F412147
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 335 | 234 | 334 | 222 |
Family's Representative Sequence
| Representative Sequence | 3300005543|Ga0070672_100000104|Ga0070672_10000010417 |
| Length | 230 |
| Sequence | MIRPMAELNLVLLGPPGSGKGTQGERLNEDLRLPYYATGDILRAAVREETELGRAAKEYMDRGDLVPDEVIVAVIAERIGSSEALDGFILDGFPRTTPQAEALDAKLSELGRGVTAVLLIDVADDEVVRRLGGRRTCEANGHVFHVEFEPPKEEGVCDIDGSRLIVRDDDKPEVIRKRLETYHEKTEPLVSYYDSRGVLRRIEGEAAPEEVAEQIRRTLATMRMEQDEAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 38 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 43 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 44 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 45 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 46 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 47 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 50 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 51 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 52 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 53 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 54 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 64 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 76 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 77 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 118 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 119 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 120 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 121 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 122 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 123 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 124 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 125 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 126 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 127 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 128 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 129 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 130 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 131 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 132 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 133 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 134 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 135 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 136 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 137 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 138 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 139 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 140 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 141 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 142 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 178 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 179 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 180 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 181 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 182 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 183 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 184 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 185 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 186 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 187 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 188 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 189 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 190 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 191 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 192 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 193 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 194 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 195 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 196 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 221 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 222 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 223 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 231 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 232 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 233 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.1 |
| Metatranscriptomes | 0.6 |
| Isolates | 0.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.39 |
| Nodule | 0 |
| Rhizoplane | 7.76 |
| Rhizosphere | 86.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000007 | 3300001977 | Bacteria | 20037 |
| 2 | Ga0065707_10087143 | 3300005295 | Bacteria | 5147 |
| 3 | Ga0070658_10019454 | 3300005327 | Bacteria | 5437 |
| 4 | Ga0070683_100011264 | 3300005329 | Bacteria | 7719 |
| 5 | Ga0070683_100103396 | 3300005329 | Bacteria | 2684 |
| 6 | Ga0070683_100162836 | 3300005329 | Bacteria | 2117 |
| 7 | Ga0068869_100201096 | 3300005334 | Bacteria | 1571 |
| 8 | Ga0070666_10073588 | 3300005335 | Bacteria | 2327 |
| 9 | Ga0070682_100000032 | 3300005337 | Bacteria | 155141 |
| 10 | Ga0068868_100008360 | 3300005338 | Bacteria | 7408 |
| 11 | Ga0070689_100344263 | 3300005340 | Bacteria | 1249 |
| 12 | Ga0070691_10004069 | 3300005341 | Bacteria | 6629 |
| 13 | Ga0070661_100000236 | 3300005344 | Bacteria | 45535 |
| 14 | Ga0070661_100208553 | 3300005344 | Bacteria | 1495 |
| 15 | Ga0070661_100455963 | 3300005344 | Bacteria | 1018 |
| 16 | Ga0070692_10208773 | 3300005345 | Bacteria | 1148 |
| 17 | Ga0070668_100012523 | 3300005347 | Bacteria | 6316 |
| 18 | Ga0070668_100043738 | 3300005347 | Bacteria | 3435 |
| 19 | Ga0070675_100003153 | 3300005354 | Bacteria | 12477 |
| 20 | Ga0070671_100453109 | 3300005355 | Bacteria | 1101 |
| 21 | Ga0070688_100000168 | 3300005365 | Bacteria | 35364 |
| 22 | Ga0070688_100000562 | 3300005365 | Bacteria | 18826 |
| 23 | Ga0070688_100145408 | 3300005365 | Bacteria | 1615 |
| 24 | Ga0070659_100140970 | 3300005366 | Bacteria | 1963 |
| 25 | Ga0070667_100001611 | 3300005367 | Bacteria | 20202 |
| 26 | Ga0070667_100051933 | 3300005367 | Bacteria | 3457 |
| 27 | Ga0070714_100036840 | 3300005435 | Bacteria | 4106 |
| 28 | Ga0070713_100000171 | 3300005436 | Bacteria | 43503 |
| 29 | Ga0070713_100102600 | 3300005436 | Bacteria | 2481 |
| 30 | Ga0070701_10080489 | 3300005438 | Bacteria | 1762 |
| 31 | Ga0070700_100074204 | 3300005441 | Bacteria | 2179 |
| 32 | Ga0070663_100024140 | 3300005455 | Bacteria | 4087 |
| 33 | Ga0070663_100778605 | 3300005455 | Bacteria | 819 |
| 34 | Ga0070678_100023357 | 3300005456 | Bacteria | 4119 |
| 35 | Ga0070685_10000246 | 3300005466 | Bacteria | 35364 |
| 36 | Ga0070685_10001063 | 3300005466 | Bacteria | 14725 |
| 37 | Ga0070679_100000832 | 3300005530 | Bacteria | 26815 |
| 38 | Ga0070684_100065586 | 3300005535 | Bacteria | 3187 |
| 39 | Ga0070684_100067227 | 3300005535 | Bacteria | 3147 |
| 40 | Ga0070684_100098552 | 3300005535 | Bacteria | 2608 |
| 41 | Ga0070672_100000104 | 3300005543 | Bacteria | 42077 |
| 42 | Ga0070665_100051471 | 3300005548 | Bacteria | 4130 |
| 43 | Ga0070665_100065177 | 3300005548 | Bacteria | 3654 |
| 44 | Ga0070665_100276946 | 3300005548 | Bacteria | 1680 |
| 45 | Ga0070664_100085966 | 3300005564 | Bacteria | 2717 |
| 46 | Ga0070664_100153083 | 3300005564 | Bacteria | 2037 |
| 47 | Ga0068857_100311195 | 3300005577 | Bacteria | 1453 |
| 48 | Ga0068854_100000939 | 3300005578 | Bacteria | 17543 |
| 49 | Ga0068856_100007857 | 3300005614 | Bacteria | 10417 |
| 50 | Ga0068852_100000024 | 3300005616 | Bacteria | 120479 |
| 51 | Ga0068859_101102345 | 3300005617 | Bacteria | 873 |
| 52 | Ga0068866_10010127 | 3300005718 | Bacteria | 4031 |
| 53 | Ga0068851_10007702 | 3300005834 | Bacteria | 4952 |
| 54 | Ga0068851_10018801 | 3300005834 | Bacteria | 3334 |
| 55 | Ga0068863_100008951 | 3300005841 | Bacteria | 9775 |
| 56 | Ga0068863_100302345 | 3300005841 | Bacteria | 1552 |
| 57 | Ga0068858_100360906 | 3300005842 | Bacteria | 1392 |
| 58 | Ga0068860_100076698 | 3300005843 | Bacteria | 3179 |
| 59 | Ga0068862_100001247 | 3300005844 | Bacteria | 23931 |
| 60 | Ga0081455_10063685 | 3300005937 | Bacteria | 3092 |
| 61 | Ga0081540_1000281 | 3300005983 | Bacteria | 52990 |
| 62 | Ga0081540_1045901 | 3300005983 | Bacteria | 2212 |
| 63 | Ga0081539_10002195 | 3300005985 | Bacteria | 28613 |
| 64 | Ga0075363_100308305 | 3300006048 | Bacteria | 919 |
| 65 | Ga0070715_10248864 | 3300006163 | Bacteria | 928 |
| 66 | Ga0070712_100333416 | 3300006175 | Bacteria | 1237 |
| 67 | Ga0075370_10367529 | 3300006353 | Bacteria | 861 |
| 68 | Ga0075430_100043648 | 3300006846 | Bacteria | 3790 |
| 69 | Ga0075433_10004429 | 3300006852 | Bacteria | 10932 |
| 70 | Ga0075434_100992962 | 3300006871 | Bacteria | 853 |
| 71 | Ga0068865_100000024 | 3300006881 | Bacteria | 94969 |
| 72 | Ga0097620_101102450 | 3300006931 | Bacteria | 873 |
| 73 | Ga0105240_10402473 | 3300009093 | Bacteria | 1541 |
| 74 | Ga0105245_10000528 | 3300009098 | Bacteria | 35016 |
| 75 | Ga0105245_10019614 | 3300009098 | Bacteria | 5924 |
| 76 | Ga0105247_10019328 | 3300009101 | Bacteria | 4089 |
| 77 | Ga0105247_10193652 | 3300009101 | Bacteria | 1362 |
| 78 | Ga0105243_10006175 | 3300009148 | Bacteria | 9263 |
| 79 | Ga0105241_10287652 | 3300009174 | Bacteria | 1406 |
| 80 | Ga0105242_10000123 | 3300009176 | Bacteria | 56900 |
| 81 | Ga0105242_10003277 | 3300009176 | Bacteria | 12618 |
| 82 | Ga0105248_10001735 | 3300009177 | Bacteria | 24226 |
| 83 | Ga0105238_10322187 | 3300009551 | Bacteria | 1532 |
| 84 | Ga0105238_10432182 | 3300009551 | Bacteria | 1312 |
| 85 | Ga0105030_108643 | 3300009987 | Bacteria | 867 |
| 86 | Ga0105239_10032561 | 3300010375 | Bacteria | 5728 |
| 87 | Ga0105239_10183680 | 3300010375 | Bacteria | 2340 |
| 88 | Ga0105239_10320952 | 3300010375 | Bacteria | 1746 |
| 89 | Ga0157370_10213556 | 3300013104 | Bacteria | 1788 |
| 90 | Ga0157369_10000068 | 3300013105 | Bacteria | 144274 |
| 91 | Ga0157378_10048351 | 3300013297 | Bacteria | 3782 |
| 92 | Ga0157378_10104189 | 3300013297 | Bacteria | 2593 |
| 93 | Ga0157378_10233477 | 3300013297 | Bacteria | 1754 |
| 94 | Ga0163162_10088547 | 3300013306 | Bacteria | 3175 |
| 95 | Ga0163162_11207412 | 3300013306 | Bacteria | 858 |
| 96 | Ga0157372_10000809 | 3300013307 | Bacteria | 33940 |
| 97 | Ga0157375_10016258 | 3300013308 | Bacteria | 6675 |
| 98 | Ga0157375_10600233 | 3300013308 | Bacteria | 1260 |
| 99 | Ga0163163_10471068 | 3300014325 | Bacteria | 1317 |
| 100 | Ga0157380_10000326 | 3300014326 | Bacteria | 28781 |
| 101 | Ga0157379_10025779 | 3300014968 | Bacteria | 5226 |
| 102 | Ga0157376_10060903 | 3300014969 | Bacteria | 3172 |
| 103 | Ga0157376_10067012 | 3300014969 | Bacteria | 3036 |
| 104 | Ga0157376_10334933 | 3300014969 | Bacteria | 1443 |
| 105 | Ga0206354_11410537 | 3300020081 | Bacteria | 1114 |
| 106 | Ga0224712_10004702 | 3300022467 | Bacteria | 3712 |
| 107 | Ga0207656_10000374 | 3300025321 | Bacteria | 15006 |
| 108 | Ga0207656_10001048 | 3300025321 | Bacteria | 9048 |
| 109 | Ga0207642_10007311 | 3300025899 | Bacteria | 3722 |
| 110 | Ga0207710_10000220 | 3300025900 | Bacteria | 50023 |
| 111 | Ga0207710_10034933 | 3300025900 | Bacteria | 2211 |
| 112 | Ga0207680_10010652 | 3300025903 | Bacteria | 4610 |
| 113 | Ga0207680_10163663 | 3300025903 | Bacteria | 1494 |
| 114 | Ga0207705_10014343 | 3300025909 | Bacteria | 5703 |
| 115 | Ga0207649_10000166 | 3300025920 | Bacteria | 53758 |
| 116 | Ga0207649_10384407 | 3300025920 | Bacteria | 1047 |
| 117 | Ga0207652_10000917 | 3300025921 | Bacteria | 27806 |
| 118 | Ga0207694_10380094 | 3300025924 | Bacteria | 1172 |
| 119 | Ga0207659_10000138 | 3300025926 | Bacteria | 42755 |
| 120 | Ga0207687_10000025 | 3300025927 | Bacteria | 175177 |
| 121 | Ga0207687_10002690 | 3300025927 | Bacteria | 12023 |
| 122 | Ga0207700_10000019 | 3300025928 | Bacteria | 183117 |
| 123 | Ga0207664_10013567 | 3300025929 | Bacteria | 5855 |
| 124 | Ga0207644_10501598 | 3300025931 | Bacteria | 1001 |
| 125 | Ga0207690_10003914 | 3300025932 | Bacteria | 8802 |
| 126 | Ga0207686_10000066 | 3300025934 | Bacteria | 95095 |
| 127 | Ga0207686_10001614 | 3300025934 | Bacteria | 12622 |
| 128 | Ga0207709_10002223 | 3300025935 | Bacteria | 12376 |
| 129 | Ga0207670_10297906 | 3300025936 | Bacteria | 1262 |
| 130 | Ga0207704_10000308 | 3300025938 | Bacteria | 22892 |
| 131 | Ga0207691_10000430 | 3300025940 | Bacteria | 41789 |
| 132 | Ga0207711_10000011 | 3300025941 | Bacteria | 518817 |
| 133 | Ga0207689_10251183 | 3300025942 | Bacteria | 1462 |
| 134 | Ga0207661_10000518 | 3300025944 | Bacteria | 24943 |
| 135 | Ga0207661_10000616 | 3300025944 | Bacteria | 22858 |
| 136 | Ga0207661_10009756 | 3300025944 | Bacteria | 6896 |
| 137 | Ga0207661_10153591 | 3300025944 | Bacteria | 1992 |
| 138 | Ga0207679_10006381 | 3300025945 | Bacteria | 7448 |
| 139 | Ga0207712_10809954 | 3300025961 | Bacteria | 824 |
| 140 | Ga0207668_10011784 | 3300025972 | Bacteria | 5327 |
| 141 | Ga0207668_10028292 | 3300025972 | Bacteria | 3663 |
| 142 | Ga0207640_10000821 | 3300025981 | Bacteria | 17670 |
| 143 | Ga0207658_10000840 | 3300025986 | Bacteria | 25652 |
| 144 | Ga0207658_10109895 | 3300025986 | Bacteria | 2177 |
| 145 | Ga0207677_10001476 | 3300026023 | Bacteria | 12436 |
| 146 | Ga0207703_10533339 | 3300026035 | Bacteria | 1105 |
| 147 | Ga0207678_10244452 | 3300026067 | Bacteria | 1537 |
| 148 | Ga0207678_10300116 | 3300026067 | Bacteria | 1380 |
| 149 | Ga0207708_10156105 | 3300026075 | Bacteria | 1800 |
| 150 | Ga0207702_10002042 | 3300026078 | Bacteria | 19546 |
| 151 | Ga0207641_10015727 | 3300026088 | Bacteria | 6200 |
| 152 | Ga0207641_10105321 | 3300026088 | Bacteria | 2491 |
| 153 | Ga0207674_10330824 | 3300026116 | Bacteria | 1473 |
| 154 | Ga0207675_100664139 | 3300026118 | Bacteria | 1049 |
| 155 | Ga0207683_10038808 | 3300026121 | Bacteria | 4154 |
| 156 | Ga0207698_10000014 | 3300026142 | Bacteria | 240703 |
| 157 | Ga0207698_10032167 | 3300026142 | Bacteria | 3797 |
| 158 | Ga0268266_10001628 | 3300028379 | Bacteria | 26120 |
| 159 | Ga0268266_10018264 | 3300028379 | Bacteria | 5979 |
| 160 | Ga0268266_10055970 | 3300028379 | Bacteria | 3392 |
| 161 | Ga0268265_10000667 | 3300028380 | Bacteria | 34047 |
| 162 | Ga0268264_10846754 | 3300028381 | Bacteria | 916 |
| 163 | Ga0265319_1000030 | 3300028563 | Bacteria | 129742 |
| 164 | Ga0265338_10000156 | 3300028800 | Bacteria | 125065 |
| 165 | Ga0316181_1236952 | 3300030744 | Bacteria | 1363 |
| 166 | Ga0316182_1103924 | 3300030745 | Bacteria | 6246 |
| 167 | Ga0265325_10010101 | 3300031241 | Bacteria | 5483 |
| 168 | Ga0265327_10102824 | 3300031251 | Bacteria | 1376 |
| 169 | Ga0316575_10179342 | 3300031665 | Unclassified | 879 |
| 170 | Ga0307405_10581697 | 3300031731 | Bacteria | 911 |
| 171 | Ga0307412_10547488 | 3300031911 | Bacteria | 971 |
| 172 | Ga0439465_0153680 | 3300041413 | Bacteria | 823 |
| 173 | Ga0451807_2709994 | 3300041486 | Bacteria | 1126 |
| 174 | Ga0451833_0601880 | 3300041491 | Bacteria | 3363 |
| 175 | Ga0451833_0895723 | 3300041491 | Bacteria | 2705 |
| 176 | Ga0451837_1001135 | 3300041494 | Bacteria | 6440 |
| 177 | Ga0451845_0823628 | 3300041501 | Bacteria | 1919 |
| 178 | Ga0451853_0406739 | 3300041512 | Bacteria | 1125 |
| 179 | Ga0439445_0028057 | 3300042004 | Bacteria | 1449 |
| 180 | Ga0439445_0032745 | 3300042004 | Bacteria | 1356 |
| 181 | Ga0439432_007856 | 3300042006 | Bacteria | 3762 |
| 182 | Ga0451577_0000328 | 3300042876 | Bacteria | 88518 |
| 183 | Ga0451577_0087004 | 3300042876 | Bacteria | 2788 |
| 184 | Ga0451577_0126618 | 3300042876 | Bacteria | 2289 |
| 185 | Ga0451577_0158136 | 3300042876 | Bacteria | 2040 |
| 186 | Ga0453683_0000002 | 3300044673 | Bacteria | 1244396 |
| 187 | Ga0453683_0000848 | 3300044673 | Bacteria | 29516 |
| 188 | Ga0453683_0003668 | 3300044673 | Bacteria | 11245 |
| 189 | Ga0453683_0030691 | 3300044673 | Bacteria | 3397 |
| 190 | Ga0453684_0000950 | 3300044712 | Bacteria | 95538 |
| 191 | Ga0453684_0005204 | 3300044712 | Bacteria | 26125 |
| 192 | Ga0453684_0028025 | 3300044712 | Bacteria | 8053 |
| 193 | Ga0466957_0004792 | 3300044842 | Bacteria | 7572 |
| 194 | Ga0466957_0043709 | 3300044842 | Bacteria | 2714 |
| 195 | Ga0466960_0059318 | 3300044901 | Bacteria | 1872 |
| 196 | Ga0451576_0000151 | 3300045051 | Bacteria | 176466 |
| 197 | Ga0451576_0005912 | 3300045051 | Bacteria | 15170 |
| 198 | Ga0451576_0417213 | 3300045051 | Bacteria | 1408 |
| 199 | Ga0466958_0138861 | 3300045836 | Bacteria | 1529 |
| 200 | Ga0466967_0000003 | 3300045976 | Bacteria | 169144 |
| 201 | Ga0495592_0130275 | 3300046454 | Bacteria | 1760 |
| 202 | Ga0495592_0219027 | 3300046454 | Bacteria | 1274 |
| 203 | Ga0495629_0000543 | 3300046459 | Bacteria | 31107 |
| 204 | Ga0495629_0033292 | 3300046459 | Bacteria | 3646 |
| 205 | Ga0495629_0140631 | 3300046459 | Bacteria | 1679 |
| 206 | Ga0495641_0023186 | 3300046461 | Bacteria | 3089 |
| 207 | Ga0495651_0050048 | 3300046462 | Bacteria | 3225 |
| 208 | Ga0495653_0067045 | 3300046463 | Bacteria | 2697 |
| 209 | Ga0495594_0000001 | 3300046499 | Bacteria | 293051 |
| 210 | Ga0495606_0000283 | 3300046507 | Bacteria | 88309 |
| 211 | Ga0495608_0000010 | 3300046511 | Bacteria | 258660 |
| 212 | Ga0495628_0000864 | 3300046516 | Bacteria | 28036 |
| 213 | Ga0495628_0176466 | 3300046516 | Bacteria | 1618 |
| 214 | Ga0495630_0000148 | 3300046517 | Bacteria | 54619 |
| 215 | Ga0495630_0000395 | 3300046517 | Bacteria | 34351 |
| 216 | Ga0495630_0028236 | 3300046517 | Bacteria | 4169 |
| 217 | Ga0495652_0000009 | 3300046529 | Bacteria | 311000 |
| 218 | Ga0495640_0009674 | 3300046533 | Bacteria | 7495 |
| 219 | Ga0495587_0029873 | 3300046536 | Bacteria | 3307 |
| 220 | Ga0495587_0054221 | 3300046536 | Bacteria | 2363 |
| 221 | Ga0495587_0256387 | 3300046536 | Bacteria | 983 |
| 222 | Ga0495645_0004698 | 3300046543 | Bacteria | 9326 |
| 223 | Ga0495622_0000069 | 3300046557 | Bacteria | 89759 |
| 224 | Ga0495667_0010689 | 3300046559 | Bacteria | 6207 |
| 225 | Ga0495625_0000109 | 3300046660 | Bacteria | 125064 |
| 226 | Ga0495625_0118853 | 3300046660 | Bacteria | 1800 |
| 227 | Ga0495635_0087861 | 3300046663 | Bacteria | 2127 |
| 228 | Ga0495588_0000175 | 3300046674 | Bacteria | 80911 |
| 229 | Ga0495657_0000005 | 3300046675 | Bacteria | 254860 |
| 230 | Ga0495657_0014713 | 3300046675 | Bacteria | 5742 |
| 231 | Ga0495647_0000114 | 3300046681 | Bacteria | 20349 |
| 232 | Ga0495658_0006678 | 3300046683 | Bacteria | 5671 |
| 233 | Ga0495613_0000087 | 3300046689 | Bacteria | 88644 |
| 234 | Ga0495624_0000429 | 3300046690 | Bacteria | 33305 |
| 235 | Ga0495600_0019425 | 3300046809 | Bacteria | 4339 |
| 236 | Ga0495660_0144283 | 3300046810 | Bacteria | 1181 |
| 237 | Ga0495604_0000322 | 3300047317 | Bacteria | 42966 |
| 238 | Ga0495674_0000141 | 3300047319 | Bacteria | 55539 |
| 239 | Ga0495672_0116441 | 3300047320 | Bacteria | 1427 |
| 240 | Ga0495676_0000522 | 3300047321 | Bacteria | 31518 |
| 241 | Ga0495676_0034901 | 3300047321 | Bacteria | 4214 |
| 242 | Ga0495680_0075724 | 3300047322 | Bacteria | 2553 |
| 243 | Ga0495680_0091590 | 3300047322 | Bacteria | 2279 |
| 244 | Ga0495675_0000398 | 3300047444 | Bacteria | 30075 |
| 245 | Ga0495684_0141338 | 3300047471 | Bacteria | 1805 |
| 246 | Ga0495686_0217173 | 3300047472 | Bacteria | 1089 |
| 247 | Ga0495602_0000038 | 3300048088 | Bacteria | 130758 |
| 248 | Ga0495602_0003702 | 3300048088 | Bacteria | 15861 |
| 249 | Ga0495602_0037972 | 3300048088 | Bacteria | 4460 |
| 250 | Ga0495602_0223358 | 3300048088 | Bacteria | 1420 |
| 251 | Ga0496100_0000028 | 3300048903 | Bacteria | 113912 |
| 252 | Ga0496101_0000005 | 3300048904 | Bacteria | 331455 |
| 253 | Ga0496102_0000021 | 3300048905 | Bacteria | 246920 |
| 254 | Ga0496102_0176450 | 3300048905 | Bacteria | 2012 |
| 255 | Ga0496103_0000001 | 3300048906 | Bacteria | 643471 |
| 256 | Ga0496104_0000029 | 3300048907 | Bacteria | 202968 |
| 257 | Ga0496104_0037414 | 3300048907 | Bacteria | 4539 |
| 258 | Ga0496104_0056802 | 3300048907 | Bacteria | 3703 |
| 259 | Ga0496105_0000002 | 3300048908 | Bacteria | 753215 |
| 260 | Ga0496106_0000070 | 3300048909 | Bacteria | 82770 |
| 261 | Ga0496106_0218603 | 3300048909 | Bacteria | 1519 |
| 262 | Ga0496107_0000004 | 3300048910 | Bacteria | 297680 |
| 263 | Ga0496107_0017709 | 3300048910 | Bacteria | 5013 |
| 264 | Ga0496108_0000042 | 3300048911 | Bacteria | 146397 |
| 265 | Ga0496108_0002451 | 3300048911 | Bacteria | 14838 |
| 266 | Ga0496109_0000034 | 3300048912 | Bacteria | 160397 |
| 267 | Ga0496109_0000062 | 3300048912 | Bacteria | 112843 |
| 268 | Ga0496110_0000325 | 3300048913 | Bacteria | 31707 |
| 269 | Ga0496110_0077462 | 3300048913 | Bacteria | 2958 |
| 270 | Ga0496111_0000171 | 3300048914 | Bacteria | 29367 |
| 271 | Ga0496112_0017988 | 3300048915 | Bacteria | 6650 |
| 272 | Ga0496113_0000002 | 3300048916 | Bacteria | 220193 |
| 273 | Ga0496114_0000097 | 3300048917 | Bacteria | 63410 |
| 274 | Ga0496114_0137030 | 3300048917 | Bacteria | 2117 |
| 275 | Ga0496115_0000151 | 3300048918 | Bacteria | 64493 |
| 276 | Ga0496119_0015147 | 3300048922 | Bacteria | 5967 |
| 277 | Ga0496119_0188351 | 3300048922 | Bacteria | 1077 |
| 278 | Ga0496121_0029534 | 3300048924 | Bacteria | 5066 |
| 279 | Ga0496124_0203023 | 3300048927 | Bacteria | 1506 |
| 280 | Ga0496124_0293280 | 3300048927 | Bacteria | 1179 |
| 281 | Ga0501031_0016044 | 3300049568 | Bacteria | 4863 |
| 282 | Ga0501032_0223940 | 3300049569 | Bacteria | 1224 |
| 283 | Ga0501032_0294038 | 3300049569 | Bacteria | 1050 |
| 284 | Ga0501034_0009432 | 3300049571 | Bacteria | 10214 |
| 285 | Ga0501034_0738539 | 3300049571 | Bacteria | 880 |
| 286 | Ga0501036_0197014 | 3300049572 | Bacteria | 1695 |
| 287 | Ga0501037_0141622 | 3300049573 | Bacteria | 1720 |
| 288 | Ga0501038_0178030 | 3300049574 | Bacteria | 1717 |
| 289 | Ga0501039_0185534 | 3300049575 | Bacteria | 1636 |
| 290 | Ga0501039_0187959 | 3300049575 | Bacteria | 1624 |
| 291 | Ga0501040_0148635 | 3300049576 | Bacteria | 1652 |
| 292 | Ga0501042_0020760 | 3300049578 | Bacteria | 4573 |
| 293 | Ga0501043_0004838 | 3300049579 | Bacteria | 10893 |
| 294 | Ga0501043_0635300 | 3300049579 | Bacteria | 785 |
| 295 | Ga0501046_0001288 | 3300049580 | Bacteria | 24284 |
| 296 | Ga0501047_0006076 | 3300049581 | Bacteria | 11348 |
| 297 | Ga0501047_0031813 | 3300049581 | Bacteria | 5090 |
| 298 | Ga0501047_0231925 | 3300049581 | Bacteria | 1699 |
| 299 | Ga0501048_0020228 | 3300049582 | Bacteria | 4878 |
| 300 | Ga0501067_0074750 | 3300049583 | Bacteria | 1878 |
| 301 | Ga0501068_0159494 | 3300049584 | Bacteria | 1421 |
| 302 | Ga0501068_0574508 | 3300049584 | Bacteria | 734 |
| 303 | Ga0501069_0175114 | 3300049585 | Bacteria | 1239 |
| 304 | Ga0501070_0000267 | 3300049586 | Bacteria | 49167 |
| 305 | Ga0501070_0064865 | 3300049586 | Bacteria | 3024 |
| 306 | Ga0501073_0121466 | 3300049589 | Bacteria | 1810 |
| 307 | Ga0501079_0110131 | 3300049741 | Bacteria | 2139 |
| 308 | Ga0501080_0349922 | 3300049742 | Bacteria | 1334 |
| 309 | Ga0501080_0671530 | 3300049742 | Bacteria | 915 |
| 310 | Ga0501083_0018653 | 3300049744 | Bacteria | 4833 |
| 311 | Ga0501035_0000877 | 3300049822 | Bacteria | 31897 |
| 312 | Ga0501044_0001422 | 3300049823 | Bacteria | 28073 |
| 313 | Ga0501045_0174664 | 3300049824 | Bacteria | 1600 |
| 314 | nmdc:mga03n38_295362_c1 | 3300050490 | Bacteria | 869 |
| 315 | nmdc:mga00v17_209932_c1 | 3300050491 | Bacteria | 1260 |
| 316 | nmdc:mga07m45_229969_c1 | 3300050496 | Bacteria | 1079 |
| 317 | nmdc:mga0qj67_251582_c1 | 3300050509 | Bacteria | 1434 |
| 318 | nmdc:mga0a205_15_c2 | 3300050515 | Bacteria | 75060 |
| 319 | Ga0495601_0000698 | 3300053077 | Bacteria | 18035 |
| 320 | Ga0495601_0090130 | 3300053077 | Bacteria | 1972 |
| 321 | Ga0495612_0001451 | 3300053078 | Bacteria | 9769 |
| 322 | Ga0495655_0000013 | 3300053083 | Bacteria | 63264 |
| 323 | Ga0495655_0000120 | 3300053083 | Bacteria | 14477 |
| 324 | Ga0495595_0000005 | 3300053084 | Bacteria | 258660 |
| 325 | Ga0495595_0309950 | 3300053084 | Bacteria | 794 |
| 326 | Ga0495619_0000036 | 3300053085 | Bacteria | 125188 |
| 327 | Ga0495619_0000069 | 3300053085 | Bacteria | 82755 |
| 328 | Ga0495619_0000489 | 3300053085 | Bacteria | 26595 |
| 329 | Ga0495619_0001945 | 3300053085 | Bacteria | 13767 |
| 330 | Ga0500566_0013929 | 3300053094 | Bacteria | 4727 |
| 331 | Ga0500641_0008993 | 3300053096 | Bacteria | 3580 |
| 332 | Ga0500628_000045 | 3300053129 | Bacteria | 45042 |
| 333 | Ga0501084_0215435 | 3300054114 | Bacteria | 1620 |
| 334 | Ga0501082_0235196 | 3300060353 | Bacteria | 1594 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041491 | Ga0451833_0601880 | Ga0451833_0601880_2635_3201 | 153 |
| 2 | 3300041494 | Ga0451837_1001135 | Ga0451837_1001135_4026_4592 | 153 |
| 3 | 3300046559 | Ga0495667_0010689 | Ga0495667_0010689_2724_3281 | 179 |
| 4 | 3300053085 | Ga0495619_0000036 | Ga0495619_0000036_92311_92868 | 179 |
| 5 | 3300041413 | Ga0439465_0153680 | Ga0439465_0153680_93_641 | 181 |
| 6 | 3300041491 | Ga0451833_0895723 | Ga0451833_0895723_1042_1593 | 182 |
| 7 | iso_pu_bacteria | 2643221962 | 2645723815 | 183 |
| 8 | 3300006871 | Ga0075434_100992962 | Ga0075434_1009929621 | 184 |
| 9 | 3300005334 | Ga0068869_100201096 | Ga0068869_1002010962 | 187 |
| 10 | 3300006353 | Ga0075370_10367529 | Ga0075370_103675292 | 187 |
| 11 | 3300009987 | Ga0105030_108643 | Ga0105030_1086432 | 187 |
| 12 | 3300025942 | Ga0207689_10251183 | Ga0207689_102511832 | 187 |
| 13 | 3300025961 | Ga0207712_10809954 | Ga0207712_108099542 | 187 |
| 14 | 3300030744 | Ga0316181_1236952 | Ga0316181_12369522 | 187 |
| 15 | 3300030745 | Ga0316182_1103924 | Ga0316182_11039242 | 187 |
| 16 | 3300042004 | Ga0439445_0028057 | Ga0439445_0028057_41_607 | 187 |
| 17 | 3300042004 | Ga0439445_0032745 | Ga0439445_0032745_472_1038 | 187 |
| 18 | 3300042006 | Ga0439432_007856 | Ga0439432_007856_2820_3386 | 187 |
| 19 | 3300049584 | Ga0501068_0574508 | Ga0501068_0574508_130_696 | 187 |
| 20 | 3300050496 | nmdc:mga07m45_229969_c1 | nmdc:mga07m45_229969_c1_140_706 | 187 |
| 21 | 3300005548 | Ga0070665_100276946 | Ga0070665_1002769462 | 188 |
| 22 | 3300005441 | Ga0070700_100074204 | Ga0070700_1000742041 | 198 |
| 23 | 3300005456 | Ga0070678_100023357 | Ga0070678_1000233573 | 198 |
| 24 | 3300046463 | Ga0495653_0067045 | Ga0495653_0067045_1740_2354 | 198 |
| 25 | 3300046674 | Ga0495588_0000175 | Ga0495588_0000175_45116_45730 | 198 |
| 26 | 3300046810 | Ga0495660_0144283 | Ga0495660_0144283_517_1131 | 198 |
| 27 | 3300048913 | Ga0496110_0077462 | Ga0496110_0077462_818_1432 | 198 |
| 28 | 3300048917 | Ga0496114_0000097 | Ga0496114_0000097_34036_34650 | 198 |
| 29 | 3300048918 | Ga0496115_0000151 | Ga0496115_0000151_35138_35752 | 198 |
| 30 | 3300048927 | Ga0496124_0203023 | Ga0496124_0203023_566_1180 | 198 |
| 31 | 3300050515 | nmdc:mga0a205_15_c2 | nmdc:mga0a205_15_c2_17115_17729 | 198 |
| 32 | 3300045976 | Ga0466967_0000003 | Ga0466967_0000003_35285_35965 | 211 |
| 33 | 3300031665 | Ga0316575_10179342 | Ga0316575_101793421 | 212 |
| 34 | 3300049575 | Ga0501039_0185534 | Ga0501039_0185534_773_1453 | 212 |
| 35 | 3300042876 | Ga0451577_0126618 | Ga0451577_0126618_137_781 | 214 |
| 36 | 3300044673 | Ga0453683_0003668 | Ga0453683_0003668_10467_11111 | 214 |
| 37 | 3300044712 | Ga0453684_0005204 | Ga0453684_0005204_6564_7208 | 214 |
| 38 | 3300045051 | Ga0451576_0000151 | Ga0451576_0000151_165404_166048 | 214 |
| 39 | 3300044673 | Ga0453683_0000848 | Ga0453683_0000848_17917_18570 | 215 |
| 40 | 3300005295 | Ga0065707_10087143 | Ga0065707_100871433 | 216 |
| 41 | 3300042876 | Ga0451577_0000328 | Ga0451577_0000328_3897_4547 | 216 |
| 42 | 3300042876 | Ga0451577_0087004 | Ga0451577_0087004_596_1246 | 216 |
| 43 | 3300042876 | Ga0451577_0158136 | Ga0451577_0158136_830_1480 | 216 |
| 44 | 3300044673 | Ga0453683_0000002 | Ga0453683_0000002_895517_896167 | 216 |
| 45 | 3300044673 | Ga0453683_0030691 | Ga0453683_0030691_233_883 | 216 |
| 46 | 3300044712 | Ga0453684_0000950 | Ga0453684_0000950_10809_11459 | 216 |
| 47 | 3300044712 | Ga0453684_0028025 | Ga0453684_0028025_4492_5142 | 216 |
| 48 | 3300045051 | Ga0451576_0005912 | Ga0451576_0005912_10420_11070 | 216 |
| 49 | 3300045051 | Ga0451576_0417213 | Ga0451576_0417213_416_1066 | 216 |
| 50 | 3300049578 | Ga0501042_0020760 | Ga0501042_0020760_2582_3253 | 217 |
| 51 | 3300001977 | JGI24746J21847_1000007 | JGI24746J21847_100000726 | 220 |
| 52 | 3300005327 | Ga0070658_10019454 | Ga0070658_100194548 | 220 |
| 53 | 3300005329 | Ga0070683_100011264 | Ga0070683_1000112643 | 220 |
| 54 | 3300005329 | Ga0070683_100103396 | Ga0070683_1001033962 | 220 |
| 55 | 3300005329 | Ga0070683_100162836 | Ga0070683_1001628362 | 220 |
| 56 | 3300005335 | Ga0070666_10073588 | Ga0070666_100735881 | 220 |
| 57 | 3300005337 | Ga0070682_100000032 | Ga0070682_100000032153 | 220 |
| 58 | 3300005338 | Ga0068868_100008360 | Ga0068868_10000836012 | 220 |
| 59 | 3300005340 | Ga0070689_100344263 | Ga0070689_1003442632 | 220 |
| 60 | 3300005341 | Ga0070691_10004069 | Ga0070691_1000406910 | 220 |
| 61 | 3300005344 | Ga0070661_100000236 | Ga0070661_10000023619 | 220 |
| 62 | 3300005344 | Ga0070661_100208553 | Ga0070661_1002085532 | 220 |
| 63 | 3300005344 | Ga0070661_100455963 | Ga0070661_1004559632 | 220 |
| 64 | 3300005345 | Ga0070692_10208773 | Ga0070692_102087732 | 220 |
| 65 | 3300005347 | Ga0070668_100012523 | Ga0070668_1000125234 | 220 |
| 66 | 3300005347 | Ga0070668_100043738 | Ga0070668_1000437383 | 220 |
| 67 | 3300005354 | Ga0070675_100003153 | Ga0070675_10000315310 | 220 |
| 68 | 3300005355 | Ga0070671_100453109 | Ga0070671_1004531092 | 220 |
| 69 | 3300005365 | Ga0070688_100000168 | Ga0070688_1000001685 | 220 |
| 70 | 3300005365 | Ga0070688_100000562 | Ga0070688_1000005625 | 220 |
| 71 | 3300005365 | Ga0070688_100145408 | Ga0070688_1001454082 | 220 |
| 72 | 3300005366 | Ga0070659_100140970 | Ga0070659_1001409702 | 220 |
| 73 | 3300005367 | Ga0070667_100001611 | Ga0070667_1000016118 | 220 |
| 74 | 3300005367 | Ga0070667_100051933 | Ga0070667_1000519332 | 220 |
| 75 | 3300005435 | Ga0070714_100036840 | Ga0070714_1000368405 | 220 |
| 76 | 3300005436 | Ga0070713_100000171 | Ga0070713_10000017136 | 220 |
| 77 | 3300005436 | Ga0070713_100102600 | Ga0070713_1001026003 | 220 |
| 78 | 3300005438 | Ga0070701_10080489 | Ga0070701_100804892 | 220 |
| 79 | 3300005455 | Ga0070663_100024140 | Ga0070663_1000241405 | 220 |
| 80 | 3300005455 | Ga0070663_100778605 | Ga0070663_1007786051 | 220 |
| 81 | 3300005466 | Ga0070685_10000246 | Ga0070685_100002465 | 220 |
| 82 | 3300005466 | Ga0070685_10001063 | Ga0070685_100010635 | 220 |
| 83 | 3300005530 | Ga0070679_100000832 | Ga0070679_10000083215 | 220 |
| 84 | 3300005535 | Ga0070684_100065586 | Ga0070684_1000655864 | 220 |
| 85 | 3300005535 | Ga0070684_100067227 | Ga0070684_1000672272 | 220 |
| 86 | 3300005535 | Ga0070684_100098552 | Ga0070684_1000985522 | 220 |
| 87 | 3300005543 | Ga0070672_100000104 | Ga0070672_10000010417 | 220 |
| 88 | 3300005548 | Ga0070665_100051471 | Ga0070665_1000514712 | 220 |
| 89 | 3300005548 | Ga0070665_100065177 | Ga0070665_1000651773 | 220 |
| 90 | 3300005564 | Ga0070664_100085966 | Ga0070664_1000859664 | 220 |
| 91 | 3300005564 | Ga0070664_100153083 | Ga0070664_1001530832 | 220 |
| 92 | 3300005577 | Ga0068857_100311195 | Ga0068857_1003111952 | 220 |
| 93 | 3300005578 | Ga0068854_100000939 | Ga0068854_10000093915 | 220 |
| 94 | 3300005614 | Ga0068856_100007857 | Ga0068856_1000078578 | 220 |
| 95 | 3300005616 | Ga0068852_100000024 | Ga0068852_1000000245 | 220 |
| 96 | 3300005617 | Ga0068859_101102345 | Ga0068859_1011023452 | 220 |
| 97 | 3300005718 | Ga0068866_10010127 | Ga0068866_100101272 | 220 |
| 98 | 3300005834 | Ga0068851_10007702 | Ga0068851_100077025 | 220 |
| 99 | 3300005834 | Ga0068851_10018801 | Ga0068851_100188014 | 220 |
| 100 | 3300005841 | Ga0068863_100008951 | Ga0068863_1000089515 | 220 |
| 101 | 3300005841 | Ga0068863_100302345 | Ga0068863_1003023452 | 220 |
| 102 | 3300005842 | Ga0068858_100360906 | Ga0068858_1003609062 | 220 |
| 103 | 3300005843 | Ga0068860_100076698 | Ga0068860_1000766981 | 220 |
| 104 | 3300005844 | Ga0068862_100001247 | Ga0068862_1000012478 | 220 |
| 105 | 3300005937 | Ga0081455_10063685 | Ga0081455_100636852 | 220 |
| 106 | 3300005983 | Ga0081540_1000281 | Ga0081540_100028165 | 220 |
| 107 | 3300005983 | Ga0081540_1045901 | Ga0081540_10459012 | 220 |
| 108 | 3300005985 | Ga0081539_10002195 | Ga0081539_1000219533 | 220 |
| 109 | 3300006048 | Ga0075363_100308305 | Ga0075363_1003083052 | 220 |
| 110 | 3300006163 | Ga0070715_10248864 | Ga0070715_102488642 | 220 |
| 111 | 3300006175 | Ga0070712_100333416 | Ga0070712_1003334161 | 220 |
| 112 | 3300006846 | Ga0075430_100043648 | Ga0075430_1000436485 | 220 |
| 113 | 3300006852 | Ga0075433_10004429 | Ga0075433_1000442914 | 220 |
| 114 | 3300006881 | Ga0068865_100000024 | Ga0068865_10000002495 | 220 |
| 115 | 3300006931 | Ga0097620_101102450 | Ga0097620_1011024502 | 220 |
| 116 | 3300009093 | Ga0105240_10402473 | Ga0105240_104024731 | 220 |
| 117 | 3300009098 | Ga0105245_10000528 | Ga0105245_1000052825 | 220 |
| 118 | 3300009098 | Ga0105245_10019614 | Ga0105245_100196145 | 220 |
| 119 | 3300009101 | Ga0105247_10019328 | Ga0105247_100193285 | 220 |
| 120 | 3300009101 | Ga0105247_10193652 | Ga0105247_101936522 | 220 |
| 121 | 3300009148 | Ga0105243_10006175 | Ga0105243_100061757 | 220 |
| 122 | 3300009174 | Ga0105241_10287652 | Ga0105241_102876522 | 220 |
| 123 | 3300009176 | Ga0105242_10000123 | Ga0105242_1000012324 | 220 |
| 124 | 3300009176 | Ga0105242_10003277 | Ga0105242_100032772 | 220 |
| 125 | 3300009177 | Ga0105248_10001735 | Ga0105248_100017355 | 220 |
| 126 | 3300009551 | Ga0105238_10322187 | Ga0105238_103221871 | 220 |
| 127 | 3300009551 | Ga0105238_10432182 | Ga0105238_104321821 | 220 |
| 128 | 3300010375 | Ga0105239_10032561 | Ga0105239_100325618 | 220 |
| 129 | 3300010375 | Ga0105239_10183680 | Ga0105239_101836802 | 220 |
| 130 | 3300010375 | Ga0105239_10320952 | Ga0105239_103209522 | 220 |
| 131 | 3300013104 | Ga0157370_10213556 | Ga0157370_102135561 | 220 |
| 132 | 3300013105 | Ga0157369_10000068 | Ga0157369_10000068133 | 220 |
| 133 | 3300013297 | Ga0157378_10048351 | Ga0157378_100483515 | 220 |
| 134 | 3300013297 | Ga0157378_10104189 | Ga0157378_101041893 | 220 |
| 135 | 3300013297 | Ga0157378_10233477 | Ga0157378_102334772 | 220 |
| 136 | 3300013306 | Ga0163162_10088547 | Ga0163162_100885471 | 220 |
| 137 | 3300013306 | Ga0163162_11207412 | Ga0163162_112074122 | 220 |
| 138 | 3300013307 | Ga0157372_10000809 | Ga0157372_1000080924 | 220 |
| 139 | 3300013308 | Ga0157375_10016258 | Ga0157375_100162585 | 220 |
| 140 | 3300013308 | Ga0157375_10600233 | Ga0157375_106002332 | 220 |
| 141 | 3300014325 | Ga0163163_10471068 | Ga0163163_104710682 | 220 |
| 142 | 3300014326 | Ga0157380_10000326 | Ga0157380_100003265 | 220 |
| 143 | 3300014968 | Ga0157379_10025779 | Ga0157379_100257793 | 220 |
| 144 | 3300014969 | Ga0157376_10060903 | Ga0157376_100609033 | 220 |
| 145 | 3300014969 | Ga0157376_10067012 | Ga0157376_100670123 | 220 |
| 146 | 3300014969 | Ga0157376_10334933 | Ga0157376_103349332 | 220 |
| 147 | 3300020081 | Ga0206354_11410537 | Ga0206354_114105371 | 220 |
| 148 | 3300022467 | Ga0224712_10004702 | Ga0224712_100047022 | 220 |
| 149 | 3300025321 | Ga0207656_10000374 | Ga0207656_1000037416 | 220 |
| 150 | 3300025321 | Ga0207656_10001048 | Ga0207656_100010483 | 220 |
| 151 | 3300025899 | Ga0207642_10007311 | Ga0207642_100073112 | 220 |
| 152 | 3300025900 | Ga0207710_10000220 | Ga0207710_1000022050 | 220 |
| 153 | 3300025900 | Ga0207710_10034933 | Ga0207710_100349332 | 220 |
| 154 | 3300025903 | Ga0207680_10010652 | Ga0207680_100106523 | 220 |
| 155 | 3300025903 | Ga0207680_10163663 | Ga0207680_101636632 | 220 |
| 156 | 3300025909 | Ga0207705_10014343 | Ga0207705_1001434310 | 220 |
| 157 | 3300025920 | Ga0207649_10000166 | Ga0207649_1000016610 | 220 |
| 158 | 3300025920 | Ga0207649_10384407 | Ga0207649_103844072 | 220 |
| 159 | 3300025921 | Ga0207652_10000917 | Ga0207652_1000091725 | 220 |
| 160 | 3300025924 | Ga0207694_10380094 | Ga0207694_103800942 | 220 |
| 161 | 3300025926 | Ga0207659_10000138 | Ga0207659_1000013833 | 220 |
| 162 | 3300025927 | Ga0207687_10000025 | Ga0207687_1000002531 | 220 |
| 163 | 3300025927 | Ga0207687_10002690 | Ga0207687_1000269018 | 220 |
| 164 | 3300025928 | Ga0207700_10000019 | Ga0207700_10000019175 | 220 |
| 165 | 3300025929 | Ga0207664_10013567 | Ga0207664_100135678 | 220 |
| 166 | 3300025931 | Ga0207644_10501598 | Ga0207644_105015982 | 220 |
| 167 | 3300025932 | Ga0207690_10003914 | Ga0207690_100039149 | 220 |
| 168 | 3300025934 | Ga0207686_10000066 | Ga0207686_1000006682 | 220 |
| 169 | 3300025934 | Ga0207686_10001614 | Ga0207686_1000161423 | 220 |
| 170 | 3300025935 | Ga0207709_10002223 | Ga0207709_100022237 | 220 |
| 171 | 3300025936 | Ga0207670_10297906 | Ga0207670_102979062 | 220 |
| 172 | 3300025938 | Ga0207704_10000308 | Ga0207704_1000030814 | 220 |
| 173 | 3300025940 | Ga0207691_10000430 | Ga0207691_1000043017 | 220 |
| 174 | 3300025941 | Ga0207711_10000011 | Ga0207711_1000001144 | 220 |
| 175 | 3300025944 | Ga0207661_10000518 | Ga0207661_1000051816 | 220 |
| 176 | 3300025944 | Ga0207661_10000616 | Ga0207661_1000061617 | 220 |
| 177 | 3300025944 | Ga0207661_10009756 | Ga0207661_100097564 | 220 |
| 178 | 3300025944 | Ga0207661_10153591 | Ga0207661_101535912 | 220 |
| 179 | 3300025945 | Ga0207679_10006381 | Ga0207679_100063813 | 220 |
| 180 | 3300025972 | Ga0207668_10011784 | Ga0207668_100117842 | 220 |
| 181 | 3300025972 | Ga0207668_10028292 | Ga0207668_100282922 | 220 |
| 182 | 3300025981 | Ga0207640_10000821 | Ga0207640_1000082112 | 220 |
| 183 | 3300025986 | Ga0207658_10000840 | Ga0207658_1000084030 | 220 |
| 184 | 3300025986 | Ga0207658_10109895 | Ga0207658_101098952 | 220 |
| 185 | 3300026023 | Ga0207677_10001476 | Ga0207677_100014764 | 220 |
| 186 | 3300026035 | Ga0207703_10533339 | Ga0207703_105333392 | 220 |
| 187 | 3300026067 | Ga0207678_10244452 | Ga0207678_102444522 | 220 |
| 188 | 3300026067 | Ga0207678_10300116 | Ga0207678_103001162 | 220 |
| 189 | 3300026075 | Ga0207708_10156105 | Ga0207708_101561052 | 220 |
| 190 | 3300026078 | Ga0207702_10002042 | Ga0207702_1000204210 | 220 |
| 191 | 3300026088 | Ga0207641_10015727 | Ga0207641_100157276 | 220 |
| 192 | 3300026088 | Ga0207641_10105321 | Ga0207641_101053212 | 220 |
| 193 | 3300026116 | Ga0207674_10330824 | Ga0207674_103308242 | 220 |
| 194 | 3300026118 | Ga0207675_100664139 | Ga0207675_1006641391 | 220 |
| 195 | 3300026121 | Ga0207683_10038808 | Ga0207683_100388082 | 220 |
| 196 | 3300026142 | Ga0207698_10000014 | Ga0207698_1000001462 | 220 |
| 197 | 3300026142 | Ga0207698_10032167 | Ga0207698_100321673 | 220 |
| 198 | 3300028379 | Ga0268266_10001628 | Ga0268266_1000162812 | 220 |
| 199 | 3300028379 | Ga0268266_10018264 | Ga0268266_100182646 | 220 |
| 200 | 3300028379 | Ga0268266_10055970 | Ga0268266_100559705 | 220 |
| 201 | 3300028380 | Ga0268265_10000667 | Ga0268265_1000066727 | 220 |
| 202 | 3300028381 | Ga0268264_10846754 | Ga0268264_108467542 | 220 |
| 203 | 3300028563 | Ga0265319_1000030 | Ga0265319_100003055 | 220 |
| 204 | 3300028800 | Ga0265338_10000156 | Ga0265338_1000015655 | 220 |
| 205 | 3300031241 | Ga0265325_10010101 | Ga0265325_100101016 | 220 |
| 206 | 3300031251 | Ga0265327_10102824 | Ga0265327_101028242 | 220 |
| 207 | 3300031731 | Ga0307405_10581697 | Ga0307405_105816972 | 220 |
| 208 | 3300031911 | Ga0307412_10547488 | Ga0307412_105474881 | 220 |
| 209 | 3300041486 | Ga0451807_2709994 | Ga0451807_2709994_239_919 | 220 |
| 210 | 3300041501 | Ga0451845_0823628 | Ga0451845_0823628_903_1583 | 220 |
| 211 | 3300041512 | Ga0451853_0406739 | Ga0451853_0406739_184_864 | 220 |
| 212 | 3300044842 | Ga0466957_0004792 | Ga0466957_0004792_1454_2134 | 220 |
| 213 | 3300044842 | Ga0466957_0043709 | Ga0466957_0043709_895_1575 | 220 |
| 214 | 3300044901 | Ga0466960_0059318 | Ga0466960_0059318_315_989 | 220 |
| 215 | 3300045836 | Ga0466958_0138861 | Ga0466958_0138861_720_1400 | 220 |
| 216 | 3300046454 | Ga0495592_0130275 | Ga0495592_0130275_484_1164 | 220 |
| 217 | 3300046454 | Ga0495592_0219027 | Ga0495592_0219027_491_1171 | 220 |
| 218 | 3300046459 | Ga0495629_0000543 | Ga0495629_0000543_17054_17734 | 220 |
| 219 | 3300046459 | Ga0495629_0033292 | Ga0495629_0033292_1028_1708 | 220 |
| 220 | 3300046459 | Ga0495629_0140631 | Ga0495629_0140631_130_810 | 220 |
| 221 | 3300046461 | Ga0495641_0023186 | Ga0495641_0023186_596_1276 | 220 |
| 222 | 3300046462 | Ga0495651_0050048 | Ga0495651_0050048_1895_2575 | 220 |
| 223 | 3300046499 | Ga0495594_0000001 | Ga0495594_0000001_36930_37610 | 220 |
| 224 | 3300046507 | Ga0495606_0000283 | Ga0495606_0000283_54826_55506 | 220 |
| 225 | 3300046511 | Ga0495608_0000010 | Ga0495608_0000010_246724_247404 | 220 |
| 226 | 3300046516 | Ga0495628_0000864 | Ga0495628_0000864_22848_23528 | 220 |
| 227 | 3300046516 | Ga0495628_0176466 | Ga0495628_0176466_787_1467 | 220 |
| 228 | 3300046517 | Ga0495630_0000148 | Ga0495630_0000148_41320_42000 | 220 |
| 229 | 3300046517 | Ga0495630_0000395 | Ga0495630_0000395_21306_21986 | 220 |
| 230 | 3300046517 | Ga0495630_0028236 | Ga0495630_0028236_1761_2441 | 220 |
| 231 | 3300046529 | Ga0495652_0000009 | Ga0495652_0000009_223871_224551 | 220 |
| 232 | 3300046533 | Ga0495640_0009674 | Ga0495640_0009674_5973_6653 | 220 |
| 233 | 3300046536 | Ga0495587_0029873 | Ga0495587_0029873_1586_2266 | 220 |
| 234 | 3300046536 | Ga0495587_0054221 | Ga0495587_0054221_526_1206 | 220 |
| 235 | 3300046536 | Ga0495587_0256387 | Ga0495587_0256387_88_768 | 220 |
| 236 | 3300046543 | Ga0495645_0004698 | Ga0495645_0004698_2216_2896 | 220 |
| 237 | 3300046557 | Ga0495622_0000069 | Ga0495622_0000069_41379_42059 | 220 |
| 238 | 3300046660 | Ga0495625_0000109 | Ga0495625_0000109_77900_78580 | 220 |
| 239 | 3300046660 | Ga0495625_0118853 | Ga0495625_0118853_373_1050 | 220 |
| 240 | 3300046663 | Ga0495635_0087861 | Ga0495635_0087861_431_1111 | 220 |
| 241 | 3300046675 | Ga0495657_0000005 | Ga0495657_0000005_7457_8137 | 220 |
| 242 | 3300046675 | Ga0495657_0014713 | Ga0495657_0014713_4402_5082 | 220 |
| 243 | 3300046681 | Ga0495647_0000114 | Ga0495647_0000114_7624_8304 | 220 |
| 244 | 3300046683 | Ga0495658_0006678 | Ga0495658_0006678_4435_5115 | 220 |
| 245 | 3300046689 | Ga0495613_0000087 | Ga0495613_0000087_83079_83759 | 220 |
| 246 | 3300046690 | Ga0495624_0000429 | Ga0495624_0000429_13780_14460 | 220 |
| 247 | 3300046809 | Ga0495600_0019425 | Ga0495600_0019425_2101_2781 | 220 |
| 248 | 3300047317 | Ga0495604_0000322 | Ga0495604_0000322_16672_17352 | 220 |
| 249 | 3300047319 | Ga0495674_0000141 | Ga0495674_0000141_17789_18469 | 220 |
| 250 | 3300047320 | Ga0495672_0116441 | Ga0495672_0116441_680_1360 | 220 |
| 251 | 3300047321 | Ga0495676_0000522 | Ga0495676_0000522_12415_13095 | 220 |
| 252 | 3300047321 | Ga0495676_0034901 | Ga0495676_0034901_374_1054 | 220 |
| 253 | 3300047322 | Ga0495680_0075724 | Ga0495680_0075724_686_1366 | 220 |
| 254 | 3300047322 | Ga0495680_0091590 | Ga0495680_0091590_912_1592 | 220 |
| 255 | 3300047444 | Ga0495675_0000398 | Ga0495675_0000398_3635_4315 | 220 |
| 256 | 3300047471 | Ga0495684_0141338 | Ga0495684_0141338_723_1403 | 220 |
| 257 | 3300047472 | Ga0495686_0217173 | Ga0495686_0217173_362_1042 | 220 |
| 258 | 3300048088 | Ga0495602_0000038 | Ga0495602_0000038_24286_24966 | 220 |
| 259 | 3300048088 | Ga0495602_0003702 | Ga0495602_0003702_10831_11511 | 220 |
| 260 | 3300048088 | Ga0495602_0037972 | Ga0495602_0037972_83_763 | 220 |
| 261 | 3300048088 | Ga0495602_0223358 | Ga0495602_0223358_160_840 | 220 |
| 262 | 3300048903 | Ga0496100_0000028 | Ga0496100_0000028_92460_93140 | 220 |
| 263 | 3300048904 | Ga0496101_0000005 | Ga0496101_0000005_242459_243139 | 220 |
| 264 | 3300048905 | Ga0496102_0000021 | Ga0496102_0000021_170350_171030 | 220 |
| 265 | 3300048905 | Ga0496102_0176450 | Ga0496102_0176450_1307_1987 | 220 |
| 266 | 3300048906 | Ga0496103_0000001 | Ga0496103_0000001_424877_425557 | 220 |
| 267 | 3300048907 | Ga0496104_0000029 | Ga0496104_0000029_183172_183852 | 220 |
| 268 | 3300048907 | Ga0496104_0037414 | Ga0496104_0037414_2146_2826 | 220 |
| 269 | 3300048907 | Ga0496104_0056802 | Ga0496104_0056802_2885_3565 | 220 |
| 270 | 3300048908 | Ga0496105_0000002 | Ga0496105_0000002_183172_183852 | 220 |
| 271 | 3300048909 | Ga0496106_0000070 | Ga0496106_0000070_61356_62036 | 220 |
| 272 | 3300048909 | Ga0496106_0218603 | Ga0496106_0218603_727_1407 | 220 |
| 273 | 3300048910 | Ga0496107_0000004 | Ga0496107_0000004_242676_243356 | 220 |
| 274 | 3300048910 | Ga0496107_0017709 | Ga0496107_0017709_4114_4794 | 220 |
| 275 | 3300048911 | Ga0496108_0000042 | Ga0496108_0000042_115691_116368 | 220 |
| 276 | 3300048911 | Ga0496108_0002451 | Ga0496108_0002451_7119_7799 | 220 |
| 277 | 3300048912 | Ga0496109_0000034 | Ga0496109_0000034_148330_149007 | 220 |
| 278 | 3300048912 | Ga0496109_0000062 | Ga0496109_0000062_9684_10364 | 220 |
| 279 | 3300048913 | Ga0496110_0000325 | Ga0496110_0000325_15999_16679 | 220 |
| 280 | 3300048914 | Ga0496111_0000171 | Ga0496111_0000171_12928_13608 | 220 |
| 281 | 3300048915 | Ga0496112_0017988 | Ga0496112_0017988_5149_5829 | 220 |
| 282 | 3300048916 | Ga0496113_0000002 | Ga0496113_0000002_23099_23779 | 220 |
| 283 | 3300048917 | Ga0496114_0137030 | Ga0496114_0137030_950_1630 | 220 |
| 284 | 3300048922 | Ga0496119_0015147 | Ga0496119_0015147_1188_1868 | 220 |
| 285 | 3300048922 | Ga0496119_0188351 | Ga0496119_0188351_204_884 | 220 |
| 286 | 3300048924 | Ga0496121_0029534 | Ga0496121_0029534_3820_4500 | 220 |
| 287 | 3300048927 | Ga0496124_0293280 | Ga0496124_0293280_141_821 | 220 |
| 288 | 3300049568 | Ga0501031_0016044 | Ga0501031_0016044_138_818 | 220 |
| 289 | 3300049569 | Ga0501032_0223940 | Ga0501032_0223940_143_823 | 220 |
| 290 | 3300049569 | Ga0501032_0294038 | Ga0501032_0294038_209_889 | 220 |
| 291 | 3300049571 | Ga0501034_0009432 | Ga0501034_0009432_9060_9740 | 220 |
| 292 | 3300049571 | Ga0501034_0738539 | Ga0501034_0738539_68_748 | 220 |
| 293 | 3300049572 | Ga0501036_0197014 | Ga0501036_0197014_885_1565 | 220 |
| 294 | 3300049573 | Ga0501037_0141622 | Ga0501037_0141622_911_1591 | 220 |
| 295 | 3300049574 | Ga0501038_0178030 | Ga0501038_0178030_911_1591 | 220 |
| 296 | 3300049575 | Ga0501039_0187959 | Ga0501039_0187959_678_1358 | 220 |
| 297 | 3300049576 | Ga0501040_0148635 | Ga0501040_0148635_912_1592 | 220 |
| 298 | 3300049579 | Ga0501043_0004838 | Ga0501043_0004838_8995_9675 | 220 |
| 299 | 3300049579 | Ga0501043_0635300 | Ga0501043_0635300_13_693 | 220 |
| 300 | 3300049580 | Ga0501046_0001288 | Ga0501046_0001288_4035_4715 | 220 |
| 301 | 3300049581 | Ga0501047_0006076 | Ga0501047_0006076_2803_3483 | 220 |
| 302 | 3300049581 | Ga0501047_0031813 | Ga0501047_0031813_2191_2871 | 220 |
| 303 | 3300049581 | Ga0501047_0231925 | Ga0501047_0231925_17_697 | 220 |
| 304 | 3300049582 | Ga0501048_0020228 | Ga0501048_0020228_4033_4713 | 220 |
| 305 | 3300049583 | Ga0501067_0074750 | Ga0501067_0074750_631_1311 | 220 |
| 306 | 3300049584 | Ga0501068_0159494 | Ga0501068_0159494_565_1245 | 220 |
| 307 | 3300049585 | Ga0501069_0175114 | Ga0501069_0175114_205_885 | 220 |
| 308 | 3300049586 | Ga0501070_0000267 | Ga0501070_0000267_11737_12417 | 220 |
| 309 | 3300049586 | Ga0501070_0064865 | Ga0501070_0064865_1683_2363 | 220 |
| 310 | 3300049589 | Ga0501073_0121466 | Ga0501073_0121466_222_902 | 220 |
| 311 | 3300049741 | Ga0501079_0110131 | Ga0501079_0110131_1410_2090 | 220 |
| 312 | 3300049742 | Ga0501080_0349922 | Ga0501080_0349922_97_777 | 220 |
| 313 | 3300049742 | Ga0501080_0671530 | Ga0501080_0671530_213_893 | 220 |
| 314 | 3300049744 | Ga0501083_0018653 | Ga0501083_0018653_4037_4717 | 220 |
| 315 | 3300049822 | Ga0501035_0000877 | Ga0501035_0000877_11935_12615 | 220 |
| 316 | 3300049823 | Ga0501044_0001422 | Ga0501044_0001422_12104_12784 | 220 |
| 317 | 3300049824 | Ga0501045_0174664 | Ga0501045_0174664_903_1583 | 220 |
| 318 | 3300050490 | nmdc:mga03n38_295362_c1 | nmdc:mga03n38_295362_c1_110_784 | 220 |
| 319 | 3300050491 | nmdc:mga00v17_209932_c1 | nmdc:mga00v17_209932_c1_375_1049 | 220 |
| 320 | 3300050509 | nmdc:mga0qj67_251582_c1 | nmdc:mga0qj67_251582_c1_377_1057 | 220 |
| 321 | 3300053077 | Ga0495601_0000698 | Ga0495601_0000698_15249_15929 | 220 |
| 322 | 3300053077 | Ga0495601_0090130 | Ga0495601_0090130_338_1018 | 220 |
| 323 | 3300053078 | Ga0495612_0001451 | Ga0495612_0001451_7114_7794 | 220 |
| 324 | 3300053083 | Ga0495655_0000013 | Ga0495655_0000013_26519_27199 | 220 |
| 325 | 3300053083 | Ga0495655_0000120 | Ga0495655_0000120_4449_5129 | 220 |
| 326 | 3300053084 | Ga0495595_0000005 | Ga0495595_0000005_11257_11937 | 220 |
| 327 | 3300053084 | Ga0495595_0309950 | Ga0495595_0309950_96_776 | 220 |
| 328 | 3300053085 | Ga0495619_0000069 | Ga0495619_0000069_61858_62538 | 220 |
| 329 | 3300053085 | Ga0495619_0000489 | Ga0495619_0000489_22283_22963 | 220 |
| 330 | 3300053085 | Ga0495619_0001945 | Ga0495619_0001945_10248_10928 | 220 |
| 331 | 3300053094 | Ga0500566_0013929 | Ga0500566_0013929_55_735 | 220 |
| 332 | 3300053096 | Ga0500641_0008993 | Ga0500641_0008993_2143_2823 | 220 |
| 333 | 3300053129 | Ga0500628_000045 | Ga0500628_000045_15282_15962 | 220 |
| 334 | 3300054114 | Ga0501084_0215435 | Ga0501084_0215435_860_1540 | 220 |
| 335 | 3300060353 | Ga0501082_0235196 | Ga0501082_0235196_49_729 | 220 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4qbg-assembly1.cif.gz_B | crystal structure of a stable adenylate kinase variant aklse4 | 0.9736 | 4 | 220 |
| 4qbg-assembly1.cif.gz_B | crystal structure of a stable adenylate kinase variant aklse4 | 0.9692 | 4 | 220 |
| 1zip-assembly1.cif.gz_A | bacillus stearothermophilus adenylate kinase | 0.9684 | 4 | 220 |
| 4mkh-assembly1.cif.gz_A | crystal structure of a stable adenylate kinase variant akv18 | 0.9682 | 4 | 220 |
| 4tyq-assembly2.cif.gz_B | crystal structure of an adenylate kinase mutant--akm2 | 0.9656 | 4 | 217 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WKF5_1_180_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9676 | 4 | 215 | 3.40.50.300 |
| af_P9WKF5_1_180_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9571 | 4 | 215 | 3.40.50.300 |
| 4ikeB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9341 | 4 | 215 | 3.40.50.300 |
| 4typB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9312 | 4 | 213 | 3.40.50.300 |
| af_B4FL09_65_286_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.923 | 3 | 219 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9WN85-F1-model_v4 | Adenylate kinase (EC 2.7.4.3) | 0.9863 | 1 | 193 |
GO:0004017
GO:0005524 GO:0005737 |
| AF-A0A2G4G650-F1-model_v4 | Adenylate kinase (AK) (EC 2.7.4.3) (ATP-AMP transphosphorylase) (ATP:AMP phosphotransferase) (Adenylate monophosphate kinase) | 0.9821 | 4 | 215 |
GO:0004017
GO:0005524 GO:0005737 GO:0008270 GO:0044209 |
| AF-A0A6J4T9P4-F1-model_v4 | Adenylate kinase (EC 2.7.4.3) | 0.9816 | 2 | 218 |
GO:0004017
GO:0005524 GO:0005737 |
| AF-A0A7V2PJM8-F1-model_v4 | Adenylate kinase (AK) (EC 2.7.4.3) (ATP-AMP transphosphorylase) (ATP:AMP phosphotransferase) (Adenylate monophosphate kinase) | 0.9813 | 3 | 219 |
GO:0004017
GO:0005524 GO:0005737 GO:0008270 GO:0044209 |
| AF-A0A7V9WN85-F1-model_v4 | Adenylate kinase (EC 2.7.4.3) | 0.9813 | 1 | 193 |
GO:0004017
GO:0005524 GO:0005737 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar