F412072

General Info

Members Datasets Scaffolds Average Seq Length
335 209 330 143

Family's Representative Sequence

Representative Sequence 3300005288|Ga0065714_10021427|Ga0065714_100214273
Length 169
Sequence MAGETVITVVGNLTSDPELRYTQNGLAVANFTIASTPRNFDRATSEWKDGEALFLRASVWREFAEHVAGSLTKGSRVIASGRLKQRSYETKEGEKRTSMELEIDEIGPSLRYATASLTRAQSSSAPRGGAPVAQQQGNDEPWAPSAPAANTGGGDVWNTPGNFSDETPF

Samples

Sample ID Description Type Environment
1 2517572101 Frankia sp. DC12 Isolate Nodule
2 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
3 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
4 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
50 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
54 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
81 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
82 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
83 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
84 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
85 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
86 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
87 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
93 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
94 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
100 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
101 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
102 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
103 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
104 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
105 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
106 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
107 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
108 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
109 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
110 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
111 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
112 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
113 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
114 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
115 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
116 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
117 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
121 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
122 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
123 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
124 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
125 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
126 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
127 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
128 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
129 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
130 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
131 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
132 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
144 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
145 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
146 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
147 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
148 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
149 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
150 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
151 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
152 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
153 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
176 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
177 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
180 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
181 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
182 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
185 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
186 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
187 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
188 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
189 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
190 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
193 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
194 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
195 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
196 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
197 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
198 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
199 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
200 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
201 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
202 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
203 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
204 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
207 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
208 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
209 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.96
Metatranscriptomes 9.55
Isolates 1.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.22
Nodule 0.3
Rhizoplane 7.76
Rhizosphere 67.16
Stem 0
Stem Tuber 0
Unclassified 9.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055540_1030061 3300003792 Bacteria 1265
2 Ga0058863_11767744 3300004799 Bacteria 1331
3 Ga0058861_11718171 3300004800 Bacteria 917
4 Ga0058862_12317645 3300004803 Bacteria 695
5 Ga0065714_10021427 3300005288 Bacteria 1095
6 Ga0065714_10054755 3300005288 Bacteria 577
7 Ga0070683_100029247 3300005329 Bacteria 4986
8 Ga0070680_100294527 3300005336 Bacteria 1375
9 Ga0070668_100016009 3300005347 Bacteria 5611
10 Ga0070674_100151053 3300005356 Bacteria 1753
11 Ga0070667_101029500 3300005367 Bacteria 769
12 Ga0070714_100363560 3300005435 Bacteria 1361
13 Ga0070714_100792215 3300005435 Bacteria 917
14 Ga0070710_10384596 3300005437 Bacteria 937
15 Ga0070708_101454638 3300005445 Bacteria 639
16 Ga0070663_100646765 3300005455 Bacteria 894
17 Ga0070678_100586472 3300005456 Bacteria 994
18 Ga0070681_10867453 3300005458 Bacteria 821
19 Ga0070679_100262114 3300005530 Bacteria 1683
20 Ga0070679_100680310 3300005530 Bacteria 971
21 Ga0070684_100652546 3300005535 Bacteria 980
22 Ga0068853_100070238 3300005539 Bacteria 3048
23 Ga0068853_100574288 3300005539 Bacteria 1069
24 Ga0070665_100892223 3300005548 Bacteria 902
25 Ga0068855_100163242 3300005563 Bacteria 2527
26 Ga0081455_10097205 3300005937 Bacteria 2373
27 Ga0075365_10021198 3300006038 Bacteria 4049
28 Ga0075365_10037259 3300006038 Bacteria 3156
29 Ga0075365_10148448 3300006038 Bacteria 1630
30 Ga0075365_10595517 3300006038 Bacteria 782
31 Ga0075363_100006695 3300006048 Bacteria 5257
32 Ga0075363_100039811 3300006048 Bacteria 2475
33 Ga0075363_100077465 3300006048 Bacteria 1814
34 Ga0075363_100309080 3300006048 Bacteria 918
35 Ga0075364_10000313 3300006051 Bacteria 23763
36 Ga0075364_10204582 3300006051 Bacteria 1338
37 Ga0075364_10447534 3300006051 Bacteria 882
38 Ga0075362_10008094 3300006177 Bacteria 4008
39 Ga0075362_10021215 3300006177 Bacteria 2723
40 Ga0075362_10079406 3300006177 Bacteria 1510
41 Ga0075367_10076291 3300006178 Bacteria 2022
42 Ga0075367_10141968 3300006178 Bacteria 1488
43 Ga0075367_10229756 3300006178 Bacteria 1162
44 Ga0075369_10045602 3300006186 Bacteria 1885
45 Ga0075369_10049855 3300006186 Bacteria 1809
46 Ga0075369_10064380 3300006186 Bacteria 1605
47 Ga0075370_10028113 3300006353 Bacteria 3124
48 Ga0075370_10066386 3300006353 Bacteria 2058
49 Ga0075435_101246876 3300007076 Bacteria 651
50 Ga0105240_10645391 3300009093 Bacteria 1161
51 Ga0105247_10000024 3300009101 Bacteria 210946
52 Ga0114129_10303113 3300009147 Bacteria 2128
53 Ga0105242_10360235 3300009176 Bacteria 1346
54 Ga0105248_10077715 3300009177 Bacteria 3731
55 Ga0105237_10014123 3300009545 Bacteria 8357
56 Ga0105249_10564123 3300009553 Bacteria 1190
57 Ga0105239_10017001 3300010375 Bacteria 8041
58 Ga0157370_10289587 3300013104 Bacteria 1513
59 Ga0157369_10047677 3300013105 Bacteria 4650
60 Ga0157369_10130227 3300013105 Bacteria 2666
61 Ga0171462_1002 3300013250 Bacteria 1052134
62 Ga0157372_10531557 3300013307 Bacteria 1371
63 Ga0157372_10699347 3300013307 Bacteria 1180
64 Ga0157375_10600056 3300013308 Bacteria 1260
65 Ga0163163_10058202 3300014325 Bacteria 3821
66 Ga0157380_10105523 3300014326 Bacteria 2355
67 Ga0183365_11489 3300015684 Bacteria 849
68 Ga0183360_11206 3300015689 Bacteria 876
69 Ga0163161_10084540 3300017792 Bacteria 2340
70 Ga0197907_10961421 3300020069 Bacteria 1055
71 Ga0206355_1038144 3300020076 Bacteria 2000
72 Ga0206350_11586544 3300020080 Bacteria 634
73 Ga0206354_10214892 3300020081 Bacteria 868
74 Ga0206353_11965733 3300020082 Bacteria 634
75 Ga0209051_1000628 3300025303 Bacteria 40593
76 Ga0209051_1001487 3300025303 Bacteria 19629
77 Ga0207655_1012042 3300025728 Bacteria 5092
78 Ga0207710_10000045 3300025900 Bacteria 210957
79 Ga0207707_10376138 3300025912 Bacteria 1221
80 Ga0207671_10001793 3300025914 Bacteria 24059
81 Ga0207671_10029794 3300025914 Bacteria 4074
82 Ga0207663_10443748 3300025916 Bacteria 1000
83 Ga0207657_10602008 3300025919 Bacteria 857
84 Ga0207649_10829243 3300025920 Bacteria 723
85 Ga0207687_11219490 3300025927 Bacteria 647
86 Ga0207664_10334211 3300025929 Bacteria 1339
87 Ga0207664_10460971 3300025929 Bacteria 1135
88 Ga0207686_10124986 3300025934 Bacteria 1757
89 Ga0207709_10024067 3300025935 Bacteria 3473
90 Ga0207669_10329687 3300025937 Bacteria 1171
91 Ga0207704_10766090 3300025938 Bacteria 804
92 Ga0207711_10141995 3300025941 Bacteria 2161
93 Ga0207661_10083616 3300025944 Bacteria 2642
94 Ga0207667_10067699 3300025949 Bacteria 3719
95 Ga0207668_10009746 3300025972 Bacteria 5768
96 Ga0207639_10026359 3300026041 Bacteria 4225
97 Ga0207678_10091379 3300026067 Bacteria 2602
98 Ga0207702_10437195 3300026078 Bacteria 1267
99 Ga0207683_10120471 3300026121 Bacteria 2355
100 Ga0268266_10462884 3300028379 Bacteria 1207
101 Ga0307408_100243021 3300031548 Bacteria 1480
102 Ga0307405_10115789 3300031731 Bacteria 1824
103 Ga0307413_10170479 3300031824 Bacteria 1540
104 Ga0307413_10303332 3300031824 Bacteria 1212
105 Ga0307413_10602830 3300031824 Bacteria 899
106 Ga0307413_11559395 3300031824 Bacteria 585
107 Ga0307410_10111421 3300031852 Bacteria 1980
108 Ga0307410_10284288 3300031852 Bacteria 1299
109 Ga0307406_10001414 3300031901 Bacteria 13327
110 Ga0307406_10010729 3300031901 Bacteria 5177
111 Ga0307406_10024838 3300031901 Bacteria 3583
112 Ga0307406_10403323 3300031901 Bacteria 1084
113 Ga0307407_10005597 3300031903 Bacteria 5472
114 Ga0307407_10314357 3300031903 Bacteria 1097
115 Ga0307412_10397261 3300031911 Bacteria 1121
116 Ga0307412_10706518 3300031911 Bacteria 866
117 Ga0307409_101189411 3300031995 Bacteria 785
118 Ga0307416_100739760 3300032002 Bacteria 1075
119 Ga0307416_101179946 3300032002 Bacteria 871
120 Ga0307416_101610744 3300032002 Bacteria 754
121 Ga0307416_101611030 3300032002 Bacteria 754
122 Ga0307414_10488372 3300032004 Bacteria 1087
123 Ga0307414_10518867 3300032004 Bacteria 1057
124 Ga0307414_11256741 3300032004 Bacteria 686
125 Ga0307414_11260009 3300032004 Bacteria 685
126 Ga0307411_10272066 3300032005 Bacteria 1344
127 Ga0307411_11046457 3300032005 Bacteria 733
128 Ga0307415_100473497 3300032126 Bacteria 1088
129 Ga0307415_100673705 3300032126 Bacteria 930
130 Ga0307415_101015427 3300032126 Bacteria 772
131 Ga0307415_101389841 3300032126 Bacteria 668
132 Ga0307415_101619506 3300032126 Bacteria 622
133 Ga0373935_1169831 3300035692 Bacteria 573
134 Ga0316584_0335227 3300036712 Bacteria 1088
135 Ga0395899_0281452 3300037312 Bacteria 1131
136 Ga0395900_0506823 3300037418 Bacteria 1156
137 Ga0395900_0544392 3300037418 Bacteria 1106
138 Ga0395900_0778781 3300037418 Bacteria 886
139 Ga0395900_1136070 3300037418 Bacteria 698
140 Ga0395898_0018250 3300037466 Bacteria 7156
141 Ga0395898_0064168 3300037466 Bacteria 3562
142 Ga0395905_0225531 3300037471 Bacteria 1753
143 Ga0395905_0839327 3300037471 Bacteria 822
144 Ga0395901_0027819 3300038443 Bacteria 5814
145 Ga0395901_0362134 3300038443 Bacteria 1495
146 Ga0395901_0456410 3300038443 Bacteria 1306
147 Ga0395901_1013800 3300038443 Bacteria 805
148 Ga0436365_1428208 3300039437 Bacteria 1311
149 Ga0439436_0043522 3300041404 Bacteria 1281
150 Ga0439465_0007517 3300041413 Bacteria 3463
151 Ga0451791_1684085 3300041451 Bacteria 1587
152 Ga0451793_1458892 3300041452 Bacteria 3708
153 Ga0451797_1234086 3300041453 Bacteria 1019
154 Ga0451797_1323798 3300041453 Bacteria 989
155 Ga0451847_0641468 3300041503 Bacteria 927
156 Ga0439433_0054109 3300041999 Bacteria 949
157 Ga0466969_0039373 3300044656 Bacteria 2374
158 Ga0466966_0090065 3300044684 Bacteria 1905
159 Ga0466966_0154170 3300044684 Bacteria 1400
160 Ga0466966_0378584 3300044684 Bacteria 850
161 Ga0466961_0008394 3300044693 Bacteria 6579
162 Ga0466961_0576963 3300044693 Bacteria 677
163 Ga0466963_0005006 3300044694 Bacteria 7738
164 Ga0466963_0021561 3300044694 Bacteria 4067
165 Ga0466963_0071686 3300044694 Bacteria 2332
166 Ga0466963_0103053 3300044694 Bacteria 1955
167 Ga0466963_1203350 3300044694 Bacteria 532
168 Ga0466964_0248580 3300044706 Bacteria 876
169 Ga0466964_0383977 3300044706 Bacteria 730
170 Ga0466964_0434417 3300044706 Bacteria 693
171 Ga0466971_0150858 3300044719 Bacteria 1085
172 Ga0466968_0113082 3300044735 Bacteria 1222
173 Ga0466970_0171308 3300044765 Bacteria 1203
174 Ga0466970_0436895 3300044765 Bacteria 749
175 Ga0466957_0151843 3300044842 Bacteria 1498
176 Ga0466957_0206193 3300044842 Bacteria 1293
177 Ga0466957_0668787 3300044842 Bacteria 731
178 Ga0466957_0773460 3300044842 Bacteria 681
179 Ga0466960_0142271 3300044901 Bacteria 1275
180 Ga0466960_0357034 3300044901 Bacteria 834
181 Ga0466959_0129072 3300045049 Bacteria 1792
182 Ga0466959_0177294 3300045049 Bacteria 1492
183 Ga0466959_0362349 3300045049 Bacteria 988
184 Ga0466958_0023375 3300045836 Bacteria 3628
185 Ga0466958_0071254 3300045836 Bacteria 2128
186 Ga0466958_0099883 3300045836 Bacteria 1803
187 Ga0466967_0045031 3300045976 Bacteria 3832
188 Ga0466967_0379589 3300045976 Bacteria 1372
189 Ga0466967_0385519 3300045976 Bacteria 1361
190 Ga0466967_0481903 3300045976 Bacteria 1215
191 Ga0466967_1141301 3300045976 Bacteria 776
192 Ga0466967_1681348 3300045976 Bacteria 632
193 Ga0495638_0001483 3300046460 Bacteria 21203
194 Ga0495650_0337521 3300046471 Bacteria 500
195 Ga0495606_0007788 3300046507 Bacteria 9479
196 Ga0495644_0245833 3300046523 Bacteria 694
197 Ga0495648_0013828 3300046524 Bacteria 5945
198 Ga0495648_0048148 3300046524 Bacteria 2627
199 Ga0495654_0038605 3300046530 Bacteria 2387
200 Ga0495625_0194668 3300046660 Bacteria 1341
201 Ga0495625_0466949 3300046660 Bacteria 777
202 Ga0495635_0315581 3300046663 Bacteria 1047
203 Ga0495600_0518788 3300046809 Bacteria 731
204 Ga0495672_0002575 3300047320 Bacteria 16485
205 Ga0495672_0300691 3300047320 Bacteria 760
206 Ga0495673_0000444 3300047469 Bacteria 45563
207 Ga0495686_0001889 3300047472 Bacteria 20961
208 Ga0495686_0016616 3300047472 Bacteria 4986
209 Ga0496100_0002836 3300048903 Bacteria 8879
210 Ga0496100_0098449 3300048903 Bacteria 2010
211 Ga0496101_0000026 3300048904 Bacteria 199963
212 Ga0496101_0223236 3300048904 Bacteria 1463
213 Ga0496101_0532174 3300048904 Bacteria 929
214 Ga0496102_0000031 3300048905 Bacteria 217389
215 Ga0496102_0023598 3300048905 Bacteria 5465
216 Ga0496102_0449578 3300048905 Bacteria 1209
217 Ga0496103_0000025 3300048906 Bacteria 221144
218 Ga0496104_0122816 3300048907 Bacteria 2493
219 Ga0496105_0008082 3300048908 Bacteria 8178
220 Ga0496105_0371574 3300048908 Bacteria 1139
221 Ga0496105_0598209 3300048908 Bacteria 856
222 Ga0496106_0020434 3300048909 Bacteria 4914
223 Ga0496106_0021910 3300048909 Bacteria 4747
224 Ga0496107_0201986 3300048910 Bacteria 1477
225 Ga0496107_0301144 3300048910 Bacteria 1193
226 Ga0496108_0126453 3300048911 Bacteria 2195
227 Ga0496108_0332030 3300048911 Bacteria 1326
228 Ga0496111_0636945 3300048914 Bacteria 779
229 Ga0496112_0443310 3300048915 Bacteria 1236
230 Ga0496115_0009018 3300048918 Bacteria 7400
231 Ga0496116_0000084 3300048919 Bacteria 219579
232 Ga0496116_0000509 3300048919 Bacteria 52583
233 Ga0496117_0000018 3300048920 Bacteria 479613
234 Ga0496117_0004491 3300048920 Bacteria 15336
235 Ga0496117_0049339 3300048920 Bacteria 2995
236 Ga0496118_0000013 3300048921 Bacteria 574008
237 Ga0496118_0001558 3300048921 Bacteria 34068
238 Ga0496118_0077589 3300048921 Bacteria 2355
239 Ga0496118_0125775 3300048921 Bacteria 1660
240 Ga0496118_0136251 3300048921 Bacteria 1566
241 Ga0496119_0001033 3300048922 Bacteria 35640
242 Ga0496119_0058231 3300048922 Bacteria 2329
243 Ga0496119_0096382 3300048922 Bacteria 1669
244 Ga0496119_0211688 3300048922 Bacteria 997
245 Ga0496119_0349033 3300048922 Bacteria 717
246 Ga0496120_0000418 3300048923 Bacteria 67915
247 Ga0496120_0095618 3300048923 Bacteria 1579
248 Ga0496121_0000056 3300048924 Bacteria 296250
249 Ga0496122_0190170 3300048925 Bacteria 1213
250 Ga0496123_0174241 3300048926 Bacteria 1131
251 Ga0496124_0041534 3300048927 Bacteria 3968
252 Ga0496124_0051526 3300048927 Bacteria 3502
253 Ga0496124_0326971 3300048927 Bacteria 1095
254 Ga0496125_0000230 3300048928 Bacteria 114490
255 Ga0496125_0021720 3300048928 Bacteria 5975
256 Ga0496125_0079697 3300048928 Bacteria 2511
257 Ga0496126_0002664 3300048929 Bacteria 23643
258 Ga0496126_0229851 3300048929 Bacteria 1554
259 Ga0501306_020212 3300049127 Bacteria 924
260 Ga0501309_025965 3300049129 Bacteria 844
261 Ga0501305_019608 3300049161 Bacteria 988
262 Ga0501305_040731 3300049161 Bacteria 755
263 Ga0501305_047216 3300049161 Bacteria 715
264 Ga0501307_039225 3300049162 Bacteria 683
265 Ga0501311_071351 3300049527 Bacteria 577
266 Ga0501313_019807 3300049529 Bacteria 825
267 Ga0501315_012833 3300049531 Bacteria 1042
268 Ga0501316_003150 3300049532 Bacteria 1583
269 Ga0501317_003008 3300049533 Bacteria 1645
270 Ga0501317_004069 3300049533 Bacteria 1501
271 Ga0501317_010607 3300049533 Bacteria 1104
272 Ga0501318_007040 3300049534 Bacteria 1163
273 Ga0501318_008519 3300049534 Bacteria 1098
274 Ga0501318_011567 3300049534 Bacteria 999
275 Ga0501318_022690 3300049534 Bacteria 806
276 Ga0501321_007895 3300049537 Bacteria 1116
277 Ga0501323_005359 3300049539 Bacteria 1401
278 Ga0501323_039301 3300049539 Bacteria 689
279 Ga0501324_016437 3300049540 Bacteria 726
280 Ga0501324_017142 3300049540 Bacteria 716
281 Ga0501032_0002608 3300049569 Bacteria 14092
282 Ga0501034_0016640 3300049571 Bacteria 7540
283 Ga0501037_0000365 3300049573 Bacteria 37978
284 Ga0501038_0006076 3300049574 Bacteria 11170
285 Ga0501039_0000118 3300049575 Bacteria 54344
286 Ga0501042_0235440 3300049578 Bacteria 1321
287 Ga0501043_0000931 3300049579 Bacteria 25918
288 Ga0501067_0066310 3300049583 Bacteria 1998
289 Ga0501068_0463708 3300049584 Bacteria 820
290 Ga0501069_0224904 3300049585 Bacteria 1091
291 Ga0501070_0000548 3300049586 Bacteria 34385
292 Ga0501070_0685257 3300049586 Bacteria 811
293 Ga0501071_0213555 3300049587 Bacteria 1451
294 Ga0501073_0009392 3300049589 Bacteria 7222
295 Ga0501077_0093930 3300049593 Bacteria 1901
296 Ga0501217_293743 3300049661 Bacteria 535
297 Ga0501080_0120118 3300049742 Bacteria 2436
298 Ga0501035_1224428 3300049822 Bacteria 582
299 nmdc:mga03n38_103020_c1 3300050490 Bacteria 1379
300 nmdc:mga03n38_154911_c1 3300050490 Bacteria 1156
301 nmdc:mga03n38_4799_c1 3300050490 Bacteria 4526
302 nmdc:mga00v17_107361_c1 3300050491 Bacteria 1768
303 nmdc:mga00v17_38801_c1 3300050491 Bacteria 2421
304 nmdc:mga00v17_98144_c1 3300050491 Bacteria 1847
305 nmdc:mga0yw44_134912_c1 3300050492 Bacteria 1601
306 nmdc:mga0yw44_13507_c1 3300050492 Bacteria 4303
307 nmdc:mga0yw44_14023_c1 3300050492 Bacteria 4241
308 nmdc:mga06z11_11576_c1 3300050494 Bacteria 3809
309 nmdc:mga04h51_31182_c1 3300050495 Bacteria 1683
310 nmdc:mga07m45_16212_c1 3300050496 Bacteria 3989
311 nmdc:mga05p37_192583_c1 3300050507 Bacteria 2474
312 nmdc:mga0rr50_690441_c1 3300050513 Bacteria 871
313 nmdc:mga0sz30_22081_c1 3300050516 Bacteria 2580
314 nmdc:mga0sz30_5284_c3 3300050516 Bacteria 3437
315 Ga0500610_0010181 3300053079 Bacteria 4217
316 Ga0500643_009169 3300053087 Bacteria 3804
317 Ga0500556_0000008 3300053104 Bacteria 304943
318 Ga0500562_014754 3300053108 Bacteria 2002
319 Ga0500655_058928 3300053133 Bacteria 772
320 Ga0500568_0000003 3300053139 Bacteria 863587
321 Ga0500589_174940 3300053147 Bacteria 849
322 Ga0500604_0026727 3300053151 Bacteria 1666
323 Ga0500616_0006211 3300053153 Bacteria 7882
324 Ga0500616_0009295 3300053153 Bacteria 5988
325 Ga0500616_0036377 3300053153 Bacteria 2672
326 Ga0500627_0064033 3300053158 Bacteria 1621
327 Ga0587073_0019918 3300059492 Bacteria 1273
328 Ga0587107_014939 3300059652 Bacteria 1006
329 Ga0501082_0225445 3300060353 Bacteria 1631
330 Ga0466962_0044694 3300061719 Bacteria 2119

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041503 Ga0451847_0641468 Ga0451847_0641468_333_743 114
2 3300046471 Ga0495650_0337521 Ga0495650_0337521_79_489 115
3 3300005437 Ga0070710_10384596 Ga0070710_103845961 127
4 3300041451 Ga0451791_1684085 Ga0451791_1684085_895_1404 129
5 3300005435 Ga0070714_100363560 Ga0070714_1003635601 131
6 3300025929 Ga0207664_10334211 Ga0207664_103342113 131
7 3300044693 Ga0466961_0008394 Ga0466961_0008394_5335_5823 131
8 3300044694 Ga0466963_1203350 Ga0466963_1203350_13_501 131
9 3300044706 Ga0466964_0383977 Ga0466964_0383977_222_710 131
10 3300044719 Ga0466971_0150858 Ga0466971_0150858_353_841 131
11 3300044765 Ga0466970_0171308 Ga0466970_0171308_478_966 131
12 3300044842 Ga0466957_0151843 Ga0466957_0151843_457_945 131
13 3300044901 Ga0466960_0142271 Ga0466960_0142271_513_998 131
14 3300045049 Ga0466959_0177294 Ga0466959_0177294_424_912 131
15 3300045836 Ga0466958_0023375 Ga0466958_0023375_641_1129 131
16 3300049162 Ga0501307_039225 Ga0501307_039225_39_566 131
17 3300049527 Ga0501311_071351 Ga0501311_071351_11_538 131
18 3300049532 Ga0501316_003150 Ga0501316_003150_537_1064 131
19 3300049537 Ga0501321_007895 Ga0501321_007895_188_715 131
20 3300025728 Ga0207655_1012042 Ga0207655_10120424 132
21 3300031824 Ga0307413_10602830 Ga0307413_106028301 132
22 3300031901 Ga0307406_10010729 Ga0307406_100107297 132
23 3300032126 Ga0307415_101015427 Ga0307415_1010154271 132
24 3300041404 Ga0439436_0043522 Ga0439436_0043522_334_834 132
25 3300049531 Ga0501315_012833 Ga0501315_012833_10_537 132
26 3300049533 Ga0501317_004069 Ga0501317_004069_531_1049 132
27 3300006038 Ga0075365_10021198 Ga0075365_100211985 133
28 3300006051 Ga0075364_10447534 Ga0075364_104475342 133
29 3300006178 Ga0075367_10141968 Ga0075367_101419682 133
30 3300006186 Ga0075369_10045602 Ga0075369_100456022 133
31 3300025935 Ga0207709_10024067 Ga0207709_100240678 133
32 3300050491 nmdc:mga00v17_107361_c1 nmdc:mga00v17_107361_c1_1103_1627 133
33 3300050492 nmdc:mga0yw44_14023_c1 nmdc:mga0yw44_14023_c1_1377_1901 133
34 3300007076 Ga0075435_101246876 Ga0075435_1012468761 134
35 3300009093 Ga0105240_10645391 Ga0105240_106453912 134
36 3300037312 Ga0395899_0281452 Ga0395899_0281452_151_690 134
37 3300037418 Ga0395900_0778781 Ga0395900_0778781_337_876 134
38 3300037466 Ga0395898_0018250 Ga0395898_0018250_1749_2288 134
39 3300037471 Ga0395905_0225531 Ga0395905_0225531_982_1521 134
40 3300048908 Ga0496105_0598209 Ga0496105_0598209_184_663 134
41 3300049742 Ga0501080_0120118 Ga0501080_0120118_1014_1595 134
42 3300050513 nmdc:mga0rr50_690441_c1 nmdc:mga0rr50_690441_c1_373_852 134
43 3300005530 Ga0070679_100680310 Ga0070679_1006803101 135
44 3300005535 Ga0070684_100652546 Ga0070684_1006525462 135
45 3300009176 Ga0105242_10360235 Ga0105242_103602353 135
46 3300009553 Ga0105249_10564123 Ga0105249_105641231 135
47 3300013105 Ga0157369_10047677 Ga0157369_100476775 135
48 3300013307 Ga0157372_10531557 Ga0157372_105315572 135
49 3300013308 Ga0157375_10600056 Ga0157375_106000562 135
50 3300014326 Ga0157380_10105523 Ga0157380_101055233 135
51 3300017792 Ga0163161_10084540 Ga0163161_100845403 135
52 3300031824 Ga0307413_10303332 Ga0307413_103033322 135
53 3300031901 Ga0307406_10001414 Ga0307406_100014143 135
54 3300031903 Ga0307407_10314357 Ga0307407_103143573 135
55 3300031911 Ga0307412_10706518 Ga0307412_107065182 135
56 3300032004 Ga0307414_10488372 Ga0307414_104883722 135
57 3300037418 Ga0395900_0544392 Ga0395900_0544392_18_524 135
58 3300038443 Ga0395901_0362134 Ga0395901_0362134_55_546 135
59 3300041453 Ga0451797_1323798 Ga0451797_1323798_27_548 135
60 3300044656 Ga0466969_0039373 Ga0466969_0039373_1103_1582 135
61 3300044694 Ga0466963_0005006 Ga0466963_0005006_3073_3561 135
62 3300048921 Ga0496118_0077589 Ga0496118_0077589_1020_1541 135
63 3300048922 Ga0496119_0349033 Ga0496119_0349033_137_658 135
64 3300048928 Ga0496125_0000230 Ga0496125_0000230_68091_68585 135
65 3300049534 Ga0501318_008519 Ga0501318_008519_371_850 135
66 3300049540 Ga0501324_017142 Ga0501324_017142_184_675 135
67 iso_pu_bacteria 2517572101 2517761650 135
68 3300006038 Ga0075365_10148448 Ga0075365_101484482 136
69 3300006178 Ga0075367_10229756 Ga0075367_102297561 136
70 3300009147 Ga0114129_10303113 Ga0114129_103031132 136
71 3300025916 Ga0207663_10443748 Ga0207663_104437481 136
72 3300032004 Ga0307414_11256741 Ga0307414_112567411 136
73 3300038443 Ga0395901_0027819 Ga0395901_0027819_5197_5682 136
74 3300039437 Ga0436365_1428208 Ga0436365_1428208_553_1041 136
75 3300044706 Ga0466964_0248580 Ga0466964_0248580_226_726 136
76 3300045976 Ga0466967_1141301 Ga0466967_1141301_38_538 136
77 3300048921 Ga0496118_0136251 Ga0496118_0136251_940_1458 136
78 3300048927 Ga0496124_0041534 Ga0496124_0041534_2756_3274 136
79 3300048927 Ga0496124_0051526 Ga0496124_0051526_670_1224 136
80 3300048928 Ga0496125_0021720 Ga0496125_0021720_2320_2838 136
81 3300048928 Ga0496125_0079697 Ga0496125_0079697_411_926 136
82 3300049587 Ga0501071_0213555 Ga0501071_0213555_767_1324 136
83 3300050507 nmdc:mga05p37_192583_c1 nmdc:mga05p37_192583_c1_283_816 136
84 3300053147 Ga0500589_174940 Ga0500589_174940_170_679 136
85 iso_pu_bacteria 2939660829 2939661425 136
86 3300005336 Ga0070680_100294527 Ga0070680_1002945273 137
87 3300005435 Ga0070714_100792215 Ga0070714_1007922151 137
88 3300005458 Ga0070681_10867453 Ga0070681_108674532 137
89 3300005530 Ga0070679_100262114 Ga0070679_1002621143 137
90 3300005539 Ga0068853_100574288 Ga0068853_1005742882 137
91 3300013105 Ga0157369_10130227 Ga0157369_101302273 137
92 3300013250 Ga0171462_1002 Ga0171462_100246 137
93 3300015684 Ga0183365_11489 Ga0183365_114891 137
94 3300015689 Ga0183360_11206 Ga0183360_112062 137
95 3300020069 Ga0197907_10961421 Ga0197907_109614213 137
96 3300020080 Ga0206350_11586544 Ga0206350_115865442 137
97 3300020081 Ga0206354_10214892 Ga0206354_102148922 137
98 3300020082 Ga0206353_11965733 Ga0206353_119657331 137
99 3300025912 Ga0207707_10376138 Ga0207707_103761382 137
100 3300025914 Ga0207671_10001793 Ga0207671_1000179312 137
101 3300025919 Ga0207657_10602008 Ga0207657_106020081 137
102 3300025920 Ga0207649_10829243 Ga0207649_108292431 137
103 3300025929 Ga0207664_10460971 Ga0207664_104609712 137
104 3300031548 Ga0307408_100243021 Ga0307408_1002430213 137
105 3300031731 Ga0307405_10115789 Ga0307405_101157893 137
106 3300031824 Ga0307413_11559395 Ga0307413_115593952 137
107 3300031852 Ga0307410_10111421 Ga0307410_101114213 137
108 3300032002 Ga0307416_101610744 Ga0307416_1016107442 137
109 3300032004 Ga0307414_11260009 Ga0307414_112600091 137
110 3300032005 Ga0307411_10272066 Ga0307411_102720662 137
111 3300032126 Ga0307415_100473497 Ga0307415_1004734973 137
112 3300037418 Ga0395900_0506823 Ga0395900_0506823_122_607 137
113 3300037471 Ga0395905_0839327 Ga0395905_0839327_264_749 137
114 3300044684 Ga0466966_0378584 Ga0466966_0378584_195_683 137
115 3300044901 Ga0466960_0357034 Ga0466960_0357034_138_620 137
116 3300047320 Ga0495672_0300691 Ga0495672_0300691_72_635 137
117 3300048920 Ga0496117_0049339 Ga0496117_0049339_706_1224 137
118 3300048925 Ga0496122_0190170 Ga0496122_0190170_204_722 137
119 3300048926 Ga0496123_0174241 Ga0496123_0174241_85_603 137
120 3300049127 Ga0501306_020212 Ga0501306_020212_199_690 137
121 3300049161 Ga0501305_019608 Ga0501305_019608_378_869 137
122 3300049161 Ga0501305_047216 Ga0501305_047216_105_623 137
123 3300049529 Ga0501313_019807 Ga0501313_019807_17_508 137
124 3300049533 Ga0501317_010607 Ga0501317_010607_362_853 137
125 3300049534 Ga0501318_007040 Ga0501318_007040_299_790 137
126 3300049534 Ga0501318_011567 Ga0501318_011567_18_536 137
127 3300049539 Ga0501323_005359 Ga0501323_005359_387_878 137
128 3300049540 Ga0501324_016437 Ga0501324_016437_35_526 137
129 3300049661 Ga0501217_293743 Ga0501217_293743_33_521 137
130 iso_pu_bacteria 8003314358 8003318667 137
131 3300006038 Ga0075365_10595517 Ga0075365_105955171 138
132 3300014325 Ga0163163_10058202 Ga0163163_100582024 138
133 3300031901 Ga0307406_10024838 Ga0307406_100248383 138
134 3300037418 Ga0395900_1136070 Ga0395900_1136070_53_499 138
135 3300038443 Ga0395901_0456410 Ga0395901_0456410_793_1269 138
136 3300041453 Ga0451797_1234086 Ga0451797_1234086_277_795 138
137 3300046524 Ga0495648_0048148 Ga0495648_0048148_1030_1635 138
138 3300048904 Ga0496101_0532174 Ga0496101_0532174_349_915 138
139 3300049533 Ga0501317_003008 Ga0501317_003008_691_1206 138
140 3300049578 Ga0501042_0235440 Ga0501042_0235440_595_1143 138
141 3300049584 Ga0501068_0463708 Ga0501068_0463708_78_638 138
142 3300060353 Ga0501082_0225445 Ga0501082_0225445_596_1144 138
143 iso_pu_bacteria 2964326757 2964327900 138
144 3300009101 Ga0105247_10000024 Ga0105247_10000024141 139
145 3300025900 Ga0207710_10000045 Ga0207710_1000004540 139
146 3300044694 Ga0466963_0021561 Ga0466963_0021561_3045_3518 139
147 3300044765 Ga0466970_0436895 Ga0466970_0436895_186_725 139
148 3300048922 Ga0496119_0211688 Ga0496119_0211688_292_795 139
149 3300049161 Ga0501305_040731 Ga0501305_040731_51_572 139
150 3300049534 Ga0501318_022690 Ga0501318_022690_63_584 139
151 3300049583 Ga0501067_0066310 Ga0501067_0066310_686_1240 139
152 3300049586 Ga0501070_0685257 Ga0501070_0685257_83_613 139
153 3300049822 Ga0501035_1224428 Ga0501035_1224428_11_505 139
154 3300059652 Ga0587107_014939 Ga0587107_014939_125_619 139
155 3300005445 Ga0070708_101454638 Ga0070708_1014546381 140
156 3300005563 Ga0068855_100163242 Ga0068855_1001632422 140
157 3300005937 Ga0081455_10097205 Ga0081455_100972052 140
158 3300009545 Ga0105237_10014123 Ga0105237_100141234 140
159 3300010375 Ga0105239_10017001 Ga0105239_100170016 140
160 3300013104 Ga0157370_10289587 Ga0157370_102895872 140
161 3300013307 Ga0157372_10699347 Ga0157372_106993473 140
162 3300025914 Ga0207671_10029794 Ga0207671_100297944 140
163 3300025949 Ga0207667_10067699 Ga0207667_100676991 140
164 3300031824 Ga0307413_10170479 Ga0307413_101704793 140
165 3300032126 Ga0307415_100673705 Ga0307415_1006737052 140
166 3300032126 Ga0307415_101619506 Ga0307415_1016195061 140
167 3300044684 Ga0466966_0090065 Ga0466966_0090065_1097_1585 140
168 3300044694 Ga0466963_0071686 Ga0466963_0071686_530_1018 140
169 3300044735 Ga0466968_0113082 Ga0466968_0113082_279_779 140
170 3300044842 Ga0466957_0206193 Ga0466957_0206193_772_1260 140
171 3300045049 Ga0466959_0362349 Ga0466959_0362349_323_811 140
172 3300045836 Ga0466958_0099883 Ga0466958_0099883_363_851 140
173 3300045976 Ga0466967_0481903 Ga0466967_0481903_681_1169 140
174 3300046507 Ga0495606_0007788 Ga0495606_0007788_7557_8066 140
175 3300046524 Ga0495648_0013828 Ga0495648_0013828_4067_4582 140
176 3300046530 Ga0495654_0038605 Ga0495654_0038605_691_1206 140
177 3300046660 Ga0495625_0466949 Ga0495625_0466949_50_559 140
178 3300047320 Ga0495672_0002575 Ga0495672_0002575_941_1456 140
179 3300047469 Ga0495673_0000444 Ga0495673_0000444_15465_15980 140
180 3300048903 Ga0496100_0002836 Ga0496100_0002836_776_1291 140
181 3300048904 Ga0496101_0000026 Ga0496101_0000026_193223_193738 140
182 3300048905 Ga0496102_0000031 Ga0496102_0000031_213265_213780 140
183 3300048906 Ga0496103_0000025 Ga0496103_0000025_212073_212588 140
184 3300048908 Ga0496105_0371574 Ga0496105_0371574_125_640 140
185 3300048909 Ga0496106_0020434 Ga0496106_0020434_2151_2663 140
186 3300048910 Ga0496107_0301144 Ga0496107_0301144_316_831 140
187 3300048919 Ga0496116_0000084 Ga0496116_0000084_5823_6338 140
188 3300048920 Ga0496117_0000018 Ga0496117_0000018_7819_8334 140
189 3300048921 Ga0496118_0000013 Ga0496118_0000013_471280_471795 140
190 3300048922 Ga0496119_0001033 Ga0496119_0001033_8245_8760 140
191 3300048922 Ga0496119_0096382 Ga0496119_0096382_833_1348 140
192 3300048923 Ga0496120_0000418 Ga0496120_0000418_57111_57626 140
193 3300048924 Ga0496121_0000056 Ga0496121_0000056_193344_193859 140
194 3300048929 Ga0496126_0002664 Ga0496126_0002664_5824_6339 140
195 3300048929 Ga0496126_0229851 Ga0496126_0229851_396_914 140
196 3300049129 Ga0501309_025965 Ga0501309_025965_206_733 140
197 3300049539 Ga0501323_039301 Ga0501323_039301_41_568 140
198 3300053087 Ga0500643_009169 Ga0500643_009169_3152_3673 140
199 3300059492 Ga0587073_0019918 Ga0587073_0019918_76_570 140
200 3300006038 Ga0075365_10037259 Ga0075365_100372593 141
201 3300006048 Ga0075363_100039811 Ga0075363_1000398114 141
202 3300006177 Ga0075362_10079406 Ga0075362_100794062 141
203 3300006178 Ga0075367_10076291 Ga0075367_100762912 141
204 3300006353 Ga0075370_10066386 Ga0075370_100663862 141
205 3300025927 Ga0207687_11219490 Ga0207687_112194901 141
206 3300025938 Ga0207704_10766090 Ga0207704_107660902 141
207 3300032002 Ga0307416_100739760 Ga0307416_1007397601 141
208 3300032004 Ga0307414_10518867 Ga0307414_105188672 141
209 3300036712 Ga0316584_0335227 Ga0316584_0335227_247_756 141
210 3300037466 Ga0395898_0064168 Ga0395898_0064168_3012_3512 141
211 3300044684 Ga0466966_0154170 Ga0466966_0154170_732_1217 141
212 3300044693 Ga0466961_0576963 Ga0466961_0576963_118_606 141
213 3300044706 Ga0466964_0434417 Ga0466964_0434417_78_608 141
214 3300045049 Ga0466959_0129072 Ga0466959_0129072_622_1110 141
215 3300046523 Ga0495644_0245833 Ga0495644_0245833_16_528 141
216 3300048919 Ga0496116_0000509 Ga0496116_0000509_35542_36144 141
217 3300048920 Ga0496117_0004491 Ga0496117_0004491_5125_5727 141
218 3300048921 Ga0496118_0001558 Ga0496118_0001558_7158_7760 141
219 3300048922 Ga0496119_0058231 Ga0496119_0058231_328_930 141
220 3300048923 Ga0496120_0095618 Ga0496120_0095618_755_1357 141
221 3300050492 nmdc:mga0yw44_134912_c1 nmdc:mga0yw44_134912_c1_216_737 141
222 3300050494 nmdc:mga06z11_11576_c1 nmdc:mga06z11_11576_c1_1412_1933 141
223 3300050495 nmdc:mga04h51_31182_c1 nmdc:mga04h51_31182_c1_1123_1644 141
224 3300050496 nmdc:mga07m45_16212_c1 nmdc:mga07m45_16212_c1_803_1324 141
225 3300053153 Ga0500616_0009295 Ga0500616_0009295_4579_5091 141
226 3300061719 Ga0466962_0044694 Ga0466962_0044694_1445_1948 141
227 3300005288 Ga0065714_10021427 Ga0065714_100214273 142
228 3300005288 Ga0065714_10054755 Ga0065714_100547551 142
229 3300005329 Ga0070683_100029247 Ga0070683_1000292475 142
230 3300005455 Ga0070663_100646765 Ga0070663_1006467651 142
231 3300006048 Ga0075363_100309080 Ga0075363_1003090802 142
232 3300006353 Ga0075370_10028113 Ga0075370_100281134 142
233 3300020076 Ga0206355_1038144 Ga0206355_10381443 142
234 3300025944 Ga0207661_10083616 Ga0207661_100836163 142
235 3300031852 Ga0307410_10284288 Ga0307410_102842882 142
236 3300031901 Ga0307406_10403323 Ga0307406_104033232 142
237 3300031903 Ga0307407_10005597 Ga0307407_100055971 142
238 3300031911 Ga0307412_10397261 Ga0307412_103972611 142
239 3300031995 Ga0307409_101189411 Ga0307409_1011894112 142
240 3300032002 Ga0307416_101179946 Ga0307416_1011799462 142
241 3300032002 Ga0307416_101611030 Ga0307416_1016110302 142
242 3300032005 Ga0307411_11046457 Ga0307411_110464572 142
243 3300032126 Ga0307415_101389841 Ga0307415_1013898411 142
244 3300038443 Ga0395901_1013800 Ga0395901_1013800_22_525 142
245 3300041452 Ga0451793_1458892 Ga0451793_1458892_1063_1599 142
246 3300041999 Ga0439433_0054109 Ga0439433_0054109_49_564 142
247 3300044842 Ga0466957_0668787 Ga0466957_0668787_202_699 142
248 3300045976 Ga0466967_0045031 Ga0466967_0045031_2442_2948 142
249 3300047472 Ga0495686_0016616 Ga0495686_0016616_2367_2870 142
250 3300048905 Ga0496102_0023598 Ga0496102_0023598_2681_3241 142
251 3300049585 Ga0501069_0224904 Ga0501069_0224904_410_964 142
252 3300050490 nmdc:mga03n38_103020_c1 nmdc:mga03n38_103020_c1_533_1051 142
253 3300050516 nmdc:mga0sz30_22081_c1 nmdc:mga0sz30_22081_c1_1627_2145 142
254 3300053104 Ga0500556_0000008 Ga0500556_0000008_292941_293444 142
255 3300053139 Ga0500568_0000003 Ga0500568_0000003_11489_11992 142
256 3300053151 Ga0500604_0026727 Ga0500604_0026727_864_1367 142
257 3300005456 Ga0070678_100586472 Ga0070678_1005864722 143
258 3300025934 Ga0207686_10124986 Ga0207686_101249863 143
259 3300026078 Ga0207702_10437195 Ga0207702_104371953 143
260 3300026121 Ga0207683_10120471 Ga0207683_101204713 143
261 3300041413 Ga0439465_0007517 Ga0439465_0007517_2500_3021 143
262 3300046663 Ga0495635_0315581 Ga0495635_0315581_202_681 143
263 3300046809 Ga0495600_0518788 Ga0495600_0518788_219_698 143
264 iso_pu_bacteria 8056207758 8056213892 143
265 3300006186 Ga0075369_10049855 Ga0075369_100498553 144
266 3300045976 Ga0466967_0385519 Ga0466967_0385519_135_662 144
267 3300048905 Ga0496102_0449578 Ga0496102_0449578_213_737 144
268 3300048915 Ga0496112_0443310 Ga0496112_0443310_486_1004 144
269 3300048921 Ga0496118_0125775 Ga0496118_0125775_547_1071 144
270 3300050492 nmdc:mga0yw44_13507_c1 nmdc:mga0yw44_13507_c1_151_666 144
271 3300004799 Ga0058863_11767744 Ga0058863_117677443 145
272 3300004800 Ga0058861_11718171 Ga0058861_117181711 145
273 3300004803 Ga0058862_12317645 Ga0058862_123176451 145
274 3300006048 Ga0075363_100006695 Ga0075363_1000066957 145
275 3300006048 Ga0075363_100077465 Ga0075363_1000774653 145
276 3300006051 Ga0075364_10000313 Ga0075364_1000031327 145
277 3300006177 Ga0075362_10008094 Ga0075362_100080944 145
278 3300006177 Ga0075362_10021215 Ga0075362_100212153 145
279 3300006186 Ga0075369_10064380 Ga0075369_100643802 145
280 3300045976 Ga0466967_0379589 Ga0466967_0379589_425_910 145
281 3300048914 Ga0496111_0636945 Ga0496111_0636945_152_661 145
282 3300049569 Ga0501032_0002608 Ga0501032_0002608_1396_1917 145
283 3300049571 Ga0501034_0016640 Ga0501034_0016640_2060_2581 145
284 3300049573 Ga0501037_0000365 Ga0501037_0000365_847_1368 145
285 3300049574 Ga0501038_0006076 Ga0501038_0006076_631_1152 145
286 3300049575 Ga0501039_0000118 Ga0501039_0000118_35818_36339 145
287 3300049579 Ga0501043_0000931 Ga0501043_0000931_24915_25436 145
288 3300049586 Ga0501070_0000548 Ga0501070_0000548_2194_2715 145
289 3300049589 Ga0501073_0009392 Ga0501073_0009392_2826_3347 145
290 3300049593 Ga0501077_0093930 Ga0501077_0093930_313_834 145
291 3300050490 nmdc:mga03n38_154911_c1 nmdc:mga03n38_154911_c1_464_973 145
292 3300050490 nmdc:mga03n38_4799_c1 nmdc:mga03n38_4799_c1_509_1033 145
293 3300050491 nmdc:mga00v17_38801_c1 nmdc:mga00v17_38801_c1_615_1139 145
294 3300050516 nmdc:mga0sz30_5284_c3 nmdc:mga0sz30_5284_c3_1527_2051 145
295 3300005347 Ga0070668_100016009 Ga0070668_1000160095 146
296 3300025972 Ga0207668_10009746 Ga0207668_100097462 146
297 3300035692 Ga0373935_1169831 Ga0373935_1169831_12_509 146
298 3300044694 Ga0466963_0103053 Ga0466963_0103053_412_897 146
299 3300044842 Ga0466957_0773460 Ga0466957_0773460_166_651 146
300 3300045836 Ga0466958_0071254 Ga0466958_0071254_529_1014 146
301 3300045976 Ga0466967_1681348 Ga0466967_1681348_94_579 146
302 3300046460 Ga0495638_0001483 Ga0495638_0001483_12988_13506 146
303 3300053108 Ga0500562_014754 Ga0500562_014754_1292_1804 146
304 3300053133 Ga0500655_058928 Ga0500655_058928_41_553 146
305 3300053158 Ga0500627_0064033 Ga0500627_0064033_335_862 146
306 3300005356 Ga0070674_100151053 Ga0070674_1001510533 147
307 3300005367 Ga0070667_101029500 Ga0070667_1010295001 147
308 3300005539 Ga0068853_100070238 Ga0068853_1000702383 147
309 3300009177 Ga0105248_10077715 Ga0105248_100777154 147
310 3300025937 Ga0207669_10329687 Ga0207669_103296871 147
311 3300025941 Ga0207711_10141995 Ga0207711_101419953 147
312 3300026041 Ga0207639_10026359 Ga0207639_100263594 147
313 3300046660 Ga0495625_0194668 Ga0495625_0194668_648_1160 147
314 3300047472 Ga0495686_0001889 Ga0495686_0001889_225_740 147
315 3300048903 Ga0496100_0098449 Ga0496100_0098449_574_1089 147
316 3300048904 Ga0496101_0223236 Ga0496101_0223236_670_1182 147
317 3300048907 Ga0496104_0122816 Ga0496104_0122816_528_1043 147
318 3300048908 Ga0496105_0008082 Ga0496105_0008082_1138_1650 147
319 3300048909 Ga0496106_0021910 Ga0496106_0021910_754_1269 147
320 3300048910 Ga0496107_0201986 Ga0496107_0201986_166_681 147
321 3300048911 Ga0496108_0332030 Ga0496108_0332030_230_745 147
322 3300048918 Ga0496115_0009018 Ga0496115_0009018_686_1198 147
323 3300053079 Ga0500610_0010181 Ga0500610_0010181_1163_1684 147
324 3300053153 Ga0500616_0006211 Ga0500616_0006211_6593_7111 147
325 3300053153 Ga0500616_0036377 Ga0500616_0036377_493_1017 147
326 3300003792 Ga0055540_1030061 Ga0055540_10300613 148
327 3300005548 Ga0070665_100892223 Ga0070665_1008922232 148
328 3300006051 Ga0075364_10204582 Ga0075364_102045821 148
329 3300025303 Ga0209051_1000628 Ga0209051_10006289 148
330 3300025303 Ga0209051_1001487 Ga0209051_10014874 148
331 3300026067 Ga0207678_10091379 Ga0207678_100913793 148
332 3300028379 Ga0268266_10462884 Ga0268266_104628842 148
333 3300048911 Ga0496108_0126453 Ga0496108_0126453_17_541 148
334 3300048927 Ga0496124_0326971 Ga0496124_0326971_179_709 148
335 3300050491 nmdc:mga00v17_98144_c1 nmdc:mga00v17_98144_c1_485_1015 148

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00436

SSB

Single-strand binding protein family

5

109

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bhw-assembly2.cif.gz_E b. subtilis ssba 0.9259 7 110
2cwa-assembly1.cif.gz_A crystal structure of the single-stranded dna binding protein from thermus thermophilus hb8 0.9257 7 112
6bhx-assembly1.cif.gz_C b. subtilis ssba with dna 0.9151 7 110
7r4w-assembly1.cif.gz_A single stranded dna binding protein ssb m5 from fervidobacterium gondwanense 0.9143 7 107
1z9f-assembly1.cif.gz_A crystal structure of single stranded dna-binding protein (tm0604) from thermotoga maritima at 2.60 a resolution 0.9104 7 110
ID Description Score Start End Superfamily
1z9fA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9104 7 110 2.40.50.140
5odnH00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8859 1 110 2.40.50.140
2iheA02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8788 7 119 2.40.50.140
af_C4J9S9_72_176_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8723 7 116 2.40.50.140
5odnH00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8689 1 110 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A8B3SQ42-F1-model_v4 Single-stranded DNA-binding protein 0.8822 5 109 GO:0003697
GO:0006260
GO:0009295
AF-A0A849RPJ7-F1-model_v4 Single-stranded DNA-binding protein 0.8791 7 104 GO:0003697
AF-A0A5F1YIA1-F1-model_v4 Single-stranded DNA-binding protein (SSB) 0.8773 6 110 GO:0003697
GO:0006260
GO:0009295
AF-A0A6M3JK56-F1-model_v4 Putative single-stranded DNA-binding protein 0.8744 7 105 GO:0003697
GO:0006260
GO:0009295
AF-A0A7C5BEN0-F1-model_v4 Single-stranded DNA-binding protein 0.8709 7 104 GO:0003697
GO:0006260
GO:0009295

Feature Viewer

pLDDT pTM Quality
79.73 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map