300005985 Ga0081539_10000408 Ga0081539_1000040814 188
30 3300006931 Ga0097620_101059014 Ga0097620_1010590142 188
31 3300006931 Ga0097620_102014097 Ga0097620_1020140971 188
32 3300009101 Ga0105247_10737466 Ga0105247_107374662 188
33 3300009174 Ga0105241_10124210 Ga0105241_101242102 188
34 3300013308 Ga0157375_11090228 Ga0157375_110902282 188
35 3300014326 Ga0157380_10195355 Ga0157380_101953552 188
36 3300025910 Ga0207684_11086560 Ga0207684_110865601 188
37 3300025935 Ga0207709_10391363 Ga0207709_103913631 188
38 3300025935 Ga0207709_10448471 Ga0207709_104484711 188
39 3300025941 Ga0207711_11231430 Ga0207711_112314301 188
40 3300025942 Ga0207689_10301349 Ga0207689_103013492 188
41 3300025945 Ga0207679_10653852 Ga0207679_106538522 188
42 3300025981 Ga0207640_10583298 Ga0207640_105832982 188
43 3300026035 Ga0207703_10304585 Ga0207703_103045852 188
44 3300026075 Ga0207708_10136158 Ga0207708_101361582 188
45 3300026095 Ga0207676_10225795 Ga0207676_102257952 188
46 3300026116 Ga0207674_10177167 Ga0207674_101771673 188
47 3300026142 Ga0207698_10342048 Ga0207698_103420482 188
48 3300028380 Ga0268265_10519497 Ga0268265_105194972 188
49 3300048915 Ga0496112_0817811 Ga0496112_0817811_216_791 188
50 3300005289 Ga0065704_10001508 Ga0065704_100015087 189
51 3300005290 Ga0065712_10068986 Ga0065712_100689861 189
52 3300005293 Ga0065715_10143354 Ga0065715_101433541 189
53 3300005293 Ga0065715_10279870 Ga0065715_102798702 189
54 3300005295 Ga0065707_10002161 Ga0065707_100021617 189
55 3300005295 Ga0065707_10134166 Ga0065707_101341663 189
56 3300005333 Ga0070677_10268841 Ga0070677_102688412 189
57 3300005340 Ga0070689_100814903 Ga0070689_1008149031 189
58 3300005343 Ga0070687_100046684 Ga0070687_1000466841 189
59 3300005354 Ga0070675_100121724 Ga0070675_1001217241 189
60 3300005364 Ga0070673_100281797 Ga0070673_1002817972 189
61 3300005365 Ga0070688_100075274 Ga0070688_1000752743 189
62 3300005440 Ga0070705_100042862 Ga0070705_1000428621 189
63 3300005543 Ga0070672_100397011 Ga0070672_1003970112 189
64 3300005544 Ga0070686_100016945 Ga0070686_1000169455 189
65 3300005547 Ga0070693_100290577 Ga0070693_1002905772 189
66 3300005577 Ga0068857_100203114 Ga0068857_1002031142 189
67 3300005617 Ga0068859_100019346 Ga0068859_1000193462 189
68 3300005617 Ga0068859_100148037 Ga0068859_1001480372 189
69 3300005618 Ga0068864_100801550 Ga0068864_1008015502 189
70 3300005841 Ga0068863_100050103 Ga0068863_1000501032 189
71 3300005841 Ga0068863_100302865 Ga0068863_1003028652 189
72 3300005842 Ga0068858_100864498 Ga0068858_1008644981 189
73 3300005844 Ga0068862_100149676 Ga0068862_1001496763 189
74 3300006237 Ga0097621_100030189 Ga0097621_1000301894 189
75 3300006852 Ga0075433_10445091 Ga0075433_104450911 189
76 3300006931 Ga0097620_100019348 Ga0097620_1000193482 189
77 3300006931 Ga0097620_100148026 Ga0097620_1001480263 189
78 3300009101 Ga0105247_10444445 Ga0105247_104444452 189
79 3300009147 Ga0114129_10260535 Ga0114129_102605354 189
80 3300009148 Ga0105243_10967708 Ga0105243_109677081 189
81 3300009177 Ga0105248_10177178 Ga0105248_101771783 189
82 3300009553 Ga0105249_10485363 Ga0105249_104853631 189
83 3300010375 Ga0105239_10639418 Ga0105239_106394182 189
84 3300011119 Ga0105246_10072009 Ga0105246_100720093 189
85 3300013296 Ga0157374_10067013 Ga0157374_100670132 189
86 3300013297 Ga0157378_10540643 Ga0157378_105406432 189
87 3300013306 Ga0163162_11232271 Ga0163162_112322712 189
88 3300013308 Ga0157375_12016176 Ga0157375_120161761 189
89 3300014325 Ga0163163_11068070 Ga0163163_110680702 189
90 3300014745 Ga0157377_10113379 Ga0157377_101133791 189
91 3300014969 Ga0157376_10040634 Ga0157376_100406342 189
92 3300017792 Ga0163161_10001678 Ga0163161_100016784 189
93 3300025315 Ga0207697_10019796 Ga0207697_100197961 189
94 3300025899 Ga0207642_10638230 Ga0207642_106382301 189
95 3300025904 Ga0207647_10298697 Ga0207647_102986971 189
96 3300025918 Ga0207662_10013507 Ga0207662_100135075 189
97 3300025926 Ga0207659_10240791 Ga0207659_102407912 189
98 3300025927 Ga0207687_10030951 Ga0207687_100309514 189
99 3300025940 Ga0207691_10029596 Ga0207691_100295962 189
100 3300025941 Ga0207711_11114704 Ga0207711_111147041 189
101 3300025942 Ga0207689_10008514 Ga0207689_100085142 189
102 3300025960 Ga0207651_10426013 Ga0207651_104260132 189
103 3300025961 Ga0207712_10039633 Ga0207712_100396331 189
104 3300025961 Ga0207712_10145283 Ga0207712_101452832 189
105 3300026023 Ga0207677_10581379 Ga0207677_105813791 189
106 3300026088 Ga0207641_10136844 Ga0207641_101368442 189
107 3300026088 Ga0207641_10695490 Ga0207641_106954901 189
108 3300026095 Ga0207676_10514473 Ga0207676_105144732 189
109 3300026095 Ga0207676_10691133 Ga0207676_106911331 189
110 3300026095 Ga0207676_10791726 Ga0207676_107917261 189
111 3300026116 Ga0207674_10219843 Ga0207674_102198432 189
112 3300026142 Ga0207698_10973695 Ga0207698_109736951 189
113 3300027907 Ga0207428_10006541 Ga0207428_1000654111 189
114 3300028380 Ga0268265_10305481 Ga0268265_103054812 189
115 3300035242 Ga0373962_0100325 Ga0373962_0100325_15_593 189
116 3300050507 nmdc:mga05p37_195978_c1 nmdc:mga05p37_195978_c1_1761_2330 189
117 3300050508 nmdc:mga09592_1058102_c1 nmdc:mga09592_1058102_c1_90_659 189
118 3300050508 nmdc:mga09592_878387_c1 nmdc:mga09592_878387_c1_103_672 189
119 3300050511 nmdc:mga08y16_88831_c1 nmdc:mga08y16_88831_c1_2476_3054 189
120 3300050515 nmdc:mga0a205_206377_c2 nmdc:mga0a205_206377_c2_490_1068 189
121 2162886011 MRS1b_contig_2185856 MRS1b_0630.00002290 190
122 3300005290 Ga0065712_10000113 Ga0065712_1000011329 190
123 3300005293 Ga0065715_10099112 Ga0065715_100991122 190
124 3300005295 Ga0065707_10128746 Ga0065707_101287463 190
125 3300005334 Ga0068869_100171435 Ga0068869_1001714352 190
126 3300005334 Ga0068869_100348343 Ga0068869_1003483431 190
127 3300005336 Ga0070680_100019946 Ga0070680_1000199462 190
128 3300005337 Ga0070682_100009886 Ga0070682_1000098866 190
129 3300005340 Ga0070689_100319633 Ga0070689_1003196331 190
130 3300005340 Ga0070689_100391334 Ga0070689_1003913342 190
131 3300005345 Ga0070692_10029802 Ga0070692_100298021 190
132 3300005365 Ga0070688_100165842 Ga0070688_1001658422 190
133 3300005438 Ga0070701_10410677 Ga0070701_104106772 190
134 3300005441 Ga0070700_100064306 Ga0070700_1000643064 190
135 3300005444 Ga0070694_100120772 Ga0070694_1001207722 190
136 3300005444 Ga0070694_100521639 Ga0070694_1005216391 190
137 3300005445 Ga0070708_100000257 Ga0070708_10000025736 190
138 3300005458 Ga0070681_10002499 Ga0070681_1000249917 190
139 3300005458 Ga0070681_10321599 Ga0070681_103215992 190
140 3300005459 Ga0068867_100396356 Ga0068867_1003963562 190
141 3300005467 Ga0070706_100171328 Ga0070706_1001713282 190
142 3300005467 Ga0070706_100193945 Ga0070706_1001939451 190
143 3300005468 Ga0070707_100052644 Ga0070707_1000526445 190
144 3300005471 Ga0070698_100048348 Ga0070698_1000483485 190
145 3300005518 Ga0070699_100000196 Ga0070699_10000019648 190
146 3300005518 Ga0070699_100351034 Ga0070699_1003510342 190
147 3300005530 Ga0070679_100230130 Ga0070679_1002301303 190
148 3300005536 Ga0070697_100059747 Ga0070697_1000597474 190
149 3300005536 Ga0070697_100226469 Ga0070697_1002264692 190
150 3300005536 Ga0070697_100671843 Ga0070697_1006718431 190
151 3300005546 Ga0070696_100056951 Ga0070696_1000569511 190
152 3300005546 Ga0070696_100165465 Ga0070696_1001654652 190
153 3300005546 Ga0070696_100459401 Ga0070696_1004594011 190
154 3300005546 Ga0070696_101067073 Ga0070696_1010670731 190
155 3300005547 Ga0070693_100143455 Ga0070693_1001434551 190
156 3300005547 Ga0070693_100370921 Ga0070693_1003709212 190
157 3300005549 Ga0070704_100576471 Ga0070704_1005764711 190
158 3300005564 Ga0070664_100135283 Ga0070664_1001352834 190
159 3300005564 Ga0070664_100576912 Ga0070664_1005769121 190
160 3300005615 Ga0070702_100097248 Ga0070702_1000972482 190
161 3300005615 Ga0070702_100117490 Ga0070702_1001174902 190
162 3300005615 Ga0070702_100254938 Ga0070702_1002549382 190
163 3300005616 Ga0068852_101185279 Ga0068852_1011852791 190
164 3300005617 Ga0068859_100052957 Ga0068859_1000529575 190
165 3300005617 Ga0068859_100066256 Ga0068859_1000662563 190
166 3300005617 Ga0068859_100281227 Ga0068859_1002812272 190
167 3300005617 Ga0068859_100495027 Ga0068859_1004950271 190
168 3300005618 Ga0068864_100062532 Ga0068864_1000625322 190
169 3300005618 Ga0068864_100288216 Ga0068864_1002882162 190
170 3300005618 Ga0068864_100344703 Ga0068864_1003447032 190
171 3300005618 Ga0068864_100983977 Ga0068864_1009839771 190
172 3300005719 Ga0068861_100240652 Ga0068861_1002406522 190
173 3300005841 Ga0068863_100111360 Ga0068863_1001113601 190
174 3300005841 Ga0068863_100233466 Ga0068863_1002334662 190
175 3300005842 Ga0068858_100386790 Ga0068858_1003867901 190
176 3300005843 Ga0068860_100046825 Ga0068860_1000468255 190
177 3300005843 Ga0068860_100074096 Ga0068860_1000740963 190
178 3300005843 Ga0068860_100243234 Ga0068860_1002432342 190
179 3300005843 Ga0068860_101142532 Ga0068860_1011425322 190
180 3300005844 Ga0068862_101450844 Ga0068862_1014508441 190
181 3300005985 Ga0081539_10177955 Ga0081539_101779552 190
182 3300006163 Ga0070715_10498246 Ga0070715_104982461 190
183 3300006237 Ga0097621_100213178 Ga0097621_1002131782 190
184 3300006237 Ga0097621_100687031 Ga0097621_1006870311 190
185 3300006358 Ga0068871_100006877 Ga0068871_1000068774 190
186 3300006844 Ga0075428_100215833 Ga0075428_1002158332 190
187 3300006846 Ga0075430_100257464 Ga0075430_1002574642 190
188 3300006847 Ga0075431_100435675 Ga0075431_1004356752 190
189 3300006852 Ga0075433_10036475 Ga0075433_100364752 190
190 3300006852 Ga0075433_10249366 Ga0075433_102493662 190
191 3300006871 Ga0075434_100268088 Ga0075434_1002680882 190
192 3300006880 Ga0075429_100392496 Ga0075429_1003924962 190
193 3300006881 Ga0068865_100124383 Ga0068865_1001243832 190
194 3300006931 Ga0097620_100052956 Ga0097620_1000529565 190
195 3300006931 Ga0097620_100066258 Ga0097620_1000662583 190
196 3300006931 Ga0097620_100281223 Ga0097620_1002812232 190
197 3300006931 Ga0097620_100494967 Ga0097620_1004949672 190
198 3300006931 Ga0097620_100900956 Ga0097620_1009009562 190
199 3300009101 Ga0105247_10076549 Ga0105247_100765491 190
200 3300009147 Ga0114129_10036154 Ga0114129_100361547 190
201 3300009148 Ga0105243_10000073 Ga0105243_1000007331 190
202 3300009148 Ga0105243_10263501 Ga0105243_102635012 190
203 3300009148 Ga0105243_11213382 Ga0105243_112133821 190
204 3300009176 Ga0105242_10000043 Ga0105242_1000004352 190
205 3300009176 Ga0105242_10350941 Ga0105242_103509412 190
206 3300009177 Ga0105248_10026801 Ga0105248_100268014 190
207 3300009177 Ga0105248_10516102 Ga0105248_105161022 190
208 3300009177 Ga0105248_10774844 Ga0105248_107748442 190
209 3300009177 Ga0105248_10904016 Ga0105248_109040162 190
210 3300009177 Ga0105248_10959803 Ga0105248_109598032 190
211 3300009545 Ga0105237_10269121 Ga0105237_102691213 190
212 3300009551 Ga0105238_10074314 Ga0105238_100743144 190
213 3300009553 Ga0105249_10014488 Ga0105249_100144886 190
214 3300011119 Ga0105246_10504967 Ga0105246_105049672 190
215 3300013297 Ga0157378_10237382 Ga0157378_102373822 190
216 3300013297 Ga0157378_10730996 Ga0157378_107309962 190
217 3300013297 Ga0157378_11137101 Ga0157378_111371012 190
218 3300013297 Ga0157378_12069833 Ga0157378_120698331 190
219 3300013306 Ga0163162_10708144 Ga0163162_107081442 190
220 3300013307 Ga0157372_10164612 Ga0157372_101646124 190
221 3300013308 Ga0157375_10608974 Ga0157375_106089742 190
222 3300014325 Ga0163163_10482989 Ga0163163_104829892 190
223 3300014325 Ga0163163_10487506 Ga0163163_104875061 190
224 3300014325 Ga0163163_10953278 Ga0163163_109532781 190
225 3300014326 Ga0157380_10616012 Ga0157380_106160121 190
226 3300017792 Ga0163161_10172935 Ga0163161_101729352 190
227 3300025885 Ga0207653_10000208 Ga0207653_1000020832 190
228 3300025900 Ga0207710_10087521 Ga0207710_100875212 190
229 3300025900 Ga0207710_10196654 Ga0207710_101966542 190
230 3300025904 Ga0207647_10000801 Ga0207647_100008018 190
231 3300025912 Ga0207707_10000008 Ga0207707_10000008135 190
232 3300025917 Ga0207660_10001514 Ga0207660_100015148 190
233 3300025918 Ga0207662_10323549 Ga0207662_103235492 190
234 3300025921 Ga0207652_10000065 Ga0207652_1000006535 190
235 3300025922 Ga0207646_10185766 Ga0207646_101857662 190
236 3300025924 Ga0207694_10015368 Ga0207694_100153686 190
237 3300025934 Ga0207686_10000003 Ga0207686_1000000371 190
238 3300025935 Ga0207709_10403791 Ga0207709_104037912 190
239 3300025935 Ga0207709_10710704 Ga0207709_107107042 190
240 3300025936 Ga0207670_10327682 Ga0207670_103276821 190
241 3300025936 Ga0207670_10485028 Ga0207670_104850282 190
242 3300025938 Ga0207704_10129676 Ga0207704_101296762 190
243 3300025941 Ga0207711_10059543 Ga0207711_100595434 190
244 3300025941 Ga0207711_10251501 Ga0207711_102515012 190
245 3300025941 Ga0207711_10401894 Ga0207711_104018941 190
246 3300025941 Ga0207711_10913168 Ga0207711_109131681 190
247 3300025942 Ga0207689_10141831 Ga0207689_101418312 190
248 3300025942 Ga0207689_10150252 Ga0207689_101502523 190
249 3300025945 Ga0207679_10177513 Ga0207679_101775132 190
250 3300025961 Ga0207712_10022869 Ga0207712_100228693 190
251 3300026035 Ga0207703_10365248 Ga0207703_103652481 190
252 3300026035 Ga0207703_10420026 Ga0207703_104200262 190
253 3300026041 Ga0207639_10943140 Ga0207639_109431402 190
254 3300026075 Ga0207708_10063206 Ga0207708_100632064 190
255 3300026088 Ga0207641_10033932 Ga0207641_100339324 190
256 3300026088 Ga0207641_10381755 Ga0207641_103817552 190
257 3300026088 Ga0207641_11059349 Ga0207641_110593491 190
258 3300026095 Ga0207676_10063861 Ga0207676_100638612 190
259 3300026095 Ga0207676_10076070 Ga0207676_100760702 190
260 3300026095 Ga0207676_10399439 Ga0207676_103994392 190
261 3300026095 Ga0207676_10773520 Ga0207676_107735201 190
262 3300026118 Ga0207675_100084200 Ga0207675_1000842002 190
263 3300026118 Ga0207675_100839519 Ga0207675_1008395191 190
264 3300028381 Ga0268264_10056173 Ga0268264_100561732 190
265 3300028381 Ga0268264_10767095 Ga0268264_107670952 190
266 3300031548 Ga0307408_100008536 Ga0307408_1000085367 190
267 3300031731 Ga0307405_10005314 Ga0307405_100053147 190
268 3300031852 Ga0307410_10013332 Ga0307410_100133322 190
269 3300031901 Ga0307406_10019733 Ga0307406_100197335 190
270 3300031903 Ga0307407_10064842 Ga0307407_100648423 190
271 3300031911 Ga0307412_10041141 Ga0307412_100411412 190
272 3300031995 Ga0307409_100293769 Ga0307409_1002937691 190
273 3300032002 Ga0307416_100022011 Ga0307416_1000220115 190
274 3300032004 Ga0307414_10011521 Ga0307414_100115216 190
275 3300032126 Ga0307415_100022075 Ga0307415_1000220752 190
276 3300035091 Ga0373951_0026780 Ga0373951_0026780_592_1173 190
277 3300035115 Ga0373941_0167208 Ga0373941_0167208_193_774 190
278 3300038443 Ga0395901_1100102 Ga0395901_1100102_156_734 190
279 3300044673 Ga0453683_0340894 Ga0453683_0340894_40_612 190
280 3300048915 Ga0496112_0558323 Ga0496112_0558323_305_877 190
281 3300049514 Ga0501291_002547 Ga0501291_002547_693_1274 190
282 3300049521 Ga0501298_001083 Ga0501298_001083_2715_3296 190
283 3300049649 Ga0501198_001885 Ga0501198_001885_1460_2041 190
284 3300049652 Ga0501202_000580 Ga0501202_000580_2586_3167 190
285 3300049654 Ga0501207_000815 Ga0501207_000815_436_1017 190
286 3300049656 Ga0501209_041140 Ga0501209_041140_282_863 190
287 3300049656 Ga0501209_122612 Ga0501209_122612_118_690 190
288 3300049660 Ga0501216_000491 Ga0501216_000491_1289_1870 190
289 3300049661 Ga0501217_001018 Ga0501217_001018_590_1171 190
290 3300049663 Ga0501223_001811 Ga0501223_001811_3631_4212 190
291 3300049664 Ga0501224_000348 Ga0501224_000348_1251_1832 190
292 3300049664 Ga0501224_008620 Ga0501224_008620_216_788 190
293 3300049665 Ga0501227_001393 Ga0501227_001393_3445_4026 190
294 3300049666 Ga0501228_002920 Ga0501228_002920_757_1338 190
295 3300049667 Ga0501230_000408 Ga0501230_000408_836_1417 190
296 3300049668 Ga0501233_005174 Ga0501233_005174_1090_1671 190
297 3300049668 Ga0501233_008759 Ga0501233_008759_570_1142 190
298 3300049670 Ga0501236_003196 Ga0501236_003196_694_1275 190
299 3300049672 Ga0501239_005452 Ga0501239_005452_648_1229 190
300 3300049675 Ga0501243_007057 Ga0501243_007057_473_1054 190
301 3300049676 Ga0501246_006398 Ga0501246_006398_208_789 190
302 3300049679 Ga0501249_006008 Ga0501249_006008_1372_1953 190
303 3300049679 Ga0501249_013989 Ga0501249_013989_260_832 190
304 3300049680 Ga0501250_036011 Ga0501250_036011_63_644 190
305 3300049681 Ga0501251_017639 Ga0501251_017639_220_801 190
306 3300049682 Ga0501252_018587 Ga0501252_018587_295_867 190
307 3300049683 Ga0501253_001693 Ga0501253_001693_501_1082 190
308 3300049685 Ga0501256_000074 Ga0501256_000074_4077_4658 190
309 3300049686 Ga0501257_012107 Ga0501257_012107_19_600 190
310 3300049688 Ga0501259_003107 Ga0501259_003107_1462_2043 190
311 3300049689 Ga0501260_001047 Ga0501260_001047_1080_1661 190
312 3300049689 Ga0501260_001969 Ga0501260_001969_296_868 190
313 3300049704 Ga0501221_001028 Ga0501221_001028_804_1385 190
314 3300049705 Ga0501225_0001087 Ga0501225_0001087_3241_3822 190
315 3300049706 Ga0501229_001225 Ga0501229_001225_1327_1908 190
316 3300049707 Ga0501234_000731 Ga0501234_000731_3644_4225 190
317 3300049708 Ga0501245_003157 Ga0501245_003157_53_634 190
318 3300049759 Ga0501262_027976 Ga0501262_027976_150_731 190
319 3300049765 Ga0501268_005113 Ga0501268_005113_530_1111 190
320 3300049767 Ga0501270_008801 Ga0501270_008801_423_1004 190
321 3300049769 Ga0501272_012843 Ga0501272_012843_302_883 190
322 3300049770 Ga0501273_015232 Ga0501273_015232_65_646 190
323 3300049779 Ga0501283_009319 Ga0501283_009319_532_1113 190
324 3300049850 Ga0501204_008496 Ga0501204_008496_473_1054 190
325 3300049851 Ga0501212_001066 Ga0501212_001066_1766_2338 190
326 3300049853 Ga0501226_000806 Ga0501226_000806_2696_3277 190
327 3300050508 nmdc:mga09592_672499_c1 nmdc:mga09592_672499_c1_179_751 190
328 3300050509 nmdc:mga0qj67_739569_c1 nmdc:mga0qj67_739569_c1_130_708 190
329 3300050510 nmdc:mga06r32_1021018_c1 nmdc:mga06r32_1021018_c1_101_679 190
330 3300050510 nmdc:mga06r32_364112_c1 nmdc:mga06r32_364112_c1_343_915 190
331 3300050511 nmdc:mga08y16_98762_c1 nmdc:mga08y16_98762_c1_171_743 190
332 3300050512 nmdc:mga0n895_1055657_c1 nmdc:mga0n895_1055657_c1_50_628 190
333 3300050512 nmdc:mga0n895_172753_c1 nmdc:mga0n895_172753_c1_1198_1779 190
334 3300050515 nmdc:mga0a205_166685_c1 nmdc:mga0a205_166685_c1_1440_2021 190
335 3300050515 nmdc:mga0a205_297351_c1 nmdc:mga0a205_297351_c1_11_589 190

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05685

Uma2

Putative restriction endonuclease

43

213

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p3n-assembly1.cif.gz_B structural basis for full-spectrum inhibition of threonyl-trna synthetase by borrelidin 1 0.8019 123 154
1wdj-assembly1.cif.gz_B crystal structure of tt1808 from thermus thermophilus hb8 0.7724 37 188
1wdj-assembly1.cif.gz_B crystal structure of tt1808 from thermus thermophilus hb8 0.7678 37 188
6okh-assembly1.cif.gz_B structure of an uncharacterized protein from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.7623 12 190
6okh-assembly1.cif.gz_B structure of an uncharacterized protein from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.7543 12 190
ID Description Score Start End Superfamily
af_P0AA99_43_186_2.40.440.10 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.8046 139 163 2.40.440.10
1wdjB00 Alpha Beta;Alpha-Beta Complex;tt1808, chain A;tt1808, chain A 0.7724 37 188 3.90.1570.10
1wdjB00 Alpha Beta;Alpha-Beta Complex;tt1808, chain A;tt1808, chain A 0.7678 37 188 3.90.1570.10
af_A0A1D8PRZ3_426_574_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.7669 123 157 3.40.50.800
af_Q4DDN8_1_121_3.30.450.50 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Longin domain 0.7509 138 170 3.30.450.50
ID Description Score Start End GO Terms
AF-A0A2V9PEV6-F1-model_v4 Putative restriction endonuclease domain-containing protein 0.9399 78 190
AF-A0A2V9PEV6-F1-model_v4 Putative restriction endonuclease domain-containing protein 0.932 78 190
AF-A0A2V8KWI1-F1-model_v4 Putative restriction endonuclease domain-containing protein 0.9187 45 189
AF-X1H0V4-F1-model_v4 Putative restriction endonuclease domain-containing protein 0.9167 110 189
AF-A0A2V8KWI1-F1-model_v4 Putative restriction endonuclease domain-containing protein 0.9126 45 189

Feature Viewer

pLDDT pTM Quality
82.2 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map