F412072
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 335 | 209 | 330 | 143 |
Family's Representative Sequence
| Representative Sequence | 3300005288|Ga0065714_10021427|Ga0065714_100214273 |
| Length | 169 |
| Sequence | MAGETVITVVGNLTSDPELRYTQNGLAVANFTIASTPRNFDRATSEWKDGEALFLRASVWREFAEHVAGSLTKGSRVIASGRLKQRSYETKEGEKRTSMELEIDEIGPSLRYATASLTRAQSSSAPRGGAPVAQQQGNDEPWAPSAPAANTGGGDVWNTPGNFSDETPF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 2 | 2939660829 | Mycetocola sp. 2940 | Isolate | Rhizosphere |
| 3 | 2964326757 | Planctomonas psychrotolerans J5903 | Isolate | Rhizosphere |
| 4 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 5 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 23 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 25 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 26 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 27 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 28 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 29 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 30 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 31 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 32 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 33 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 34 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 45 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 50 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 51 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 53 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 54 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 55 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 56 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 57 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 81 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 82 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 83 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 84 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 85 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 86 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 87 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 88 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 89 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 90 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 91 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 92 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 93 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 94 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 95 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 96 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 97 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 98 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 99 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 100 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 101 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 102 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 103 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 104 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 105 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 106 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 107 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 108 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 109 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 110 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 111 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 112 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 113 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 114 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 115 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 116 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 117 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 118 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 119 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 120 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 133 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 134 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 135 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 136 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 137 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 138 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 139 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 140 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 141 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 142 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 143 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 144 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 145 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 146 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 147 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 148 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 149 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 150 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 151 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 152 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 153 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 154 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 155 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 156 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 157 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 158 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 159 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 160 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 161 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 162 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 163 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 164 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 165 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 166 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 167 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 168 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 183 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 186 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 187 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 188 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 189 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 190 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 191 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 194 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 195 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 196 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 197 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 198 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 199 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 200 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 201 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 202 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 203 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 204 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 205 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 206 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 208 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 209 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.96 |
| Metatranscriptomes | 9.55 |
| Isolates | 1.49 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.22 |
| Nodule | 0.3 |
| Rhizoplane | 7.76 |
| Rhizosphere | 67.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055540_1030061 | 3300003792 | Bacteria | 1265 |
| 2 | Ga0058863_11767744 | 3300004799 | Bacteria | 1331 |
| 3 | Ga0058861_11718171 | 3300004800 | Bacteria | 917 |
| 4 | Ga0058862_12317645 | 3300004803 | Bacteria | 695 |
| 5 | Ga0065714_10021427 | 3300005288 | Bacteria | 1095 |
| 6 | Ga0065714_10054755 | 3300005288 | Bacteria | 577 |
| 7 | Ga0070683_100029247 | 3300005329 | Bacteria | 4986 |
| 8 | Ga0070680_100294527 | 3300005336 | Bacteria | 1375 |
| 9 | Ga0070668_100016009 | 3300005347 | Bacteria | 5611 |
| 10 | Ga0070674_100151053 | 3300005356 | Bacteria | 1753 |
| 11 | Ga0070667_101029500 | 3300005367 | Bacteria | 769 |
| 12 | Ga0070714_100363560 | 3300005435 | Bacteria | 1361 |
| 13 | Ga0070714_100792215 | 3300005435 | Bacteria | 917 |
| 14 | Ga0070710_10384596 | 3300005437 | Bacteria | 937 |
| 15 | Ga0070708_101454638 | 3300005445 | Bacteria | 639 |
| 16 | Ga0070663_100646765 | 3300005455 | Bacteria | 894 |
| 17 | Ga0070678_100586472 | 3300005456 | Bacteria | 994 |
| 18 | Ga0070681_10867453 | 3300005458 | Bacteria | 821 |
| 19 | Ga0070679_100262114 | 3300005530 | Bacteria | 1683 |
| 20 | Ga0070679_100680310 | 3300005530 | Bacteria | 971 |
| 21 | Ga0070684_100652546 | 3300005535 | Bacteria | 980 |
| 22 | Ga0068853_100070238 | 3300005539 | Bacteria | 3048 |
| 23 | Ga0068853_100574288 | 3300005539 | Bacteria | 1069 |
| 24 | Ga0070665_100892223 | 3300005548 | Bacteria | 902 |
| 25 | Ga0068855_100163242 | 3300005563 | Bacteria | 2527 |
| 26 | Ga0081455_10097205 | 3300005937 | Bacteria | 2373 |
| 27 | Ga0075365_10021198 | 3300006038 | Bacteria | 4049 |
| 28 | Ga0075365_10037259 | 3300006038 | Bacteria | 3156 |
| 29 | Ga0075365_10148448 | 3300006038 | Bacteria | 1630 |
| 30 | Ga0075365_10595517 | 3300006038 | Bacteria | 782 |
| 31 | Ga0075363_100006695 | 3300006048 | Bacteria | 5257 |
| 32 | Ga0075363_100039811 | 3300006048 | Bacteria | 2475 |
| 33 | Ga0075363_100077465 | 3300006048 | Bacteria | 1814 |
| 34 | Ga0075363_100309080 | 3300006048 | Bacteria | 918 |
| 35 | Ga0075364_10000313 | 3300006051 | Bacteria | 23763 |
| 36 | Ga0075364_10204582 | 3300006051 | Bacteria | 1338 |
| 37 | Ga0075364_10447534 | 3300006051 | Bacteria | 882 |
| 38 | Ga0075362_10008094 | 3300006177 | Bacteria | 4008 |
| 39 | Ga0075362_10021215 | 3300006177 | Bacteria | 2723 |
| 40 | Ga0075362_10079406 | 3300006177 | Bacteria | 1510 |
| 41 | Ga0075367_10076291 | 3300006178 | Bacteria | 2022 |
| 42 | Ga0075367_10141968 | 3300006178 | Bacteria | 1488 |
| 43 | Ga0075367_10229756 | 3300006178 | Bacteria | 1162 |
| 44 | Ga0075369_10045602 | 3300006186 | Bacteria | 1885 |
| 45 | Ga0075369_10049855 | 3300006186 | Bacteria | 1809 |
| 46 | Ga0075369_10064380 | 3300006186 | Bacteria | 1605 |
| 47 | Ga0075370_10028113 | 3300006353 | Bacteria | 3124 |
| 48 | Ga0075370_10066386 | 3300006353 | Bacteria | 2058 |
| 49 | Ga0075435_101246876 | 3300007076 | Bacteria | 651 |
| 50 | Ga0105240_10645391 | 3300009093 | Bacteria | 1161 |
| 51 | Ga0105247_10000024 | 3300009101 | Bacteria | 210946 |
| 52 | Ga0114129_10303113 | 3300009147 | Bacteria | 2128 |
| 53 | Ga0105242_10360235 | 3300009176 | Bacteria | 1346 |
| 54 | Ga0105248_10077715 | 3300009177 | Bacteria | 3731 |
| 55 | Ga0105237_10014123 | 3300009545 | Bacteria | 8357 |
| 56 | Ga0105249_10564123 | 3300009553 | Bacteria | 1190 |
| 57 | Ga0105239_10017001 | 3300010375 | Bacteria | 8041 |
| 58 | Ga0157370_10289587 | 3300013104 | Bacteria | 1513 |
| 59 | Ga0157369_10047677 | 3300013105 | Bacteria | 4650 |
| 60 | Ga0157369_10130227 | 3300013105 | Bacteria | 2666 |
| 61 | Ga0171462_1002 | 3300013250 | Bacteria | 1052134 |
| 62 | Ga0157372_10531557 | 3300013307 | Bacteria | 1371 |
| 63 | Ga0157372_10699347 | 3300013307 | Bacteria | 1180 |
| 64 | Ga0157375_10600056 | 3300013308 | Bacteria | 1260 |
| 65 | Ga0163163_10058202 | 3300014325 | Bacteria | 3821 |
| 66 | Ga0157380_10105523 | 3300014326 | Bacteria | 2355 |
| 67 | Ga0183365_11489 | 3300015684 | Bacteria | 849 |
| 68 | Ga0183360_11206 | 3300015689 | Bacteria | 876 |
| 69 | Ga0163161_10084540 | 3300017792 | Bacteria | 2340 |
| 70 | Ga0197907_10961421 | 3300020069 | Bacteria | 1055 |
| 71 | Ga0206355_1038144 | 3300020076 | Bacteria | 2000 |
| 72 | Ga0206350_11586544 | 3300020080 | Bacteria | 634 |
| 73 | Ga0206354_10214892 | 3300020081 | Bacteria | 868 |
| 74 | Ga0206353_11965733 | 3300020082 | Bacteria | 634 |
| 75 | Ga0209051_1000628 | 3300025303 | Bacteria | 40593 |
| 76 | Ga0209051_1001487 | 3300025303 | Bacteria | 19629 |
| 77 | Ga0207655_1012042 | 3300025728 | Bacteria | 5092 |
| 78 | Ga0207710_10000045 | 3300025900 | Bacteria | 210957 |
| 79 | Ga0207707_10376138 | 3300025912 | Bacteria | 1221 |
| 80 | Ga0207671_10001793 | 3300025914 | Bacteria | 24059 |
| 81 | Ga0207671_10029794 | 3300025914 | Bacteria | 4074 |
| 82 | Ga0207663_10443748 | 3300025916 | Bacteria | 1000 |
| 83 | Ga0207657_10602008 | 3300025919 | Bacteria | 857 |
| 84 | Ga0207649_10829243 | 3300025920 | Bacteria | 723 |
| 85 | Ga0207687_11219490 | 3300025927 | Bacteria | 647 |
| 86 | Ga0207664_10334211 | 3300025929 | Bacteria | 1339 |
| 87 | Ga0207664_10460971 | 3300025929 | Bacteria | 1135 |
| 88 | Ga0207686_10124986 | 3300025934 | Bacteria | 1757 |
| 89 | Ga0207709_10024067 | 3300025935 | Bacteria | 3473 |
| 90 | Ga0207669_10329687 | 3300025937 | Bacteria | 1171 |
| 91 | Ga0207704_10766090 | 3300025938 | Bacteria | 804 |
| 92 | Ga0207711_10141995 | 3300025941 | Bacteria | 2161 |
| 93 | Ga0207661_10083616 | 3300025944 | Bacteria | 2642 |
| 94 | Ga0207667_10067699 | 3300025949 | Bacteria | 3719 |
| 95 | Ga0207668_10009746 | 3300025972 | Bacteria | 5768 |
| 96 | Ga0207639_10026359 | 3300026041 | Bacteria | 4225 |
| 97 | Ga0207678_10091379 | 3300026067 | Bacteria | 2602 |
| 98 | Ga0207702_10437195 | 3300026078 | Bacteria | 1267 |
| 99 | Ga0207683_10120471 | 3300026121 | Bacteria | 2355 |
| 100 | Ga0268266_10462884 | 3300028379 | Bacteria | 1207 |
| 101 | Ga0307408_100243021 | 3300031548 | Bacteria | 1480 |
| 102 | Ga0307405_10115789 | 3300031731 | Bacteria | 1824 |
| 103 | Ga0307413_10170479 | 3300031824 | Bacteria | 1540 |
| 104 | Ga0307413_10303332 | 3300031824 | Bacteria | 1212 |
| 105 | Ga0307413_10602830 | 3300031824 | Bacteria | 899 |
| 106 | Ga0307413_11559395 | 3300031824 | Bacteria | 585 |
| 107 | Ga0307410_10111421 | 3300031852 | Bacteria | 1980 |
| 108 | Ga0307410_10284288 | 3300031852 | Bacteria | 1299 |
| 109 | Ga0307406_10001414 | 3300031901 | Bacteria | 13327 |
| 110 | Ga0307406_10010729 | 3300031901 | Bacteria | 5177 |
| 111 | Ga0307406_10024838 | 3300031901 | Bacteria | 3583 |
| 112 | Ga0307406_10403323 | 3300031901 | Bacteria | 1084 |
| 113 | Ga0307407_10005597 | 3300031903 | Bacteria | 5472 |
| 114 | Ga0307407_10314357 | 3300031903 | Bacteria | 1097 |
| 115 | Ga0307412_10397261 | 3300031911 | Bacteria | 1121 |
| 116 | Ga0307412_10706518 | 3300031911 | Bacteria | 866 |
| 117 | Ga0307409_101189411 | 3300031995 | Bacteria | 785 |
| 118 | Ga0307416_100739760 | 3300032002 | Bacteria | 1075 |
| 119 | Ga0307416_101179946 | 3300032002 | Bacteria | 871 |
| 120 | Ga0307416_101610744 | 3300032002 | Bacteria | 754 |
| 121 | Ga0307416_101611030 | 3300032002 | Bacteria | 754 |
| 122 | Ga0307414_10488372 | 3300032004 | Bacteria | 1087 |
| 123 | Ga0307414_10518867 | 3300032004 | Bacteria | 1057 |
| 124 | Ga0307414_11256741 | 3300032004 | Bacteria | 686 |
| 125 | Ga0307414_11260009 | 3300032004 | Bacteria | 685 |
| 126 | Ga0307411_10272066 | 3300032005 | Bacteria | 1344 |
| 127 | Ga0307411_11046457 | 3300032005 | Bacteria | 733 |
| 128 | Ga0307415_100473497 | 3300032126 | Bacteria | 1088 |
| 129 | Ga0307415_100673705 | 3300032126 | Bacteria | 930 |
| 130 | Ga0307415_101015427 | 3300032126 | Bacteria | 772 |
| 131 | Ga0307415_101389841 | 3300032126 | Bacteria | 668 |
| 132 | Ga0307415_101619506 | 3300032126 | Bacteria | 622 |
| 133 | Ga0373935_1169831 | 3300035692 | Bacteria | 573 |
| 134 | Ga0316584_0335227 | 3300036712 | Bacteria | 1088 |
| 135 | Ga0395899_0281452 | 3300037312 | Bacteria | 1131 |
| 136 | Ga0395900_0506823 | 3300037418 | Bacteria | 1156 |
| 137 | Ga0395900_0544392 | 3300037418 | Bacteria | 1106 |
| 138 | Ga0395900_0778781 | 3300037418 | Bacteria | 886 |
| 139 | Ga0395900_1136070 | 3300037418 | Bacteria | 698 |
| 140 | Ga0395898_0018250 | 3300037466 | Bacteria | 7156 |
| 141 | Ga0395898_0064168 | 3300037466 | Bacteria | 3562 |
| 142 | Ga0395905_0225531 | 3300037471 | Bacteria | 1753 |
| 143 | Ga0395905_0839327 | 3300037471 | Bacteria | 822 |
| 144 | Ga0395901_0027819 | 3300038443 | Bacteria | 5814 |
| 145 | Ga0395901_0362134 | 3300038443 | Bacteria | 1495 |
| 146 | Ga0395901_0456410 | 3300038443 | Bacteria | 1306 |
| 147 | Ga0395901_1013800 | 3300038443 | Bacteria | 805 |
| 148 | Ga0436365_1428208 | 3300039437 | Bacteria | 1311 |
| 149 | Ga0439436_0043522 | 3300041404 | Bacteria | 1281 |
| 150 | Ga0439465_0007517 | 3300041413 | Bacteria | 3463 |
| 151 | Ga0451791_1684085 | 3300041451 | Bacteria | 1587 |
| 152 | Ga0451793_1458892 | 3300041452 | Bacteria | 3708 |
| 153 | Ga0451797_1234086 | 3300041453 | Bacteria | 1019 |
| 154 | Ga0451797_1323798 | 3300041453 | Bacteria | 989 |
| 155 | Ga0451847_0641468 | 3300041503 | Bacteria | 927 |
| 156 | Ga0439433_0054109 | 3300041999 | Bacteria | 949 |
| 157 | Ga0466969_0039373 | 3300044656 | Bacteria | 2374 |
| 158 | Ga0466966_0090065 | 3300044684 | Bacteria | 1905 |
| 159 | Ga0466966_0154170 | 3300044684 | Bacteria | 1400 |
| 160 | Ga0466966_0378584 | 3300044684 | Bacteria | 850 |
| 161 | Ga0466961_0008394 | 3300044693 | Bacteria | 6579 |
| 162 | Ga0466961_0576963 | 3300044693 | Bacteria | 677 |
| 163 | Ga0466963_0005006 | 3300044694 | Bacteria | 7738 |
| 164 | Ga0466963_0021561 | 3300044694 | Bacteria | 4067 |
| 165 | Ga0466963_0071686 | 3300044694 | Bacteria | 2332 |
| 166 | Ga0466963_0103053 | 3300044694 | Bacteria | 1955 |
| 167 | Ga0466963_1203350 | 3300044694 | Bacteria | 532 |
| 168 | Ga0466964_0248580 | 3300044706 | Bacteria | 876 |
| 169 | Ga0466964_0383977 | 3300044706 | Bacteria | 730 |
| 170 | Ga0466964_0434417 | 3300044706 | Bacteria | 693 |
| 171 | Ga0466971_0150858 | 3300044719 | Bacteria | 1085 |
| 172 | Ga0466968_0113082 | 3300044735 | Bacteria | 1222 |
| 173 | Ga0466970_0171308 | 3300044765 | Bacteria | 1203 |
| 174 | Ga0466970_0436895 | 3300044765 | Bacteria | 749 |
| 175 | Ga0466957_0151843 | 3300044842 | Bacteria | 1498 |
| 176 | Ga0466957_0206193 | 3300044842 | Bacteria | 1293 |
| 177 | Ga0466957_0668787 | 3300044842 | Bacteria | 731 |
| 178 | Ga0466957_0773460 | 3300044842 | Bacteria | 681 |
| 179 | Ga0466960_0142271 | 3300044901 | Bacteria | 1275 |
| 180 | Ga0466960_0357034 | 3300044901 | Bacteria | 834 |
| 181 | Ga0466959_0129072 | 3300045049 | Bacteria | 1792 |
| 182 | Ga0466959_0177294 | 3300045049 | Bacteria | 1492 |
| 183 | Ga0466959_0362349 | 3300045049 | Bacteria | 988 |
| 184 | Ga0466958_0023375 | 3300045836 | Bacteria | 3628 |
| 185 | Ga0466958_0071254 | 3300045836 | Bacteria | 2128 |
| 186 | Ga0466958_0099883 | 3300045836 | Bacteria | 1803 |
| 187 | Ga0466967_0045031 | 3300045976 | Bacteria | 3832 |
| 188 | Ga0466967_0379589 | 3300045976 | Bacteria | 1372 |
| 189 | Ga0466967_0385519 | 3300045976 | Bacteria | 1361 |
| 190 | Ga0466967_0481903 | 3300045976 | Bacteria | 1215 |
| 191 | Ga0466967_1141301 | 3300045976 | Bacteria | 776 |
| 192 | Ga0466967_1681348 | 3300045976 | Bacteria | 632 |
| 193 | Ga0495638_0001483 | 3300046460 | Bacteria | 21203 |
| 194 | Ga0495650_0337521 | 3300046471 | Bacteria | 500 |
| 195 | Ga0495606_0007788 | 3300046507 | Bacteria | 9479 |
| 196 | Ga0495644_0245833 | 3300046523 | Bacteria | 694 |
| 197 | Ga0495648_0013828 | 3300046524 | Bacteria | 5945 |
| 198 | Ga0495648_0048148 | 3300046524 | Bacteria | 2627 |
| 199 | Ga0495654_0038605 | 3300046530 | Bacteria | 2387 |
| 200 | Ga0495625_0194668 | 3300046660 | Bacteria | 1341 |
| 201 | Ga0495625_0466949 | 3300046660 | Bacteria | 777 |
| 202 | Ga0495635_0315581 | 3300046663 | Bacteria | 1047 |
| 203 | Ga0495600_0518788 | 3300046809 | Bacteria | 731 |
| 204 | Ga0495672_0002575 | 3300047320 | Bacteria | 16485 |
| 205 | Ga0495672_0300691 | 3300047320 | Bacteria | 760 |
| 206 | Ga0495673_0000444 | 3300047469 | Bacteria | 45563 |
| 207 | Ga0495686_0001889 | 3300047472 | Bacteria | 20961 |
| 208 | Ga0495686_0016616 | 3300047472 | Bacteria | 4986 |
| 209 | Ga0496100_0002836 | 3300048903 | Bacteria | 8879 |
| 210 | Ga0496100_0098449 | 3300048903 | Bacteria | 2010 |
| 211 | Ga0496101_0000026 | 3300048904 | Bacteria | 199963 |
| 212 | Ga0496101_0223236 | 3300048904 | Bacteria | 1463 |
| 213 | Ga0496101_0532174 | 3300048904 | Bacteria | 929 |
| 214 | Ga0496102_0000031 | 3300048905 | Bacteria | 217389 |
| 215 | Ga0496102_0023598 | 3300048905 | Bacteria | 5465 |
| 216 | Ga0496102_0449578 | 3300048905 | Bacteria | 1209 |
| 217 | Ga0496103_0000025 | 3300048906 | Bacteria | 221144 |
| 218 | Ga0496104_0122816 | 3300048907 | Bacteria | 2493 |
| 219 | Ga0496105_0008082 | 3300048908 | Bacteria | 8178 |
| 220 | Ga0496105_0371574 | 3300048908 | Bacteria | 1139 |
| 221 | Ga0496105_0598209 | 3300048908 | Bacteria | 856 |
| 222 | Ga0496106_0020434 | 3300048909 | Bacteria | 4914 |
| 223 | Ga0496106_0021910 | 3300048909 | Bacteria | 4747 |
| 224 | Ga0496107_0201986 | 3300048910 | Bacteria | 1477 |
| 225 | Ga0496107_0301144 | 3300048910 | Bacteria | 1193 |
| 226 | Ga0496108_0126453 | 3300048911 | Bacteria | 2195 |
| 227 | Ga0496108_0332030 | 3300048911 | Bacteria | 1326 |
| 228 | Ga0496111_0636945 | 3300048914 | Bacteria | 779 |
| 229 | Ga0496112_0443310 | 3300048915 | Bacteria | 1236 |
| 230 | Ga0496115_0009018 | 3300048918 | Bacteria | 7400 |
| 231 | Ga0496116_0000084 | 3300048919 | Bacteria | 219579 |
| 232 | Ga0496116_0000509 | 3300048919 | Bacteria | 52583 |
| 233 | Ga0496117_0000018 | 3300048920 | Bacteria | 479613 |
| 234 | Ga0496117_0004491 | 3300048920 | Bacteria | 15336 |
| 235 | Ga0496117_0049339 | 3300048920 | Bacteria | 2995 |
| 236 | Ga0496118_0000013 | 3300048921 | Bacteria | 574008 |
| 237 | Ga0496118_0001558 | 3300048921 | Bacteria | 34068 |
| 238 | Ga0496118_0077589 | 3300048921 | Bacteria | 2355 |
| 239 | Ga0496118_0125775 | 3300048921 | Bacteria | 1660 |
| 240 | Ga0496118_0136251 | 3300048921 | Bacteria | 1566 |
| 241 | Ga0496119_0001033 | 3300048922 | Bacteria | 35640 |
| 242 | Ga0496119_0058231 | 3300048922 | Bacteria | 2329 |
| 243 | Ga0496119_0096382 | 3300048922 | Bacteria | 1669 |
| 244 | Ga0496119_0211688 | 3300048922 | Bacteria | 997 |
| 245 | Ga0496119_0349033 | 3300048922 | Bacteria | 717 |
| 246 | Ga0496120_0000418 | 3300048923 | Bacteria | 67915 |
| 247 | Ga0496120_0095618 | 3300048923 | Bacteria | 1579 |
| 248 | Ga0496121_0000056 | 3300048924 | Bacteria | 296250 |
| 249 | Ga0496122_0190170 | 3300048925 | Bacteria | 1213 |
| 250 | Ga0496123_0174241 | 3300048926 | Bacteria | 1131 |
| 251 | Ga0496124_0041534 | 3300048927 | Bacteria | 3968 |
| 252 | Ga0496124_0051526 | 3300048927 | Bacteria | 3502 |
| 253 | Ga0496124_0326971 | 3300048927 | Bacteria | 1095 |
| 254 | Ga0496125_0000230 | 3300048928 | Bacteria | 114490 |
| 255 | Ga0496125_0021720 | 3300048928 | Bacteria | 5975 |
| 256 | Ga0496125_0079697 | 3300048928 | Bacteria | 2511 |
| 257 | Ga0496126_0002664 | 3300048929 | Bacteria | 23643 |
| 258 | Ga0496126_0229851 | 3300048929 | Bacteria | 1554 |
| 259 | Ga0501306_020212 | 3300049127 | Bacteria | 924 |
| 260 | Ga0501309_025965 | 3300049129 | Bacteria | 844 |
| 261 | Ga0501305_019608 | 3300049161 | Bacteria | 988 |
| 262 | Ga0501305_040731 | 3300049161 | Bacteria | 755 |
| 263 | Ga0501305_047216 | 3300049161 | Bacteria | 715 |
| 264 | Ga0501307_039225 | 3300049162 | Bacteria | 683 |
| 265 | Ga0501311_071351 | 3300049527 | Bacteria | 577 |
| 266 | Ga0501313_019807 | 3300049529 | Bacteria | 825 |
| 267 | Ga0501315_012833 | 3300049531 | Bacteria | 1042 |
| 268 | Ga0501316_003150 | 3300049532 | Bacteria | 1583 |
| 269 | Ga0501317_003008 | 3300049533 | Bacteria | 1645 |
| 270 | Ga0501317_004069 | 3300049533 | Bacteria | 1501 |
| 271 | Ga0501317_010607 | 3300049533 | Bacteria | 1104 |
| 272 | Ga0501318_007040 | 3300049534 | Bacteria | 1163 |
| 273 | Ga0501318_008519 | 3300049534 | Bacteria | 1098 |
| 274 | Ga0501318_011567 | 3300049534 | Bacteria | 999 |
| 275 | Ga0501318_022690 | 3300049534 | Bacteria | 806 |
| 276 | Ga0501321_007895 | 3300049537 | Bacteria | 1116 |
| 277 | Ga0501323_005359 | 3300049539 | Bacteria | 1401 |
| 278 | Ga0501323_039301 | 3300049539 | Bacteria | 689 |
| 279 | Ga0501324_016437 | 3300049540 | Bacteria | 726 |
| 280 | Ga0501324_017142 | 3300049540 | Bacteria | 716 |
| 281 | Ga0501032_0002608 | 3300049569 | Bacteria | 14092 |
| 282 | Ga0501034_0016640 | 3300049571 | Bacteria | 7540 |
| 283 | Ga0501037_0000365 | 3300049573 | Bacteria | 37978 |
| 284 | Ga0501038_0006076 | 3300049574 | Bacteria | 11170 |
| 285 | Ga0501039_0000118 | 3300049575 | Bacteria | 54344 |
| 286 | Ga0501042_0235440 | 3300049578 | Bacteria | 1321 |
| 287 | Ga0501043_0000931 | 3300049579 | Bacteria | 25918 |
| 288 | Ga0501067_0066310 | 3300049583 | Bacteria | 1998 |
| 289 | Ga0501068_0463708 | 3300049584 | Bacteria | 820 |
| 290 | Ga0501069_0224904 | 3300049585 | Bacteria | 1091 |
| 291 | Ga0501070_0000548 | 3300049586 | Bacteria | 34385 |
| 292 | Ga0501070_0685257 | 3300049586 | Bacteria | 811 |
| 293 | Ga0501071_0213555 | 3300049587 | Bacteria | 1451 |
| 294 | Ga0501073_0009392 | 3300049589 | Bacteria | 7222 |
| 295 | Ga0501077_0093930 | 3300049593 | Bacteria | 1901 |
| 296 | Ga0501217_293743 | 3300049661 | Bacteria | 535 |
| 297 | Ga0501080_0120118 | 3300049742 | Bacteria | 2436 |
| 298 | Ga0501035_1224428 | 3300049822 | Bacteria | 582 |
| 299 | nmdc:mga03n38_103020_c1 | 3300050490 | Bacteria | 1379 |
| 300 | nmdc:mga03n38_154911_c1 | 3300050490 | Bacteria | 1156 |
| 301 | nmdc:mga03n38_4799_c1 | 3300050490 | Bacteria | 4526 |
| 302 | nmdc:mga00v17_107361_c1 | 3300050491 | Bacteria | 1768 |
| 303 | nmdc:mga00v17_38801_c1 | 3300050491 | Bacteria | 2421 |
| 304 | nmdc:mga00v17_98144_c1 | 3300050491 | Bacteria | 1847 |
| 305 | nmdc:mga0yw44_134912_c1 | 3300050492 | Bacteria | 1601 |
| 306 | nmdc:mga0yw44_13507_c1 | 3300050492 | Bacteria | 4303 |
| 307 | nmdc:mga0yw44_14023_c1 | 3300050492 | Bacteria | 4241 |
| 308 | nmdc:mga06z11_11576_c1 | 3300050494 | Bacteria | 3809 |
| 309 | nmdc:mga04h51_31182_c1 | 3300050495 | Bacteria | 1683 |
| 310 | nmdc:mga07m45_16212_c1 | 3300050496 | Bacteria | 3989 |
| 311 | nmdc:mga05p37_192583_c1 | 3300050507 | Bacteria | 2474 |
| 312 | nmdc:mga0rr50_690441_c1 | 3300050513 | Bacteria | 871 |
| 313 | nmdc:mga0sz30_22081_c1 | 3300050516 | Bacteria | 2580 |
| 314 | nmdc:mga0sz30_5284_c3 | 3300050516 | Bacteria | 3437 |
| 315 | Ga0500610_0010181 | 3300053079 | Bacteria | 4217 |
| 316 | Ga0500643_009169 | 3300053087 | Bacteria | 3804 |
| 317 | Ga0500556_0000008 | 3300053104 | Bacteria | 304943 |
| 318 | Ga0500562_014754 | 3300053108 | Bacteria | 2002 |
| 319 | Ga0500655_058928 | 3300053133 | Bacteria | 772 |
| 320 | Ga0500568_0000003 | 3300053139 | Bacteria | 863587 |
| 321 | Ga0500589_174940 | 3300053147 | Bacteria | 849 |
| 322 | Ga0500604_0026727 | 3300053151 | Bacteria | 1666 |
| 323 | Ga0500616_0006211 | 3300053153 | Bacteria | 7882 |
| 324 | Ga0500616_0009295 | 3300053153 | Bacteria | 5988 |
| 325 | Ga0500616_0036377 | 3300053153 | Bacteria | 2672 |
| 326 | Ga0500627_0064033 | 3300053158 | Bacteria | 1621 |
| 327 | Ga0587073_0019918 | 3300059492 | Bacteria | 1273 |
| 328 | Ga0587107_014939 | 3300059652 | Bacteria | 1006 |
| 329 | Ga0501082_0225445 | 3300060353 | Bacteria | 1631 |
| 330 | Ga0466962_0044694 | 3300061719 | Bacteria | 2119 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041503 | Ga0451847_0641468 | Ga0451847_0641468_333_743 | 114 |
| 2 | 3300046471 | Ga0495650_0337521 | Ga0495650_0337521_79_489 | 115 |
| 3 | 3300005437 | Ga0070710_10384596 | Ga0070710_103845961 | 127 |
| 4 | 3300041451 | Ga0451791_1684085 | Ga0451791_1684085_895_1404 | 129 |
| 5 | 3300005435 | Ga0070714_100363560 | Ga0070714_1003635601 | 131 |
| 6 | 3300025929 | Ga0207664_10334211 | Ga0207664_103342113 | 131 |
| 7 | 3300044693 | Ga0466961_0008394 | Ga0466961_0008394_5335_5823 | 131 |
| 8 | 3300044694 | Ga0466963_1203350 | Ga0466963_1203350_13_501 | 131 |
| 9 | 3300044706 | Ga0466964_0383977 | Ga0466964_0383977_222_710 | 131 |
| 10 | 3300044719 | Ga0466971_0150858 | Ga0466971_0150858_353_841 | 131 |
| 11 | 3300044765 | Ga0466970_0171308 | Ga0466970_0171308_478_966 | 131 |
| 12 | 3300044842 | Ga0466957_0151843 | Ga0466957_0151843_457_945 | 131 |
| 13 | 3300044901 | Ga0466960_0142271 | Ga0466960_0142271_513_998 | 131 |
| 14 | 3300045049 | Ga0466959_0177294 | Ga0466959_0177294_424_912 | 131 |
| 15 | 3300045836 | Ga0466958_0023375 | Ga0466958_0023375_641_1129 | 131 |
| 16 | 3300049162 | Ga0501307_039225 | Ga0501307_039225_39_566 | 131 |
| 17 | 3300049527 | Ga0501311_071351 | Ga0501311_071351_11_538 | 131 |
| 18 | 3300049532 | Ga0501316_003150 | Ga0501316_003150_537_1064 | 131 |
| 19 | 3300049537 | Ga0501321_007895 | Ga0501321_007895_188_715 | 131 |
| 20 | 3300025728 | Ga0207655_1012042 | Ga0207655_10120424 | 132 |
| 21 | 3300031824 | Ga0307413_10602830 | Ga0307413_106028301 | 132 |
| 22 | 3300031901 | Ga0307406_10010729 | Ga0307406_100107297 | 132 |
| 23 | 3300032126 | Ga0307415_101015427 | Ga0307415_1010154271 | 132 |
| 24 | 3300041404 | Ga0439436_0043522 | Ga0439436_0043522_334_834 | 132 |
| 25 | 3300049531 | Ga0501315_012833 | Ga0501315_012833_10_537 | 132 |
| 26 | 3300049533 | Ga0501317_004069 | Ga0501317_004069_531_1049 | 132 |
| 27 | 3300006038 | Ga0075365_10021198 | Ga0075365_100211985 | 133 |
| 28 | 3300006051 | Ga0075364_10447534 | Ga0075364_104475342 | 133 |
| 29 | 3300006178 | Ga0075367_10141968 | Ga0075367_101419682 | 133 |
| 30 | 3300006186 | Ga0075369_10045602 | Ga0075369_100456022 | 133 |
| 31 | 3300025935 | Ga0207709_10024067 | Ga0207709_100240678 | 133 |
| 32 | 3300050491 | nmdc:mga00v17_107361_c1 | nmdc:mga00v17_107361_c1_1103_1627 | 133 |
| 33 | 3300050492 | nmdc:mga0yw44_14023_c1 | nmdc:mga0yw44_14023_c1_1377_1901 | 133 |
| 34 | 3300007076 | Ga0075435_101246876 | Ga0075435_1012468761 | 134 |
| 35 | 3300009093 | Ga0105240_10645391 | Ga0105240_106453912 | 134 |
| 36 | 3300037312 | Ga0395899_0281452 | Ga0395899_0281452_151_690 | 134 |
| 37 | 3300037418 | Ga0395900_0778781 | Ga0395900_0778781_337_876 | 134 |
| 38 | 3300037466 | Ga0395898_0018250 | Ga0395898_0018250_1749_2288 | 134 |
| 39 | 3300037471 | Ga0395905_0225531 | Ga0395905_0225531_982_1521 | 134 |
| 40 | 3300048908 | Ga0496105_0598209 | Ga0496105_0598209_184_663 | 134 |
| 41 | 3300049742 | Ga0501080_0120118 | Ga0501080_0120118_1014_1595 | 134 |
| 42 | 3300050513 | nmdc:mga0rr50_690441_c1 | nmdc:mga0rr50_690441_c1_373_852 | 134 |
| 43 | 3300005530 | Ga0070679_100680310 | Ga0070679_1006803101 | 135 |
| 44 | 3300005535 | Ga0070684_100652546 | Ga0070684_1006525462 | 135 |
| 45 | 3300009176 | Ga0105242_10360235 | Ga0105242_103602353 | 135 |
| 46 | 3300009553 | Ga0105249_10564123 | Ga0105249_105641231 | 135 |
| 47 | 3300013105 | Ga0157369_10047677 | Ga0157369_100476775 | 135 |
| 48 | 3300013307 | Ga0157372_10531557 | Ga0157372_105315572 | 135 |
| 49 | 3300013308 | Ga0157375_10600056 | Ga0157375_106000562 | 135 |
| 50 | 3300014326 | Ga0157380_10105523 | Ga0157380_101055233 | 135 |
| 51 | 3300017792 | Ga0163161_10084540 | Ga0163161_100845403 | 135 |
| 52 | 3300031824 | Ga0307413_10303332 | Ga0307413_103033322 | 135 |
| 53 | 3300031901 | Ga0307406_10001414 | Ga0307406_100014143 | 135 |
| 54 | 3300031903 | Ga0307407_10314357 | Ga0307407_103143573 | 135 |
| 55 | 3300031911 | Ga0307412_10706518 | Ga0307412_107065182 | 135 |
| 56 | 3300032004 | Ga0307414_10488372 | Ga0307414_104883722 | 135 |
| 57 | 3300037418 | Ga0395900_0544392 | Ga0395900_0544392_18_524 | 135 |
| 58 | 3300038443 | Ga0395901_0362134 | Ga0395901_0362134_55_546 | 135 |
| 59 | 3300041453 | Ga0451797_1323798 | Ga0451797_1323798_27_548 | 135 |
| 60 | 3300044656 | Ga0466969_0039373 | Ga0466969_0039373_1103_1582 | 135 |
| 61 | 3300044694 | Ga0466963_0005006 | Ga0466963_0005006_3073_3561 | 135 |
| 62 | 3300048921 | Ga0496118_0077589 | Ga0496118_0077589_1020_1541 | 135 |
| 63 | 3300048922 | Ga0496119_0349033 | Ga0496119_0349033_137_658 | 135 |
| 64 | 3300048928 | Ga0496125_0000230 | Ga0496125_0000230_68091_68585 | 135 |
| 65 | 3300049534 | Ga0501318_008519 | Ga0501318_008519_371_850 | 135 |
| 66 | 3300049540 | Ga0501324_017142 | Ga0501324_017142_184_675 | 135 |
| 67 | iso_pu_bacteria | 2517572101 | 2517761650 | 135 |
| 68 | 3300006038 | Ga0075365_10148448 | Ga0075365_101484482 | 136 |
| 69 | 3300006178 | Ga0075367_10229756 | Ga0075367_102297561 | 136 |
| 70 | 3300009147 | Ga0114129_10303113 | Ga0114129_103031132 | 136 |
| 71 | 3300025916 | Ga0207663_10443748 | Ga0207663_104437481 | 136 |
| 72 | 3300032004 | Ga0307414_11256741 | Ga0307414_112567411 | 136 |
| 73 | 3300038443 | Ga0395901_0027819 | Ga0395901_0027819_5197_5682 | 136 |
| 74 | 3300039437 | Ga0436365_1428208 | Ga0436365_1428208_553_1041 | 136 |
| 75 | 3300044706 | Ga0466964_0248580 | Ga0466964_0248580_226_726 | 136 |
| 76 | 3300045976 | Ga0466967_1141301 | Ga0466967_1141301_38_538 | 136 |
| 77 | 3300048921 | Ga0496118_0136251 | Ga0496118_0136251_940_1458 | 136 |
| 78 | 3300048927 | Ga0496124_0041534 | Ga0496124_0041534_2756_3274 | 136 |
| 79 | 3300048927 | Ga0496124_0051526 | Ga0496124_0051526_670_1224 | 136 |
| 80 | 3300048928 | Ga0496125_0021720 | Ga0496125_0021720_2320_2838 | 136 |
| 81 | 3300048928 | Ga0496125_0079697 | Ga0496125_0079697_411_926 | 136 |
| 82 | 3300049587 | Ga0501071_0213555 | Ga0501071_0213555_767_1324 | 136 |
| 83 | 3300050507 | nmdc:mga05p37_192583_c1 | nmdc:mga05p37_192583_c1_283_816 | 136 |
| 84 | 3300053147 | Ga0500589_174940 | Ga0500589_174940_170_679 | 136 |
| 85 | iso_pu_bacteria | 2939660829 | 2939661425 | 136 |
| 86 | 3300005336 | Ga0070680_100294527 | Ga0070680_1002945273 | 137 |
| 87 | 3300005435 | Ga0070714_100792215 | Ga0070714_1007922151 | 137 |
| 88 | 3300005458 | Ga0070681_10867453 | Ga0070681_108674532 | 137 |
| 89 | 3300005530 | Ga0070679_100262114 | Ga0070679_1002621143 | 137 |
| 90 | 3300005539 | Ga0068853_100574288 | Ga0068853_1005742882 | 137 |
| 91 | 3300013105 | Ga0157369_10130227 | Ga0157369_101302273 | 137 |
| 92 | 3300013250 | Ga0171462_1002 | Ga0171462_100246 | 137 |
| 93 | 3300015684 | Ga0183365_11489 | Ga0183365_114891 | 137 |
| 94 | 3300015689 | Ga0183360_11206 | Ga0183360_112062 | 137 |
| 95 | 3300020069 | Ga0197907_10961421 | Ga0197907_109614213 | 137 |
| 96 | 3300020080 | Ga0206350_11586544 | Ga0206350_115865442 | 137 |
| 97 | 3300020081 | Ga0206354_10214892 | Ga0206354_102148922 | 137 |
| 98 | 3300020082 | Ga0206353_11965733 | Ga0206353_119657331 | 137 |
| 99 | 3300025912 | Ga0207707_10376138 | Ga0207707_103761382 | 137 |
| 100 | 3300025914 | Ga0207671_10001793 | Ga0207671_1000179312 | 137 |
| 101 | 3300025919 | Ga0207657_10602008 | Ga0207657_106020081 | 137 |
| 102 | 3300025920 | Ga0207649_10829243 | Ga0207649_108292431 | 137 |
| 103 | 3300025929 | Ga0207664_10460971 | Ga0207664_104609712 | 137 |
| 104 | 3300031548 | Ga0307408_100243021 | Ga0307408_1002430213 | 137 |
| 105 | 3300031731 | Ga0307405_10115789 | Ga0307405_101157893 | 137 |
| 106 | 3300031824 | Ga0307413_11559395 | Ga0307413_115593952 | 137 |
| 107 | 3300031852 | Ga0307410_10111421 | Ga0307410_101114213 | 137 |
| 108 | 3300032002 | Ga0307416_101610744 | Ga0307416_1016107442 | 137 |
| 109 | 3300032004 | Ga0307414_11260009 | Ga0307414_112600091 | 137 |
| 110 | 3300032005 | Ga0307411_10272066 | Ga0307411_102720662 | 137 |
| 111 | 3300032126 | Ga0307415_100473497 | Ga0307415_1004734973 | 137 |
| 112 | 3300037418 | Ga0395900_0506823 | Ga0395900_0506823_122_607 | 137 |
| 113 | 3300037471 | Ga0395905_0839327 | Ga0395905_0839327_264_749 | 137 |
| 114 | 3300044684 | Ga0466966_0378584 | Ga0466966_0378584_195_683 | 137 |
| 115 | 3300044901 | Ga0466960_0357034 | Ga0466960_0357034_138_620 | 137 |
| 116 | 3300047320 | Ga0495672_0300691 | Ga0495672_0300691_72_635 | 137 |
| 117 | 3300048920 | Ga0496117_0049339 | Ga0496117_0049339_706_1224 | 137 |
| 118 | 3300048925 | Ga0496122_0190170 | Ga0496122_0190170_204_722 | 137 |
| 119 | 3300048926 | Ga0496123_0174241 | Ga0496123_0174241_85_603 | 137 |
| 120 | 3300049127 | Ga0501306_020212 | Ga0501306_020212_199_690 | 137 |
| 121 | 3300049161 | Ga0501305_019608 | Ga0501305_019608_378_869 | 137 |
| 122 | 3300049161 | Ga0501305_047216 | Ga0501305_047216_105_623 | 137 |
| 123 | 3300049529 | Ga0501313_019807 | Ga0501313_019807_17_508 | 137 |
| 124 | 3300049533 | Ga0501317_010607 | Ga0501317_010607_362_853 | 137 |
| 125 | 3300049534 | Ga0501318_007040 | Ga0501318_007040_299_790 | 137 |
| 126 | 3300049534 | Ga0501318_011567 | Ga0501318_011567_18_536 | 137 |
| 127 | 3300049539 | Ga0501323_005359 | Ga0501323_005359_387_878 | 137 |
| 128 | 3300049540 | Ga0501324_016437 | Ga0501324_016437_35_526 | 137 |
| 129 | 3300049661 | Ga0501217_293743 | Ga0501217_293743_33_521 | 137 |
| 130 | iso_pu_bacteria | 8003314358 | 8003318667 | 137 |
| 131 | 3300006038 | Ga0075365_10595517 | Ga0075365_105955171 | 138 |
| 132 | 3300014325 | Ga0163163_10058202 | Ga0163163_100582024 | 138 |
| 133 | 3300031901 | Ga0307406_10024838 | Ga0307406_100248383 | 138 |
| 134 | 3300037418 | Ga0395900_1136070 | Ga0395900_1136070_53_499 | 138 |
| 135 | 3300038443 | Ga0395901_0456410 | Ga0395901_0456410_793_1269 | 138 |
| 136 | 3300041453 | Ga0451797_1234086 | Ga0451797_1234086_277_795 | 138 |
| 137 | 3300046524 | Ga0495648_0048148 | Ga0495648_0048148_1030_1635 | 138 |
| 138 | 3300048904 | Ga0496101_0532174 | Ga0496101_0532174_349_915 | 138 |
| 139 | 3300049533 | Ga0501317_003008 | Ga0501317_003008_691_1206 | 138 |
| 140 | 3300049578 | Ga0501042_0235440 | Ga0501042_0235440_595_1143 | 138 |
| 141 | 3300049584 | Ga0501068_0463708 | Ga0501068_0463708_78_638 | 138 |
| 142 | 3300060353 | Ga0501082_0225445 | Ga0501082_0225445_596_1144 | 138 |
| 143 | iso_pu_bacteria | 2964326757 | 2964327900 | 138 |
| 144 | 3300009101 | Ga0105247_10000024 | Ga0105247_10000024141 | 139 |
| 145 | 3300025900 | Ga0207710_10000045 | Ga0207710_1000004540 | 139 |
| 146 | 3300044694 | Ga0466963_0021561 | Ga0466963_0021561_3045_3518 | 139 |
| 147 | 3300044765 | Ga0466970_0436895 | Ga0466970_0436895_186_725 | 139 |
| 148 | 3300048922 | Ga0496119_0211688 | Ga0496119_0211688_292_795 | 139 |
| 149 | 3300049161 | Ga0501305_040731 | Ga0501305_040731_51_572 | 139 |
| 150 | 3300049534 | Ga0501318_022690 | Ga0501318_022690_63_584 | 139 |
| 151 | 3300049583 | Ga0501067_0066310 | Ga0501067_0066310_686_1240 | 139 |
| 152 | 3300049586 | Ga0501070_0685257 | Ga0501070_0685257_83_613 | 139 |
| 153 | 3300049822 | Ga0501035_1224428 | Ga0501035_1224428_11_505 | 139 |
| 154 | 3300059652 | Ga0587107_014939 | Ga0587107_014939_125_619 | 139 |
| 155 | 3300005445 | Ga0070708_101454638 | Ga0070708_1014546381 | 140 |
| 156 | 3300005563 | Ga0068855_100163242 | Ga0068855_1001632422 | 140 |
| 157 | 3300005937 | Ga0081455_10097205 | Ga0081455_100972052 | 140 |
| 158 | 3300009545 | Ga0105237_10014123 | Ga0105237_100141234 | 140 |
| 159 | 3300010375 | Ga0105239_10017001 | Ga0105239_100170016 | 140 |
| 160 | 3300013104 | Ga0157370_10289587 | Ga0157370_102895872 | 140 |
| 161 | 3300013307 | Ga0157372_10699347 | Ga0157372_106993473 | 140 |
| 162 | 3300025914 | Ga0207671_10029794 | Ga0207671_100297944 | 140 |
| 163 | 3300025949 | Ga0207667_10067699 | Ga0207667_100676991 | 140 |
| 164 | 3300031824 | Ga0307413_10170479 | Ga0307413_101704793 | 140 |
| 165 | 3300032126 | Ga0307415_100673705 | Ga0307415_1006737052 | 140 |
| 166 | 3300032126 | Ga0307415_101619506 | Ga0307415_1016195061 | 140 |
| 167 | 3300044684 | Ga0466966_0090065 | Ga0466966_0090065_1097_1585 | 140 |
| 168 | 3300044694 | Ga0466963_0071686 | Ga0466963_0071686_530_1018 | 140 |
| 169 | 3300044735 | Ga0466968_0113082 | Ga0466968_0113082_279_779 | 140 |
| 170 | 3300044842 | Ga0466957_0206193 | Ga0466957_0206193_772_1260 | 140 |
| 171 | 3300045049 | Ga0466959_0362349 | Ga0466959_0362349_323_811 | 140 |
| 172 | 3300045836 | Ga0466958_0099883 | Ga0466958_0099883_363_851 | 140 |
| 173 | 3300045976 | Ga0466967_0481903 | Ga0466967_0481903_681_1169 | 140 |
| 174 | 3300046507 | Ga0495606_0007788 | Ga0495606_0007788_7557_8066 | 140 |
| 175 | 3300046524 | Ga0495648_0013828 | Ga0495648_0013828_4067_4582 | 140 |
| 176 | 3300046530 | Ga0495654_0038605 | Ga0495654_0038605_691_1206 | 140 |
| 177 | 3300046660 | Ga0495625_0466949 | Ga0495625_0466949_50_559 | 140 |
| 178 | 3300047320 | Ga0495672_0002575 | Ga0495672_0002575_941_1456 | 140 |
| 179 | 3300047469 | Ga0495673_0000444 | Ga0495673_0000444_15465_15980 | 140 |
| 180 | 3300048903 | Ga0496100_0002836 | Ga0496100_0002836_776_1291 | 140 |
| 181 | 3300048904 | Ga0496101_0000026 | Ga0496101_0000026_193223_193738 | 140 |
| 182 | 3300048905 | Ga0496102_0000031 | Ga0496102_0000031_213265_213780 | 140 |
| 183 | 3300048906 | Ga0496103_0000025 | Ga0496103_0000025_212073_212588 | 140 |
| 184 | 3300048908 | Ga0496105_0371574 | Ga0496105_0371574_125_640 | 140 |
| 185 | 3300048909 | Ga0496106_0020434 | Ga0496106_0020434_2151_2663 | 140 |
| 186 | 3300048910 | Ga0496107_0301144 | Ga0496107_0301144_316_831 | 140 |
| 187 | 3300048919 | Ga0496116_0000084 | Ga0496116_0000084_5823_6338 | 140 |
| 188 | 3300048920 | Ga0496117_0000018 | Ga0496117_0000018_7819_8334 | 140 |
| 189 | 3300048921 | Ga0496118_0000013 | Ga0496118_0000013_471280_471795 | 140 |
| 190 | 3300048922 | Ga0496119_0001033 | Ga0496119_0001033_8245_8760 | 140 |
| 191 | 3300048922 | Ga0496119_0096382 | Ga0496119_0096382_833_1348 | 140 |
| 192 | 3300048923 | Ga0496120_0000418 | Ga0496120_0000418_57111_57626 | 140 |
| 193 | 3300048924 | Ga0496121_0000056 | Ga0496121_0000056_193344_193859 | 140 |
| 194 | 3300048929 | Ga0496126_0002664 | Ga0496126_0002664_5824_6339 | 140 |
| 195 | 3300048929 | Ga0496126_0229851 | Ga0496126_0229851_396_914 | 140 |
| 196 | 3300049129 | Ga0501309_025965 | Ga0501309_025965_206_733 | 140 |
| 197 | 3300049539 | Ga0501323_039301 | Ga0501323_039301_41_568 | 140 |
| 198 | 3300053087 | Ga0500643_009169 | Ga0500643_009169_3152_3673 | 140 |
| 199 | 3300059492 | Ga0587073_0019918 | Ga0587073_0019918_76_570 | 140 |
| 200 | 3300006038 | Ga0075365_10037259 | Ga0075365_100372593 | 141 |
| 201 | 3300006048 | Ga0075363_100039811 | Ga0075363_1000398114 | 141 |
| 202 | 3300006177 | Ga0075362_10079406 | Ga0075362_100794062 | 141 |
| 203 | 3300006178 | Ga0075367_10076291 | Ga0075367_100762912 | 141 |
| 204 | 3300006353 | Ga0075370_10066386 | Ga0075370_100663862 | 141 |
| 205 | 3300025927 | Ga0207687_11219490 | Ga0207687_112194901 | 141 |
| 206 | 3300025938 | Ga0207704_10766090 | Ga0207704_107660902 | 141 |
| 207 | 3300032002 | Ga0307416_100739760 | Ga0307416_1007397601 | 141 |
| 208 | 3300032004 | Ga0307414_10518867 | Ga0307414_105188672 | 141 |
| 209 | 3300036712 | Ga0316584_0335227 | Ga0316584_0335227_247_756 | 141 |
| 210 | 3300037466 | Ga0395898_0064168 | Ga0395898_0064168_3012_3512 | 141 |
| 211 | 3300044684 | Ga0466966_0154170 | Ga0466966_0154170_732_1217 | 141 |
| 212 | 3300044693 | Ga0466961_0576963 | Ga0466961_0576963_118_606 | 141 |
| 213 | 3300044706 | Ga0466964_0434417 | Ga0466964_0434417_78_608 | 141 |
| 214 | 3300045049 | Ga0466959_0129072 | Ga0466959_0129072_622_1110 | 141 |
| 215 | 3300046523 | Ga0495644_0245833 | Ga0495644_0245833_16_528 | 141 |
| 216 | 3300048919 | Ga0496116_0000509 | Ga0496116_0000509_35542_36144 | 141 |
| 217 | 3300048920 | Ga0496117_0004491 | Ga0496117_0004491_5125_5727 | 141 |
| 218 | 3300048921 | Ga0496118_0001558 | Ga0496118_0001558_7158_7760 | 141 |
| 219 | 3300048922 | Ga0496119_0058231 | Ga0496119_0058231_328_930 | 141 |
| 220 | 3300048923 | Ga0496120_0095618 | Ga0496120_0095618_755_1357 | 141 |
| 221 | 3300050492 | nmdc:mga0yw44_134912_c1 | nmdc:mga0yw44_134912_c1_216_737 | 141 |
| 222 | 3300050494 | nmdc:mga06z11_11576_c1 | nmdc:mga06z11_11576_c1_1412_1933 | 141 |
| 223 | 3300050495 | nmdc:mga04h51_31182_c1 | nmdc:mga04h51_31182_c1_1123_1644 | 141 |
| 224 | 3300050496 | nmdc:mga07m45_16212_c1 | nmdc:mga07m45_16212_c1_803_1324 | 141 |
| 225 | 3300053153 | Ga0500616_0009295 | Ga0500616_0009295_4579_5091 | 141 |
| 226 | 3300061719 | Ga0466962_0044694 | Ga0466962_0044694_1445_1948 | 141 |
| 227 | 3300005288 | Ga0065714_10021427 | Ga0065714_100214273 | 142 |
| 228 | 3300005288 | Ga0065714_10054755 | Ga0065714_100547551 | 142 |
| 229 | 3300005329 | Ga0070683_100029247 | Ga0070683_1000292475 | 142 |
| 230 | 3300005455 | Ga0070663_100646765 | Ga0070663_1006467651 | 142 |
| 231 | 3300006048 | Ga0075363_100309080 | Ga0075363_1003090802 | 142 |
| 232 | 3300006353 | Ga0075370_10028113 | Ga0075370_100281134 | 142 |
| 233 | 3300020076 | Ga0206355_1038144 | Ga0206355_10381443 | 142 |
| 234 | 3300025944 | Ga0207661_10083616 | Ga0207661_100836163 | 142 |
| 235 | 3300031852 | Ga0307410_10284288 | Ga0307410_102842882 | 142 |
| 236 | 3300031901 | Ga0307406_10403323 | Ga0307406_104033232 | 142 |
| 237 | 3300031903 | Ga0307407_10005597 | Ga0307407_100055971 | 142 |
| 238 | 3300031911 | Ga0307412_10397261 | Ga0307412_103972611 | 142 |
| 239 | 3300031995 | Ga0307409_101189411 | Ga0307409_1011894112 | 142 |
| 240 | 3300032002 | Ga0307416_101179946 | Ga0307416_1011799462 | 142 |
| 241 | 3300032002 | Ga0307416_101611030 | Ga0307416_1016110302 | 142 |
| 242 | 3300032005 | Ga0307411_11046457 | Ga0307411_110464572 | 142 |
| 243 | 3300032126 | Ga0307415_101389841 | Ga0307415_1013898411 | 142 |
| 244 | 3300038443 | Ga0395901_1013800 | Ga0395901_1013800_22_525 | 142 |
| 245 | 3300041452 | Ga0451793_1458892 | Ga0451793_1458892_1063_1599 | 142 |
| 246 | 3300041999 | Ga0439433_0054109 | Ga0439433_0054109_49_564 | 142 |
| 247 | 3300044842 | Ga0466957_0668787 | Ga0466957_0668787_202_699 | 142 |
| 248 | 3300045976 | Ga0466967_0045031 | Ga0466967_0045031_2442_2948 | 142 |
| 249 | 3300047472 | Ga0495686_0016616 | Ga0495686_0016616_2367_2870 | 142 |
| 250 | 3300048905 | Ga0496102_0023598 | Ga0496102_0023598_2681_3241 | 142 |
| 251 | 3300049585 | Ga0501069_0224904 | Ga0501069_0224904_410_964 | 142 |
| 252 | 3300050490 | nmdc:mga03n38_103020_c1 | nmdc:mga03n38_103020_c1_533_1051 | 142 |
| 253 | 3300050516 | nmdc:mga0sz30_22081_c1 | nmdc:mga0sz30_22081_c1_1627_2145 | 142 |
| 254 | 3300053104 | Ga0500556_0000008 | Ga0500556_0000008_292941_293444 | 142 |
| 255 | 3300053139 | Ga0500568_0000003 | Ga0500568_0000003_11489_11992 | 142 |
| 256 | 3300053151 | Ga0500604_0026727 | Ga0500604_0026727_864_1367 | 142 |
| 257 | 3300005456 | Ga0070678_100586472 | Ga0070678_1005864722 | 143 |
| 258 | 3300025934 | Ga0207686_10124986 | Ga0207686_101249863 | 143 |
| 259 | 3300026078 | Ga0207702_10437195 | Ga0207702_104371953 | 143 |
| 260 | 3300026121 | Ga0207683_10120471 | Ga0207683_101204713 | 143 |
| 261 | 3300041413 | Ga0439465_0007517 | Ga0439465_0007517_2500_3021 | 143 |
| 262 | 3300046663 | Ga0495635_0315581 | Ga0495635_0315581_202_681 | 143 |
| 263 | 3300046809 | Ga0495600_0518788 | Ga0495600_0518788_219_698 | 143 |
| 264 | iso_pu_bacteria | 8056207758 | 8056213892 | 143 |
| 265 | 3300006186 | Ga0075369_10049855 | Ga0075369_100498553 | 144 |
| 266 | 3300045976 | Ga0466967_0385519 | Ga0466967_0385519_135_662 | 144 |
| 267 | 3300048905 | Ga0496102_0449578 | Ga0496102_0449578_213_737 | 144 |
| 268 | 3300048915 | Ga0496112_0443310 | Ga0496112_0443310_486_1004 | 144 |
| 269 | 3300048921 | Ga0496118_0125775 | Ga0496118_0125775_547_1071 | 144 |
| 270 | 3300050492 | nmdc:mga0yw44_13507_c1 | nmdc:mga0yw44_13507_c1_151_666 | 144 |
| 271 | 3300004799 | Ga0058863_11767744 | Ga0058863_117677443 | 145 |
| 272 | 3300004800 | Ga0058861_11718171 | Ga0058861_117181711 | 145 |
| 273 | 3300004803 | Ga0058862_12317645 | Ga0058862_123176451 | 145 |
| 274 | 3300006048 | Ga0075363_100006695 | Ga0075363_1000066957 | 145 |
| 275 | 3300006048 | Ga0075363_100077465 | Ga0075363_1000774653 | 145 |
| 276 | 3300006051 | Ga0075364_10000313 | Ga0075364_1000031327 | 145 |
| 277 | 3300006177 | Ga0075362_10008094 | Ga0075362_100080944 | 145 |
| 278 | 3300006177 | Ga0075362_10021215 | Ga0075362_100212153 | 145 |
| 279 | 3300006186 | Ga0075369_10064380 | Ga0075369_100643802 | 145 |
| 280 | 3300045976 | Ga0466967_0379589 | Ga0466967_0379589_425_910 | 145 |
| 281 | 3300048914 | Ga0496111_0636945 | Ga0496111_0636945_152_661 | 145 |
| 282 | 3300049569 | Ga0501032_0002608 | Ga0501032_0002608_1396_1917 | 145 |
| 283 | 3300049571 | Ga0501034_0016640 | Ga0501034_0016640_2060_2581 | 145 |
| 284 | 3300049573 | Ga0501037_0000365 | Ga0501037_0000365_847_1368 | 145 |
| 285 | 3300049574 | Ga0501038_0006076 | Ga0501038_0006076_631_1152 | 145 |
| 286 | 3300049575 | Ga0501039_0000118 | Ga0501039_0000118_35818_36339 | 145 |
| 287 | 3300049579 | Ga0501043_0000931 | Ga0501043_0000931_24915_25436 | 145 |
| 288 | 3300049586 | Ga0501070_0000548 | Ga0501070_0000548_2194_2715 | 145 |
| 289 | 3300049589 | Ga0501073_0009392 | Ga0501073_0009392_2826_3347 | 145 |
| 290 | 3300049593 | Ga0501077_0093930 | Ga0501077_0093930_313_834 | 145 |
| 291 | 3300050490 | nmdc:mga03n38_154911_c1 | nmdc:mga03n38_154911_c1_464_973 | 145 |
| 292 | 3300050490 | nmdc:mga03n38_4799_c1 | nmdc:mga03n38_4799_c1_509_1033 | 145 |
| 293 | 3300050491 | nmdc:mga00v17_38801_c1 | nmdc:mga00v17_38801_c1_615_1139 | 145 |
| 294 | 3300050516 | nmdc:mga0sz30_5284_c3 | nmdc:mga0sz30_5284_c3_1527_2051 | 145 |
| 295 | 3300005347 | Ga0070668_100016009 | Ga0070668_1000160095 | 146 |
| 296 | 3300025972 | Ga0207668_10009746 | Ga0207668_100097462 | 146 |
| 297 | 3300035692 | Ga0373935_1169831 | Ga0373935_1169831_12_509 | 146 |
| 298 | 3300044694 | Ga0466963_0103053 | Ga0466963_0103053_412_897 | 146 |
| 299 | 3300044842 | Ga0466957_0773460 | Ga0466957_0773460_166_651 | 146 |
| 300 | 3300045836 | Ga0466958_0071254 | Ga0466958_0071254_529_1014 | 146 |
| 301 | 3300045976 | Ga0466967_1681348 | Ga0466967_1681348_94_579 | 146 |
| 302 | 3300046460 | Ga0495638_0001483 | Ga0495638_0001483_12988_13506 | 146 |
| 303 | 3300053108 | Ga0500562_014754 | Ga0500562_014754_1292_1804 | 146 |
| 304 | 3300053133 | Ga0500655_058928 | Ga0500655_058928_41_553 | 146 |
| 305 | 3300053158 | Ga0500627_0064033 | Ga0500627_0064033_335_862 | 146 |
| 306 | 3300005356 | Ga0070674_100151053 | Ga0070674_1001510533 | 147 |
| 307 | 3300005367 | Ga0070667_101029500 | Ga0070667_1010295001 | 147 |
| 308 | 3300005539 | Ga0068853_100070238 | Ga0068853_1000702383 | 147 |
| 309 | 3300009177 | Ga0105248_10077715 | Ga0105248_100777154 | 147 |
| 310 | 3300025937 | Ga0207669_10329687 | Ga0207669_103296871 | 147 |
| 311 | 3300025941 | Ga0207711_10141995 | Ga0207711_101419953 | 147 |
| 312 | 3300026041 | Ga0207639_10026359 | Ga0207639_100263594 | 147 |
| 313 | 3300046660 | Ga0495625_0194668 | Ga0495625_0194668_648_1160 | 147 |
| 314 | 3300047472 | Ga0495686_0001889 | Ga0495686_0001889_225_740 | 147 |
| 315 | 3300048903 | Ga0496100_0098449 | Ga0496100_0098449_574_1089 | 147 |
| 316 | 3300048904 | Ga0496101_0223236 | Ga0496101_0223236_670_1182 | 147 |
| 317 | 3300048907 | Ga0496104_0122816 | Ga0496104_0122816_528_1043 | 147 |
| 318 | 3300048908 | Ga0496105_0008082 | Ga0496105_0008082_1138_1650 | 147 |
| 319 | 3300048909 | Ga0496106_0021910 | Ga0496106_0021910_754_1269 | 147 |
| 320 | 3300048910 | Ga0496107_0201986 | Ga0496107_0201986_166_681 | 147 |
| 321 | 3300048911 | Ga0496108_0332030 | Ga0496108_0332030_230_745 | 147 |
| 322 | 3300048918 | Ga0496115_0009018 | Ga0496115_0009018_686_1198 | 147 |
| 323 | 3300053079 | Ga0500610_0010181 | Ga0500610_0010181_1163_1684 | 147 |
| 324 | 3300053153 | Ga0500616_0006211 | Ga0500616_0006211_6593_7111 | 147 |
| 325 | 3300053153 | Ga0500616_0036377 | Ga0500616_0036377_493_1017 | 147 |
| 326 | 3300003792 | Ga0055540_1030061 | Ga0055540_10300613 | 148 |
| 327 | 3300005548 | Ga0070665_100892223 | Ga0070665_1008922232 | 148 |
| 328 | 3300006051 | Ga0075364_10204582 | Ga0075364_102045821 | 148 |
| 329 | 3300025303 | Ga0209051_1000628 | Ga0209051_10006289 | 148 |
| 330 | 3300025303 | Ga0209051_1001487 | Ga0209051_10014874 | 148 |
| 331 | 3300026067 | Ga0207678_10091379 | Ga0207678_100913793 | 148 |
| 332 | 3300028379 | Ga0268266_10462884 | Ga0268266_104628842 | 148 |
| 333 | 3300048911 | Ga0496108_0126453 | Ga0496108_0126453_17_541 | 148 |
| 334 | 3300048927 | Ga0496124_0326971 | Ga0496124_0326971_179_709 | 148 |
| 335 | 3300050491 | nmdc:mga00v17_98144_c1 | nmdc:mga00v17_98144_c1_485_1015 | 148 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6bhw-assembly2.cif.gz_E | b. subtilis ssba | 0.9259 | 7 | 110 |
| 2cwa-assembly1.cif.gz_A | crystal structure of the single-stranded dna binding protein from thermus thermophilus hb8 | 0.9257 | 7 | 112 |
| 6bhx-assembly1.cif.gz_C | b. subtilis ssba with dna | 0.9151 | 7 | 110 |
| 7r4w-assembly1.cif.gz_A | single stranded dna binding protein ssb m5 from fervidobacterium gondwanense | 0.9143 | 7 | 107 |
| 1z9f-assembly1.cif.gz_A | crystal structure of single stranded dna-binding protein (tm0604) from thermotoga maritima at 2.60 a resolution | 0.9104 | 7 | 110 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1z9fA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9104 | 7 | 110 | 2.40.50.140 |
| 5odnH00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8859 | 1 | 110 | 2.40.50.140 |
| 2iheA02 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8788 | 7 | 119 | 2.40.50.140 |
| af_C4J9S9_72_176_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8723 | 7 | 116 | 2.40.50.140 |
| 5odnH00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8689 | 1 | 110 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A8B3SQ42-F1-model_v4 | Single-stranded DNA-binding protein | 0.8822 | 5 | 109 |
GO:0003697
GO:0006260 GO:0009295 |
| AF-A0A849RPJ7-F1-model_v4 | Single-stranded DNA-binding protein | 0.8791 | 7 | 104 |
GO:0003697
|
| AF-A0A5F1YIA1-F1-model_v4 | Single-stranded DNA-binding protein (SSB) | 0.8773 | 6 | 110 |
GO:0003697
GO:0006260 GO:0009295 |
| AF-A0A6M3JK56-F1-model_v4 | Putative single-stranded DNA-binding protein | 0.8744 | 7 | 105 |
GO:0003697
GO:0006260 GO:0009295 |
| AF-A0A7C5BEN0-F1-model_v4 | Single-stranded DNA-binding protein | 0.8709 | 7 | 104 |
GO:0003697
GO:0006260 GO:0009295 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar