F412064
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 335 | 262 | 245 | 84 |
Family's Representative Sequence
| Representative Sequence | 3300003322|rootL2_10093422|rootL2_100934222 |
| Length | 92 |
| Sequence | VKIVWDEPKRFRNLAKHGLDFRELDLEFFADAVIIDARDRRLKAIGFAIGDILAVVFATLGSEGISIISMRPASRKERKLYEQIQADHSRPH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 2 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 3 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 4 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 5 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 6 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 7 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 8 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 9 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 10 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 11 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 12 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 13 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 14 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 15 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 16 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 17 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 18 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 19 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 20 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 21 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 22 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 23 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 24 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 25 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 26 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 27 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 28 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 29 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 30 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 31 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 32 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 33 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 34 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 35 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 36 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 37 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 38 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 39 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 40 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 41 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 42 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 43 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 44 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 45 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 46 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 47 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 48 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 49 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 50 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 51 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 52 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 53 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 54 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 55 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 56 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 57 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 58 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 59 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 60 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 61 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 62 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 63 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 64 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 65 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 66 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 67 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 68 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 69 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 70 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 71 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 72 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 73 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 74 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 75 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 76 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 77 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 78 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 79 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 80 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 81 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 82 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 83 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 84 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 85 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 86 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 87 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 88 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 89 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 90 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 91 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 92 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 93 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 94 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 95 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 96 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 97 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 98 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 101 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 107 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 109 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 110 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 111 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 112 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 113 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 114 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 115 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 116 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 117 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 155 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 157 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 158 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 159 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 160 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 161 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 162 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 163 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 164 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 165 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 166 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 167 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 168 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 169 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 170 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 171 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 172 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 173 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 174 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 176 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 177 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 178 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 179 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 180 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 181 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 182 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 183 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 184 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 185 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 186 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 187 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 204 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 205 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 206 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 207 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 208 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 209 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 210 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 211 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 212 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 213 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 214 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 215 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 216 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 217 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 218 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 219 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 220 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 221 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 222 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 247 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 248 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 249 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 250 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 251 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 252 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 253 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 254 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 255 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 256 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 257 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 258 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 259 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 260 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 262 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 72.84 |
| Metatranscriptomes | 0.3 |
| Isolates | 26.87 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.04 |
| Nodule | 20 |
| Rhizoplane | 2.69 |
| Rhizosphere | 48.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 17.91 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25150J39212_1000042 | 3300002774 | Bacteria | 84513 |
| 2 | JGI25151J46595_10000565 | 3300003187 | Bacteria | 33453 |
| 3 | JGI25153J46596_10005251 | 3300003215 | Bacteria | 6811 |
| 4 | rootL2_10093422 | 3300003322 | Bacteria | 2548 |
| 5 | rootH1_10056936 | 3300003323 | Bacteria | 1893 |
| 6 | Ga0006562J51391_1031567 | 3300003578 | Bacteria | 2970 |
| 7 | Ga0055529_1018028 | 3300003763 | Bacteria | 884 |
| 8 | Ga0055536_1076202 | 3300003781 | Bacteria | 647 |
| 9 | Ga0065165_1014490 | 3300005262 | Bacteria | 3059 |
| 10 | Ga0070658_10822065 | 3300005327 | Bacteria | 807 |
| 11 | Ga0070666_10599792 | 3300005335 | Bacteria | 803 |
| 12 | Ga0070689_100562229 | 3300005340 | Bacteria | 984 |
| 13 | Ga0070668_100183045 | 3300005347 | Bacteria | 1712 |
| 14 | Ga0070668_101392044 | 3300005347 | Bacteria | 639 |
| 15 | Ga0070663_100679331 | 3300005455 | Bacteria | 873 |
| 16 | Ga0070678_100082195 | 3300005456 | Bacteria | 2445 |
| 17 | Ga0070678_101331159 | 3300005456 | Bacteria | 669 |
| 18 | Ga0070672_100091894 | 3300005543 | Bacteria | 2449 |
| 19 | Ga0070665_100115199 | 3300005548 | Bacteria | 2690 |
| 20 | Ga0070665_100583624 | 3300005548 | Bacteria | 1131 |
| 21 | Ga0068857_100574606 | 3300005577 | Bacteria | 1063 |
| 22 | Ga0070702_101533510 | 3300005615 | Bacteria | 549 |
| 23 | Ga0068859_100271991 | 3300005617 | Bacteria | 1786 |
| 24 | Ga0068861_101189250 | 3300005719 | Bacteria | 737 |
| 25 | Ga0068870_10891983 | 3300005840 | Unclassified | 627 |
| 26 | Ga0068870_11314141 | 3300005840 | Bacteria | 527 |
| 27 | Ga0068863_100144372 | 3300005841 | Bacteria | 2276 |
| 28 | Ga0081540_1059351 | 3300005983 | Bacteria | 1837 |
| 29 | Ga0081539_10000051 | 3300005985 | Bacteria | 268337 |
| 30 | Ga0081539_10415182 | 3300005985 | Bacteria | 559 |
| 31 | Ga0075367_10274209 | 3300006178 | Bacteria | 1060 |
| 32 | Ga0075370_10179720 | 3300006353 | Bacteria | 1245 |
| 33 | Ga0068871_101847477 | 3300006358 | Bacteria | 574 |
| 34 | Ga0097620_100271973 | 3300006931 | Bacteria | 1786 |
| 35 | Ga0105245_11009720 | 3300009098 | Bacteria | 876 |
| 36 | Ga0105245_12701481 | 3300009098 | Bacteria | 549 |
| 37 | Ga0105247_10209671 | 3300009101 | Bacteria | 1314 |
| 38 | Ga0105247_11823800 | 3300009101 | Bacteria | 507 |
| 39 | Ga0105243_10049864 | 3300009148 | Bacteria | 3305 |
| 40 | Ga0105243_11102884 | 3300009148 | Bacteria | 802 |
| 41 | Ga0105242_10518063 | 3300009176 | Bacteria | 1137 |
| 42 | Ga0105238_11108521 | 3300009551 | Bacteria | 814 |
| 43 | Ga0105238_11518779 | 3300009551 | Bacteria | 699 |
| 44 | Ga0105246_10179816 | 3300011119 | Bacteria | 1627 |
| 45 | Ga0157370_11030156 | 3300013104 | Bacteria | 745 |
| 46 | Ga0157378_10639166 | 3300013297 | Bacteria | 1079 |
| 47 | Ga0157378_11774255 | 3300013297 | Bacteria | 665 |
| 48 | Ga0163163_10219553 | 3300014325 | Bacteria | 1950 |
| 49 | Ga0157380_10496643 | 3300014326 | Bacteria | 1184 |
| 50 | Ga0157380_11508052 | 3300014326 | Bacteria | 726 |
| 51 | Ga0157379_10956242 | 3300014968 | Bacteria | 815 |
| 52 | Ga0207425_1000012 | 3300025245 | Bacteria | 528324 |
| 53 | Ga0209148_1000505 | 3300025254 | Bacteria | 39613 |
| 54 | Ga0209129_1000086 | 3300025258 | Bacteria | 181543 |
| 55 | Ga0209233_1019048 | 3300025261 | Bacteria | 1832 |
| 56 | Ga0209455_1003223 | 3300025272 | Bacteria | 5893 |
| 57 | Ga0209673_1008627 | 3300025273 | Bacteria | 4517 |
| 58 | Ga0209130_1004501 | 3300025284 | Bacteria | 5262 |
| 59 | Ga0209676_1074220 | 3300025292 | Bacteria | 797 |
| 60 | Ga0209025_1000024 | 3300025294 | Bacteria | 528324 |
| 61 | Ga0209758_1000046 | 3300025297 | Bacteria | 364931 |
| 62 | Ga0209051_1030564 | 3300025303 | Bacteria | 2088 |
| 63 | Ga0209051_1066664 | 3300025303 | Bacteria | 1105 |
| 64 | Ga0209257_1057468 | 3300025304 | Bacteria | 1070 |
| 65 | Ga0207682_10045991 | 3300025893 | Bacteria | 1793 |
| 66 | Ga0207710_10128260 | 3300025900 | Bacteria | 1217 |
| 67 | Ga0207680_11083626 | 3300025903 | Bacteria | 573 |
| 68 | Ga0207649_10922084 | 3300025920 | Bacteria | 685 |
| 69 | Ga0207650_11104890 | 3300025925 | Bacteria | 675 |
| 70 | Ga0207687_10284828 | 3300025927 | Bacteria | 1326 |
| 71 | Ga0207687_10647052 | 3300025927 | Bacteria | 894 |
| 72 | Ga0207691_10052626 | 3300025940 | Bacteria | 3719 |
| 73 | Ga0207679_11811728 | 3300025945 | Unclassified | 558 |
| 74 | Ga0207639_11261323 | 3300026041 | Unclassified | 694 |
| 75 | Ga0207678_10233349 | 3300026067 | Bacteria | 1575 |
| 76 | Ga0207648_11732906 | 3300026089 | Bacteria | 586 |
| 77 | Ga0207675_100320039 | 3300026118 | Bacteria | 1514 |
| 78 | Ga0207683_10088057 | 3300026121 | Bacteria | 2762 |
| 79 | Ga0207683_12148635 | 3300026121 | Bacteria | 506 |
| 80 | Ga0209281_1007626 | 3300027111 | Bacteria | 2702 |
| 81 | Ga0268266_10028526 | 3300028379 | Bacteria | 4743 |
| 82 | Ga0268266_11291143 | 3300028379 | Bacteria | 705 |
| 83 | Ga0268266_11409121 | 3300028379 | Bacteria | 672 |
| 84 | Ga0307515_10205505 | 3300028794 | Bacteria | 1831 |
| 85 | Ga0265330_10018135 | 3300031235 | Bacteria | 3236 |
| 86 | Ga0265325_10276151 | 3300031241 | Bacteria | 754 |
| 87 | Ga0265325_10387825 | 3300031241 | Bacteria | 613 |
| 88 | Ga0265316_11243817 | 3300031344 | Bacteria | 515 |
| 89 | Ga0265342_10393103 | 3300031712 | Bacteria | 717 |
| 90 | Ga0307516_10656910 | 3300031730 | Bacteria | 704 |
| 91 | Ga0307405_10147509 | 3300031731 | Bacteria | 1650 |
| 92 | Ga0307405_10555753 | 3300031731 | Bacteria | 930 |
| 93 | Ga0307413_10832481 | 3300031824 | Bacteria | 778 |
| 94 | Ga0307410_10523282 | 3300031852 | Bacteria | 979 |
| 95 | Ga0307410_11176055 | 3300031852 | Bacteria | 667 |
| 96 | Ga0307406_11161086 | 3300031901 | Bacteria | 669 |
| 97 | Ga0307407_10092835 | 3300031903 | Bacteria | 1855 |
| 98 | Ga0307412_10924045 | 3300031911 | Bacteria | 766 |
| 99 | Ga0307416_100378371 | 3300032002 | Bacteria | 1445 |
| 100 | Ga0307416_102711186 | 3300032002 | Unclassified | 592 |
| 101 | Ga0307414_11980589 | 3300032004 | Bacteria | 544 |
| 102 | Ga0307411_10457251 | 3300032005 | Bacteria | 1069 |
| 103 | Ga0307415_100414165 | 3300032126 | Bacteria | 1154 |
| 104 | Ga0373929_0065506 | 3300035085 | Bacteria | 859 |
| 105 | Ga0373936_0030662 | 3300035113 | Bacteria | 2121 |
| 106 | Ga0373937_0165696 | 3300036401 | Bacteria | 2072 |
| 107 | Ga0395905_0026234 | 3300037471 | Bacteria | 5494 |
| 108 | Ga0395905_0035438 | 3300037471 | Bacteria | 4686 |
| 109 | Ga0436364_0101778 | 3300037853 | Bacteria | 1608 |
| 110 | Ga0237819_16744 | 3300038705 | Bacteria | 820 |
| 111 | Ga0436365_0584183 | 3300039437 | Bacteria | 699 |
| 112 | Ga0436360_0290965 | 3300039438 | Bacteria | 706 |
| 113 | Ga0436361_0533849 | 3300039447 | Unclassified | 672 |
| 114 | Ga0436363_1540848 | 3300039450 | Unclassified | 645 |
| 115 | Ga0451853_2483692 | 3300041512 | Bacteria | 817 |
| 116 | Ga0439449_0103657 | 3300042007 | Bacteria | 1052 |
| 117 | Ga0466972_0000200 | 3300044658 | Bacteria | 43953 |
| 118 | Ga0466970_0133668 | 3300044765 | Bacteria | 1364 |
| 119 | Ga0466967_0280029 | 3300045976 | Bacteria | 1600 |
| 120 | Ga0495629_0009469 | 3300046459 | Bacteria | 7124 |
| 121 | Ga0495653_0514427 | 3300046463 | Bacteria | 745 |
| 122 | Ga0495608_0037660 | 3300046511 | Bacteria | 3252 |
| 123 | Ga0495628_0413532 | 3300046516 | Bacteria | 984 |
| 124 | Ga0495665_0319075 | 3300046531 | Bacteria | 794 |
| 125 | Ga0495640_0049262 | 3300046533 | Bacteria | 2906 |
| 126 | Ga0495622_0081307 | 3300046557 | Bacteria | 1490 |
| 127 | Ga0495635_0008380 | 3300046663 | Bacteria | 7215 |
| 128 | Ga0495657_0020494 | 3300046675 | Bacteria | 4752 |
| 129 | Ga0495600_0097965 | 3300046809 | Bacteria | 1911 |
| 130 | Ga0495604_0002639 | 3300047317 | Bacteria | 14394 |
| 131 | Ga0495676_0365124 | 3300047321 | Bacteria | 963 |
| 132 | Ga0495680_0468333 | 3300047322 | Bacteria | 860 |
| 133 | Ga0495685_136878 | 3300047447 | Unclassified | 799 |
| 134 | Ga0495684_1091688 | 3300047471 | Bacteria | 501 |
| 135 | Ga0495602_0019615 | 3300048088 | Bacteria | 6709 |
| 136 | Ga0495602_0578794 | 3300048088 | Bacteria | 775 |
| 137 | Ga0496100_0290432 | 3300048903 | Bacteria | 1222 |
| 138 | Ga0496102_0643569 | 3300048905 | Bacteria | 983 |
| 139 | Ga0496102_1478815 | 3300048905 | Bacteria | 598 |
| 140 | Ga0496104_0005151 | 3300048907 | Bacteria | 11419 |
| 141 | Ga0496105_0010064 | 3300048908 | Bacteria | 7421 |
| 142 | Ga0496107_1147243 | 3300048910 | Bacteria | 560 |
| 143 | Ga0496112_1190100 | 3300048915 | Bacteria | 679 |
| 144 | Ga0496113_1006021 | 3300048916 | Bacteria | 656 |
| 145 | Ga0496114_0158126 | 3300048917 | Bacteria | 1969 |
| 146 | Ga0496116_0020877 | 3300048919 | Bacteria | 4957 |
| 147 | Ga0496116_0045304 | 3300048919 | Bacteria | 2978 |
| 148 | Ga0496117_0026928 | 3300048920 | Bacteria | 4489 |
| 149 | Ga0496118_0068364 | 3300048921 | Bacteria | 2580 |
| 150 | Ga0496119_0002144 | 3300048922 | Bacteria | 22179 |
| 151 | Ga0496119_0309677 | 3300048922 | Bacteria | 776 |
| 152 | Ga0496120_0011576 | 3300048923 | Bacteria | 6059 |
| 153 | Ga0496120_0040958 | 3300048923 | Bacteria | 2718 |
| 154 | Ga0496121_0024057 | 3300048924 | Bacteria | 5836 |
| 155 | Ga0496121_0027091 | 3300048924 | Bacteria | 5374 |
| 156 | Ga0496121_0081855 | 3300048924 | Bacteria | 2554 |
| 157 | Ga0496121_0210404 | 3300048924 | Bacteria | 1378 |
| 158 | Ga0496121_0887436 | 3300048924 | Bacteria | 514 |
| 159 | Ga0496122_0027609 | 3300048925 | Bacteria | 4845 |
| 160 | Ga0496122_0057655 | 3300048925 | Bacteria | 2882 |
| 161 | Ga0496123_0005995 | 3300048926 | Bacteria | 11950 |
| 162 | Ga0496123_0127029 | 3300048926 | Bacteria | 1421 |
| 163 | Ga0496123_0424196 | 3300048926 | Bacteria | 599 |
| 164 | Ga0496124_0019949 | 3300048927 | Bacteria | 6216 |
| 165 | Ga0496124_0040470 | 3300048927 | Bacteria | 4030 |
| 166 | Ga0496124_0122792 | 3300048927 | Bacteria | 2073 |
| 167 | Ga0496124_0556279 | 3300048927 | Bacteria | 756 |
| 168 | Ga0496125_0000634 | 3300048928 | Bacteria | 58798 |
| 169 | Ga0496125_0019563 | 3300048928 | Bacteria | 6380 |
| 170 | Ga0496125_0134631 | 3300048928 | Bacteria | 1731 |
| 171 | Ga0496125_0146642 | 3300048928 | Bacteria | 1630 |
| 172 | Ga0496126_0044722 | 3300048929 | Bacteria | 4075 |
| 173 | Ga0496126_0202994 | 3300048929 | Bacteria | 1673 |
| 174 | Ga0496126_0284634 | 3300048929 | Bacteria | 1368 |
| 175 | Ga0496126_1006006 | 3300048929 | Bacteria | 625 |
| 176 | Ga0501031_0000036 | 3300049568 | Bacteria | 73760 |
| 177 | Ga0501031_0012514 | 3300049568 | Bacteria | 5539 |
| 178 | Ga0501032_0000100 | 3300049569 | Bacteria | 73505 |
| 179 | Ga0501032_0005055 | 3300049569 | Bacteria | 9860 |
| 180 | Ga0501033_0000088 | 3300049570 | Bacteria | 87638 |
| 181 | Ga0501033_0000500 | 3300049570 | Bacteria | 36912 |
| 182 | Ga0501033_1069991 | 3300049570 | Unclassified | 537 |
| 183 | Ga0501034_0000397 | 3300049571 | Bacteria | 73511 |
| 184 | Ga0501034_0200551 | 3300049571 | Bacteria | 1954 |
| 185 | Ga0501034_0457405 | 3300049571 | Bacteria | 1193 |
| 186 | Ga0501036_0000056 | 3300049572 | Bacteria | 73511 |
| 187 | Ga0501036_0044841 | 3300049572 | Bacteria | 3746 |
| 188 | Ga0501036_0309323 | 3300049572 | Bacteria | 1321 |
| 189 | Ga0501037_0000119 | 3300049573 | Bacteria | 73510 |
| 190 | Ga0501037_0000742 | 3300049573 | Bacteria | 24738 |
| 191 | Ga0501037_0075453 | 3300049573 | Bacteria | 2448 |
| 192 | Ga0501038_0000098 | 3300049574 | Bacteria | 73471 |
| 193 | Ga0501038_0009558 | 3300049574 | Bacteria | 8896 |
| 194 | Ga0501038_0152233 | 3300049574 | Bacteria | 1885 |
| 195 | Ga0501039_0000013 | 3300049575 | Bacteria | 234418 |
| 196 | Ga0501039_0121899 | 3300049575 | Bacteria | 2044 |
| 197 | Ga0501039_1280178 | 3300049575 | Unclassified | 566 |
| 198 | Ga0501043_0000022 | 3300049579 | Bacteria | 154467 |
| 199 | Ga0501043_0004996 | 3300049579 | Bacteria | 10731 |
| 200 | Ga0501043_0095339 | 3300049579 | Bacteria | 2338 |
| 201 | Ga0501046_0296985 | 3300049580 | Bacteria | 1181 |
| 202 | Ga0501047_0039087 | 3300049581 | Bacteria | 4590 |
| 203 | Ga0501047_0124767 | 3300049581 | Bacteria | 2455 |
| 204 | Ga0501047_0423603 | 3300049581 | Bacteria | 1162 |
| 205 | Ga0501067_0160483 | 3300049583 | Bacteria | 1252 |
| 206 | Ga0501068_0038478 | 3300049584 | Bacteria | 2866 |
| 207 | Ga0501069_0000012 | 3300049585 | Bacteria | 148453 |
| 208 | Ga0501070_0000103 | 3300049586 | Bacteria | 74597 |
| 209 | Ga0501070_0054296 | 3300049586 | Bacteria | 3323 |
| 210 | Ga0501070_0056386 | 3300049586 | Bacteria | 3257 |
| 211 | Ga0501070_0148773 | 3300049586 | Bacteria | 1932 |
| 212 | Ga0501071_0062113 | 3300049587 | Bacteria | 2706 |
| 213 | Ga0501073_0030752 | 3300049589 | Bacteria | 3833 |
| 214 | Ga0501073_0336718 | 3300049589 | Bacteria | 1042 |
| 215 | Ga0501074_0000021 | 3300049590 | Bacteria | 71950 |
| 216 | Ga0501076_1017097 | 3300049592 | Unclassified | 683 |
| 217 | Ga0501076_1559965 | 3300049592 | Unclassified | 542 |
| 218 | Ga0501080_0001356 | 3300049742 | Bacteria | 20452 |
| 219 | Ga0501080_0115020 | 3300049742 | Bacteria | 2494 |
| 220 | Ga0501083_0012886 | 3300049744 | Bacteria | 5847 |
| 221 | Ga0501035_0000039 | 3300049822 | Bacteria | 156824 |
| 222 | Ga0501035_0000053 | 3300049822 | Bacteria | 142860 |
| 223 | Ga0501035_0016789 | 3300049822 | Bacteria | 6749 |
| 224 | Ga0501044_0000047 | 3300049823 | Bacteria | 146449 |
| 225 | Ga0501044_0000214 | 3300049823 | Bacteria | 73483 |
| 226 | Ga0501044_0031444 | 3300049823 | Bacteria | 5587 |
| 227 | Ga0501045_0788382 | 3300049824 | Unclassified | 700 |
| 228 | nmdc:mga07m45_151375_c1 | 3300050496 | Bacteria | 1345 |
| 229 | Ga0500578_0350299 | 3300053086 | Bacteria | 863 |
| 230 | Ga0500646_0097299 | 3300053090 | Unclassified | 919 |
| 231 | Ga0500651_0088703 | 3300053093 | Bacteria | 1907 |
| 232 | Ga0500651_0352101 | 3300053093 | Bacteria | 835 |
| 233 | Ga0500555_163633 | 3300053103 | Bacteria | 542 |
| 234 | Ga0500569_009544 | 3300053109 | Bacteria | 2259 |
| 235 | Ga0500655_057003 | 3300053133 | Bacteria | 783 |
| 236 | Ga0500658_0207229 | 3300053134 | Bacteria | 897 |
| 237 | Ga0500559_0160909 | 3300053136 | Bacteria | 1055 |
| 238 | Ga0500616_0000104 | 3300053153 | Bacteria | 159954 |
| 239 | Ga0500638_225690 | 3300053162 | Bacteria | 773 |
| 240 | Ga0500636_0277777 | 3300053177 | Bacteria | 838 |
| 241 | Ga0500645_006745 | 3300053730 | Bacteria | 4067 |
| 242 | Ga0500645_092674 | 3300053730 | Bacteria | 856 |
| 243 | Ga0500609_061693 | 3300053731 | Bacteria | 524 |
| 244 | Ga0501082_0013345 | 3300060353 | Bacteria | 7066 |
| 245 | Ga0501082_0270789 | 3300060353 | Unclassified | 1478 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2534681786 | 2535484705 | 76 |
| 2 | iso_pu_bacteria | 2891373044 | 2891377083 | 76 |
| 3 | iso_pu_bacteria | 2510065057 | 2510303413 | 77 |
| 4 | iso_pu_bacteria | 2510917026 | 2511171546 | 77 |
| 5 | iso_pu_bacteria | 2513237091 | 2513616078 | 77 |
| 6 | iso_pu_bacteria | 2513237140 | 2513884720 | 77 |
| 7 | iso_pu_bacteria | 2513237143 | 2513905115 | 77 |
| 8 | iso_pu_bacteria | 2515154107 | 2515613521 | 77 |
| 9 | iso_pu_bacteria | 2643221655 | 2644312690 | 77 |
| 10 | iso_pu_bacteria | 2643221659 | 2644336747 | 77 |
| 11 | iso_pu_bacteria | 2643221712 | 2644618421 | 77 |
| 12 | iso_pu_bacteria | 2855825444 | 2855827976 | 77 |
| 13 | iso_pu_bacteria | 2855839649 | 2855839749 | 77 |
| 14 | iso_pu_bacteria | 2858800743 | 2858803626 | 77 |
| 15 | iso_pu_bacteria | 2915986958 | 2915988694 | 77 |
| 16 | iso_pu_bacteria | 2915993759 | 2915997243 | 77 |
| 17 | iso_pu_bacteria | 2916028427 | 2916031492 | 77 |
| 18 | iso_pu_bacteria | 2916041962 | 2916045085 | 77 |
| 19 | iso_pu_bacteria | 2916048683 | 2916053581 | 77 |
| 20 | iso_pu_bacteria | 2916055098 | 2916057043 | 77 |
| 21 | iso_pu_bacteria | 2916076590 | 2916079744 | 77 |
| 22 | iso_pu_bacteria | 2921201388 | 2921207510 | 77 |
| 23 | iso_pu_bacteria | 2921263974 | 2921268789 | 77 |
| 24 | iso_pu_bacteria | 2921296804 | 2921297170 | 77 |
| 25 | iso_pu_bacteria | 2924150972 | 2924154300 | 77 |
| 26 | iso_pu_bacteria | 2924158325 | 2924164670 | 77 |
| 27 | iso_pu_bacteria | 2924172951 | 2924173734 | 77 |
| 28 | iso_pu_bacteria | 2937042894 | 2937047419 | 77 |
| 29 | iso_pu_bacteria | 2937049772 | 2937053290 | 77 |
| 30 | iso_pu_bacteria | 2937056579 | 2937060812 | 77 |
| 31 | iso_pu_bacteria | 2937063883 | 2937066802 | 77 |
| 32 | iso_pu_bacteria | 2937091812 | 2937098714 | 77 |
| 33 | iso_pu_bacteria | 2937098957 | 2937102775 | 77 |
| 34 | iso_pu_bacteria | 2937106411 | 2937106489 | 77 |
| 35 | iso_pu_bacteria | 2941499720 | 2941506355 | 77 |
| 36 | iso_pu_bacteria | 2957443900 | 2957447371 | 77 |
| 37 | iso_pu_bacteria | 2957478035 | 2957481906 | 77 |
| 38 | iso_pu_bacteria | 2960610863 | 2960611649 | 77 |
| 39 | iso_pu_bacteria | 2960617483 | 2960620101 | 77 |
| 40 | iso_pu_bacteria | 2960624210 | 2960626696 | 77 |
| 41 | iso_pu_bacteria | 2960652885 | 2960654402 | 77 |
| 42 | iso_pu_bacteria | 2960660292 | 2960660655 | 77 |
| 43 | iso_pu_bacteria | 2960687367 | 2960687428 | 77 |
| 44 | iso_pu_bacteria | 2964607997 | 2964613444 | 77 |
| 45 | iso_pu_bacteria | 2964649959 | 2964650088 | 77 |
| 46 | iso_pu_bacteria | 2964656573 | 2964661648 | 77 |
| 47 | iso_pu_bacteria | 2967664464 | 2967667486 | 77 |
| 48 | iso_pu_bacteria | 2967678726 | 2967682567 | 77 |
| 49 | iso_pu_bacteria | 2967714385 | 2967714421 | 77 |
| 50 | iso_pu_bacteria | 2967721400 | 2967723745 | 77 |
| 51 | iso_pu_bacteria | 2967735183 | 2967739171 | 77 |
| 52 | iso_pu_bacteria | 2967762386 | 2967768926 | 77 |
| 53 | iso_pu_bacteria | 2967775926 | 2967780074 | 77 |
| 54 | iso_pu_bacteria | 2970019648 | 2970021260 | 77 |
| 55 | iso_pu_bacteria | 2970033650 | 2970037454 | 77 |
| 56 | iso_pu_bacteria | 2970040964 | 2970041037 | 77 |
| 57 | iso_pu_bacteria | 2970047711 | 2970054010 | 77 |
| 58 | iso_pu_bacteria | 2970068827 | 2970074610 | 77 |
| 59 | iso_pu_bacteria | 2970082768 | 2970088112 | 77 |
| 60 | iso_pu_bacteria | 2970116247 | 2970118185 | 77 |
| 61 | iso_pu_bacteria | 2970177841 | 2970183581 | 77 |
| 62 | iso_pu_bacteria | 2970184632 | 2970188770 | 77 |
| 63 | iso_pu_bacteria | 2977516862 | 2977521037 | 77 |
| 64 | iso_pu_bacteria | 2977551784 | 2977554744 | 77 |
| 65 | iso_pu_bacteria | 2977579622 | 2977584361 | 77 |
| 66 | iso_pu_bacteria | 8003992118 | 8003992204 | 77 |
| 67 | iso_pu_bacteria | 8054563764 | 8054566402 | 77 |
| 68 | 3300006178 | Ga0075367_10274209 | Ga0075367_102742093 | 79 |
| 69 | 3300005327 | Ga0070658_10822065 | Ga0070658_108220652 | 80 |
| 70 | 3300005455 | Ga0070663_100679331 | Ga0070663_1006793311 | 80 |
| 71 | 3300026067 | Ga0207678_10233349 | Ga0207678_102333493 | 80 |
| 72 | 3300039438 | Ga0436360_0290965 | Ga0436360_0290965_344_592 | 80 |
| 73 | 3300039447 | Ga0436361_0533849 | Ga0436361_0533849_373_621 | 80 |
| 74 | 3300049570 | Ga0501033_1069991 | Ga0501033_1069991_154_399 | 80 |
| 75 | iso_pu_bacteria | 2643221607 | 2644050979 | 80 |
| 76 | iso_pu_bacteria | 2643221636 | 2644205482 | 80 |
| 77 | iso_pu_bacteria | 2643221686 | 2644483883 | 80 |
| 78 | iso_pu_bacteria | 2937813078 | 2937813107 | 80 |
| 79 | 3300027111 | Ga0209281_1007626 | Ga0209281_10076264 | 81 |
| 80 | 3300031731 | Ga0307405_10555753 | Ga0307405_105557532 | 81 |
| 81 | 3300031852 | Ga0307410_11176055 | Ga0307410_111760552 | 81 |
| 82 | 3300031901 | Ga0307406_11161086 | Ga0307406_111610861 | 81 |
| 83 | 3300031911 | Ga0307412_10924045 | Ga0307412_109240451 | 81 |
| 84 | 3300032004 | Ga0307414_11980589 | Ga0307414_119805891 | 81 |
| 85 | 3300037471 | Ga0395905_0026234 | Ga0395905_0026234_3460_3708 | 81 |
| 86 | 3300042007 | Ga0439449_0103657 | Ga0439449_0103657_326_571 | 81 |
| 87 | 3300045976 | Ga0466967_0280029 | Ga0466967_0280029_587_832 | 81 |
| 88 | 3300048926 | Ga0496123_0127029 | Ga0496123_0127029_310_558 | 81 |
| 89 | 3300048928 | Ga0496125_0000634 | Ga0496125_0000634_17997_18245 | 81 |
| 90 | 3300049568 | Ga0501031_0012514 | Ga0501031_0012514_4193_4441 | 81 |
| 91 | 3300049569 | Ga0501032_0005055 | Ga0501032_0005055_8350_8598 | 81 |
| 92 | 3300049570 | Ga0501033_0000500 | Ga0501033_0000500_19957_20205 | 81 |
| 93 | 3300049571 | Ga0501034_0200551 | Ga0501034_0200551_1014_1262 | 81 |
| 94 | 3300049572 | Ga0501036_0309323 | Ga0501036_0309323_656_904 | 81 |
| 95 | 3300049573 | Ga0501037_0000742 | Ga0501037_0000742_12590_12838 | 81 |
| 96 | 3300049574 | Ga0501038_0152233 | Ga0501038_0152233_1323_1571 | 81 |
| 97 | 3300049575 | Ga0501039_1280178 | Ga0501039_1280178_82_330 | 81 |
| 98 | 3300049579 | Ga0501043_0000022 | Ga0501043_0000022_120428_120676 | 81 |
| 99 | 3300049581 | Ga0501047_0423603 | Ga0501047_0423603_262_510 | 81 |
| 100 | 3300049583 | Ga0501067_0160483 | Ga0501067_0160483_894_1142 | 81 |
| 101 | 3300049584 | Ga0501068_0038478 | Ga0501068_0038478_751_999 | 81 |
| 102 | 3300049585 | Ga0501069_0000012 | Ga0501069_0000012_139012_139260 | 81 |
| 103 | 3300049586 | Ga0501070_0000103 | Ga0501070_0000103_67185_67433 | 81 |
| 104 | 3300049587 | Ga0501071_0062113 | Ga0501071_0062113_404_652 | 81 |
| 105 | 3300049589 | Ga0501073_0030752 | Ga0501073_0030752_1270_1518 | 81 |
| 106 | 3300049589 | Ga0501073_0336718 | Ga0501073_0336718_152_400 | 81 |
| 107 | 3300049590 | Ga0501074_0000021 | Ga0501074_0000021_62712_62960 | 81 |
| 108 | 3300049592 | Ga0501076_1559965 | Ga0501076_1559965_100_348 | 81 |
| 109 | 3300049742 | Ga0501080_0001356 | Ga0501080_0001356_16875_17123 | 81 |
| 110 | 3300049744 | Ga0501083_0012886 | Ga0501083_0012886_4726_4974 | 81 |
| 111 | 3300049822 | Ga0501035_0000039 | Ga0501035_0000039_17481_17729 | 81 |
| 112 | 3300049823 | Ga0501044_0000047 | Ga0501044_0000047_139175_139423 | 81 |
| 113 | 3300053153 | Ga0500616_0000104 | Ga0500616_0000104_84805_85071 | 81 |
| 114 | 3300060353 | Ga0501082_0013345 | Ga0501082_0013345_5293_5541 | 81 |
| 115 | iso_pu_bacteria | 2857349434 | 2857355279 | 81 |
| 116 | iso_pu_bacteria | 2871444079 | 2871447455 | 81 |
| 117 | iso_pu_bacteria | 2922158528 | 2922160399 | 81 |
| 118 | iso_pu_bacteria | 2924726620 | 2924729470 | 81 |
| 119 | iso_pu_bacteria | 2968128360 | 2968132898 | 81 |
| 120 | iso_pu_bacteria | 2977942078 | 2977948825 | 81 |
| 121 | iso_pu_bacteria | 2987636660 | 2987640412 | 81 |
| 122 | iso_pu_bacteria | 2996341866 | 2996343630 | 81 |
| 123 | iso_pu_bacteria | 3004203850 | 3004208610 | 81 |
| 124 | 3300035113 | Ga0373936_0030662 | Ga0373936_0030662_184_432 | 82 |
| 125 | 3300039450 | Ga0436363_1540848 | Ga0436363_1540848_261_509 | 82 |
| 126 | 3300053730 | Ga0500645_092674 | Ga0500645_092674_588_839 | 82 |
| 127 | iso_pu_bacteria | 2824679649 | 2824683015 | 82 |
| 128 | iso_pu_bacteria | 2824704595 | 2824714565 | 82 |
| 129 | iso_pu_bacteria | 2824753945 | 2824755592 | 82 |
| 130 | iso_pu_bacteria | 2824763712 | 2824766255 | 82 |
| 131 | iso_pu_bacteria | 2904711408 | 2904712106 | 82 |
| 132 | iso_pu_bacteria | 2906602504 | 2906609769 | 82 |
| 133 | iso_pu_bacteria | 3005483717 | 3005484917 | 82 |
| 134 | 3300003781 | Ga0055536_1076202 | Ga0055536_10762022 | 83 |
| 135 | 3300005347 | Ga0070668_101392044 | Ga0070668_1013920441 | 83 |
| 136 | 3300005456 | Ga0070678_100082195 | Ga0070678_1000821953 | 83 |
| 137 | 3300005983 | Ga0081540_1059351 | Ga0081540_10593512 | 83 |
| 138 | 3300005985 | Ga0081539_10000051 | Ga0081539_10000051163 | 83 |
| 139 | 3300009101 | Ga0105247_11823800 | Ga0105247_118238002 | 83 |
| 140 | 3300009176 | Ga0105242_10518063 | Ga0105242_105180633 | 83 |
| 141 | 3300009551 | Ga0105238_11518779 | Ga0105238_115187792 | 83 |
| 142 | 3300013297 | Ga0157378_10639166 | Ga0157378_106391662 | 83 |
| 143 | 3300014326 | Ga0157380_11508052 | Ga0157380_115080522 | 83 |
| 144 | 3300025292 | Ga0209676_1074220 | Ga0209676_10742201 | 83 |
| 145 | 3300026121 | Ga0207683_10088057 | Ga0207683_100880572 | 83 |
| 146 | 3300031730 | Ga0307516_10656910 | Ga0307516_106569102 | 83 |
| 147 | 3300031731 | Ga0307405_10147509 | Ga0307405_101475093 | 83 |
| 148 | 3300031824 | Ga0307413_10832481 | Ga0307413_108324811 | 83 |
| 149 | 3300031852 | Ga0307410_10523282 | Ga0307410_105232823 | 83 |
| 150 | 3300031903 | Ga0307407_10092835 | Ga0307407_100928353 | 83 |
| 151 | 3300032002 | Ga0307416_100378371 | Ga0307416_1003783713 | 83 |
| 152 | 3300032005 | Ga0307411_10457251 | Ga0307411_104572513 | 83 |
| 153 | 3300032126 | Ga0307415_100414165 | Ga0307415_1004141653 | 83 |
| 154 | 3300036401 | Ga0373937_0165696 | Ga0373937_0165696_1463_1729 | 83 |
| 155 | 3300048088 | Ga0495602_0578794 | Ga0495602_0578794_270_536 | 83 |
| 156 | 3300048923 | Ga0496120_0040958 | Ga0496120_0040958_229_480 | 83 |
| 157 | 3300048927 | Ga0496124_0122792 | Ga0496124_0122792_833_1087 | 83 |
| 158 | 3300048928 | Ga0496125_0146642 | Ga0496125_0146642_477_731 | 83 |
| 159 | 3300049568 | Ga0501031_0000036 | Ga0501031_0000036_8927_9181 | 83 |
| 160 | 3300049569 | Ga0501032_0000100 | Ga0501032_0000100_64624_64878 | 83 |
| 161 | 3300049570 | Ga0501033_0000088 | Ga0501033_0000088_8628_8882 | 83 |
| 162 | 3300049571 | Ga0501034_0000397 | Ga0501034_0000397_64630_64884 | 83 |
| 163 | 3300049572 | Ga0501036_0000056 | Ga0501036_0000056_64630_64884 | 83 |
| 164 | 3300049573 | Ga0501037_0000119 | Ga0501037_0000119_64629_64883 | 83 |
| 165 | 3300049574 | Ga0501038_0000098 | Ga0501038_0000098_64603_64857 | 83 |
| 166 | 3300049575 | Ga0501039_0000013 | Ga0501039_0000013_8628_8882 | 83 |
| 167 | 3300049579 | Ga0501043_0004996 | Ga0501043_0004996_1878_2132 | 83 |
| 168 | 3300049580 | Ga0501046_0296985 | Ga0501046_0296985_764_1018 | 83 |
| 169 | 3300049581 | Ga0501047_0039087 | Ga0501047_0039087_1861_2115 | 83 |
| 170 | 3300049586 | Ga0501070_0054296 | Ga0501070_0054296_829_1083 | 83 |
| 171 | 3300049586 | Ga0501070_0056386 | Ga0501070_0056386_2822_3076 | 83 |
| 172 | 3300049822 | Ga0501035_0000053 | Ga0501035_0000053_133979_134233 | 83 |
| 173 | 3300049823 | Ga0501044_0000214 | Ga0501044_0000214_8628_8882 | 83 |
| 174 | 3300053136 | Ga0500559_0160909 | Ga0500559_0160909_46_297 | 83 |
| 175 | iso_pu_bacteria | 2643221599 | 2644007422 | 83 |
| 176 | iso_pu_bacteria | 3005409236 | 3005411302 | 83 |
| 177 | iso_pu_bacteria | 3005452660 | 3005452909 | 83 |
| 178 | 3300013297 | Ga0157378_11774255 | Ga0157378_117742551 | 84 |
| 179 | 3300025920 | Ga0207649_10922084 | Ga0207649_109220842 | 84 |
| 180 | 3300025927 | Ga0207687_10284828 | Ga0207687_102848283 | 84 |
| 181 | 3300026041 | Ga0207639_11261323 | Ga0207639_112613232 | 84 |
| 182 | 3300031235 | Ga0265330_10018135 | Ga0265330_100181353 | 84 |
| 183 | 3300031241 | Ga0265325_10276151 | Ga0265325_102761512 | 84 |
| 184 | 3300031241 | Ga0265325_10387825 | Ga0265325_103878252 | 84 |
| 185 | 3300031344 | Ga0265316_11243817 | Ga0265316_112438171 | 84 |
| 186 | 3300031712 | Ga0265342_10393103 | Ga0265342_103931032 | 84 |
| 187 | 3300032002 | Ga0307416_102711186 | Ga0307416_1027111861 | 84 |
| 188 | 3300035085 | Ga0373929_0065506 | Ga0373929_0065506_567_821 | 84 |
| 189 | 3300005985 | Ga0081539_10415182 | Ga0081539_104151822 | 85 |
| 190 | 3300037471 | Ga0395905_0035438 | Ga0395905_0035438_3201_3458 | 85 |
| 191 | 3300003763 | Ga0055529_1018028 | Ga0055529_10180282 | 86 |
| 192 | 3300005335 | Ga0070666_10599792 | Ga0070666_105997921 | 86 |
| 193 | 3300005347 | Ga0070668_100183045 | Ga0070668_1001830453 | 86 |
| 194 | 3300005456 | Ga0070678_101331159 | Ga0070678_1013311591 | 86 |
| 195 | 3300005548 | Ga0070665_100115199 | Ga0070665_1001151994 | 86 |
| 196 | 3300005548 | Ga0070665_100583624 | Ga0070665_1005836243 | 86 |
| 197 | 3300005615 | Ga0070702_101533510 | Ga0070702_1015335101 | 86 |
| 198 | 3300005840 | Ga0068870_11314141 | Ga0068870_113141412 | 86 |
| 199 | 3300009551 | Ga0105238_11108521 | Ga0105238_111085212 | 86 |
| 200 | 3300014326 | Ga0157380_10496643 | Ga0157380_104966433 | 86 |
| 201 | 3300025254 | Ga0209148_1000505 | Ga0209148_100050526 | 86 |
| 202 | 3300025261 | Ga0209233_1019048 | Ga0209233_10190483 | 86 |
| 203 | 3300025272 | Ga0209455_1003223 | Ga0209455_10032232 | 86 |
| 204 | 3300026089 | Ga0207648_11732906 | Ga0207648_117329062 | 86 |
| 205 | 3300026121 | Ga0207683_12148635 | Ga0207683_121486352 | 86 |
| 206 | 3300028379 | Ga0268266_10028526 | Ga0268266_100285263 | 86 |
| 207 | 3300028379 | Ga0268266_11409121 | Ga0268266_114091212 | 86 |
| 208 | 3300028794 | Ga0307515_10205505 | Ga0307515_102055053 | 86 |
| 209 | 3300037853 | Ga0436364_0101778 | Ga0436364_0101778_394_654 | 86 |
| 210 | 3300039437 | Ga0436365_0584183 | Ga0436365_0584183_243_503 | 86 |
| 211 | 3300044658 | Ga0466972_0000200 | Ga0466972_0000200_28817_29077 | 86 |
| 212 | 3300044765 | Ga0466970_0133668 | Ga0466970_0133668_493_753 | 86 |
| 213 | 3300046459 | Ga0495629_0009469 | Ga0495629_0009469_6013_6273 | 86 |
| 214 | 3300046463 | Ga0495653_0514427 | Ga0495653_0514427_435_695 | 86 |
| 215 | 3300046511 | Ga0495608_0037660 | Ga0495608_0037660_1322_1582 | 86 |
| 216 | 3300046516 | Ga0495628_0413532 | Ga0495628_0413532_542_802 | 86 |
| 217 | 3300046531 | Ga0495665_0319075 | Ga0495665_0319075_492_752 | 86 |
| 218 | 3300046533 | Ga0495640_0049262 | Ga0495640_0049262_739_999 | 86 |
| 219 | 3300046557 | Ga0495622_0081307 | Ga0495622_0081307_250_510 | 86 |
| 220 | 3300046663 | Ga0495635_0008380 | Ga0495635_0008380_3024_3284 | 86 |
| 221 | 3300046675 | Ga0495657_0020494 | Ga0495657_0020494_3874_4134 | 86 |
| 222 | 3300046809 | Ga0495600_0097965 | Ga0495600_0097965_1450_1710 | 86 |
| 223 | 3300047317 | Ga0495604_0002639 | Ga0495604_0002639_9091_9351 | 86 |
| 224 | 3300047321 | Ga0495676_0365124 | Ga0495676_0365124_470_730 | 86 |
| 225 | 3300047322 | Ga0495680_0468333 | Ga0495680_0468333_82_342 | 86 |
| 226 | 3300047471 | Ga0495684_1091688 | Ga0495684_1091688_21_281 | 86 |
| 227 | 3300048088 | Ga0495602_0019615 | Ga0495602_0019615_6123_6383 | 86 |
| 228 | 3300048905 | Ga0496102_0643569 | Ga0496102_0643569_124_384 | 86 |
| 229 | 3300048907 | Ga0496104_0005151 | Ga0496104_0005151_5404_5664 | 86 |
| 230 | 3300048908 | Ga0496105_0010064 | Ga0496105_0010064_5373_5633 | 86 |
| 231 | 3300048915 | Ga0496112_1190100 | Ga0496112_1190100_293_553 | 86 |
| 232 | 3300048916 | Ga0496113_1006021 | Ga0496113_1006021_72_332 | 86 |
| 233 | 3300048917 | Ga0496114_0158126 | Ga0496114_0158126_214_474 | 86 |
| 234 | 3300048922 | Ga0496119_0002144 | Ga0496119_0002144_3685_3945 | 86 |
| 235 | 3300048923 | Ga0496120_0011576 | Ga0496120_0011576_885_1145 | 86 |
| 236 | 3300048924 | Ga0496121_0027091 | Ga0496121_0027091_1534_1794 | 86 |
| 237 | 3300048927 | Ga0496124_0556279 | Ga0496124_0556279_444_704 | 86 |
| 238 | 3300048929 | Ga0496126_0044722 | Ga0496126_0044722_57_317 | 86 |
| 239 | 3300048929 | Ga0496126_1006006 | Ga0496126_1006006_148_408 | 86 |
| 240 | 3300053086 | Ga0500578_0350299 | Ga0500578_0350299_51_311 | 86 |
| 241 | 3300053090 | Ga0500646_0097299 | Ga0500646_0097299_210_470 | 86 |
| 242 | 3300053093 | Ga0500651_0088703 | Ga0500651_0088703_470_730 | 86 |
| 243 | 3300053093 | Ga0500651_0352101 | Ga0500651_0352101_255_515 | 86 |
| 244 | 3300053103 | Ga0500555_163633 | Ga0500555_163633_101_361 | 86 |
| 245 | 3300053109 | Ga0500569_009544 | Ga0500569_009544_1822_2082 | 86 |
| 246 | 3300053133 | Ga0500655_057003 | Ga0500655_057003_213_473 | 86 |
| 247 | 3300053134 | Ga0500658_0207229 | Ga0500658_0207229_317_577 | 86 |
| 248 | 3300053162 | Ga0500638_225690 | Ga0500638_225690_245_505 | 86 |
| 249 | 3300053177 | Ga0500636_0277777 | Ga0500636_0277777_422_682 | 86 |
| 250 | 3300053730 | Ga0500645_006745 | Ga0500645_006745_2903_3163 | 86 |
| 251 | 3300053731 | Ga0500609_061693 | Ga0500609_061693_32_292 | 86 |
| 252 | 3300002774 | JGI25150J39212_1000042 | JGI25150J39212_100004286 | 87 |
| 253 | 3300003187 | JGI25151J46595_10000565 | JGI25151J46595_1000056528 | 87 |
| 254 | 3300003215 | JGI25153J46596_10005251 | JGI25153J46596_100052518 | 87 |
| 255 | 3300003322 | rootL2_10093422 | rootL2_100934222 | 87 |
| 256 | 3300003323 | rootH1_10056936 | rootH1_100569361 | 87 |
| 257 | 3300003578 | Ga0006562J51391_1031567 | Ga0006562J51391_10315673 | 87 |
| 258 | 3300005262 | Ga0065165_1014490 | Ga0065165_10144901 | 87 |
| 259 | 3300005340 | Ga0070689_100562229 | Ga0070689_1005622292 | 87 |
| 260 | 3300005543 | Ga0070672_100091894 | Ga0070672_1000918943 | 87 |
| 261 | 3300005577 | Ga0068857_100574606 | Ga0068857_1005746063 | 87 |
| 262 | 3300005617 | Ga0068859_100271991 | Ga0068859_1002719912 | 87 |
| 263 | 3300005719 | Ga0068861_101189250 | Ga0068861_1011892502 | 87 |
| 264 | 3300005840 | Ga0068870_10891983 | Ga0068870_108919832 | 87 |
| 265 | 3300005841 | Ga0068863_100144372 | Ga0068863_1001443722 | 87 |
| 266 | 3300006353 | Ga0075370_10179720 | Ga0075370_101797202 | 87 |
| 267 | 3300006358 | Ga0068871_101847477 | Ga0068871_1018474772 | 87 |
| 268 | 3300006931 | Ga0097620_100271973 | Ga0097620_1002719732 | 87 |
| 269 | 3300009098 | Ga0105245_11009720 | Ga0105245_110097202 | 87 |
| 270 | 3300009098 | Ga0105245_12701481 | Ga0105245_127014811 | 87 |
| 271 | 3300009101 | Ga0105247_10209671 | Ga0105247_102096713 | 87 |
| 272 | 3300009148 | Ga0105243_10049864 | Ga0105243_100498644 | 87 |
| 273 | 3300009148 | Ga0105243_11102884 | Ga0105243_111028842 | 87 |
| 274 | 3300011119 | Ga0105246_10179816 | Ga0105246_101798163 | 87 |
| 275 | 3300013104 | Ga0157370_11030156 | Ga0157370_110301563 | 87 |
| 276 | 3300014325 | Ga0163163_10219553 | Ga0163163_102195533 | 87 |
| 277 | 3300014968 | Ga0157379_10956242 | Ga0157379_109562422 | 87 |
| 278 | 3300025245 | Ga0207425_1000012 | Ga0207425_1000012412 | 87 |
| 279 | 3300025258 | Ga0209129_1000086 | Ga0209129_1000086129 | 87 |
| 280 | 3300025273 | Ga0209673_1008627 | Ga0209673_10086273 | 87 |
| 281 | 3300025284 | Ga0209130_1004501 | Ga0209130_10045015 | 87 |
| 282 | 3300025294 | Ga0209025_1000024 | Ga0209025_1000024412 | 87 |
| 283 | 3300025297 | Ga0209758_1000046 | Ga0209758_1000046129 | 87 |
| 284 | 3300025303 | Ga0209051_1030564 | Ga0209051_10305642 | 87 |
| 285 | 3300025303 | Ga0209051_1066664 | Ga0209051_10666642 | 87 |
| 286 | 3300025304 | Ga0209257_1057468 | Ga0209257_10574682 | 87 |
| 287 | 3300025893 | Ga0207682_10045991 | Ga0207682_100459913 | 87 |
| 288 | 3300025900 | Ga0207710_10128260 | Ga0207710_101282602 | 87 |
| 289 | 3300025903 | Ga0207680_11083626 | Ga0207680_110836262 | 87 |
| 290 | 3300025925 | Ga0207650_11104890 | Ga0207650_111048902 | 87 |
| 291 | 3300025927 | Ga0207687_10647052 | Ga0207687_106470522 | 87 |
| 292 | 3300025940 | Ga0207691_10052626 | Ga0207691_100526262 | 87 |
| 293 | 3300025945 | Ga0207679_11811728 | Ga0207679_118117282 | 87 |
| 294 | 3300026118 | Ga0207675_100320039 | Ga0207675_1003200393 | 87 |
| 295 | 3300028379 | Ga0268266_11291143 | Ga0268266_112911431 | 87 |
| 296 | 3300038705 | Ga0237819_16744 | Ga0237819_16744_308_586 | 87 |
| 297 | 3300041512 | Ga0451853_2483692 | Ga0451853_2483692_158_436 | 87 |
| 298 | 3300047447 | Ga0495685_136878 | Ga0495685_136878_26_289 | 87 |
| 299 | 3300048903 | Ga0496100_0290432 | Ga0496100_0290432_789_1052 | 87 |
| 300 | 3300048905 | Ga0496102_1478815 | Ga0496102_1478815_182_445 | 87 |
| 301 | 3300048910 | Ga0496107_1147243 | Ga0496107_1147243_134_397 | 87 |
| 302 | 3300048919 | Ga0496116_0020877 | Ga0496116_0020877_1133_1396 | 87 |
| 303 | 3300048919 | Ga0496116_0045304 | Ga0496116_0045304_1895_2158 | 87 |
| 304 | 3300048920 | Ga0496117_0026928 | Ga0496117_0026928_943_1206 | 87 |
| 305 | 3300048921 | Ga0496118_0068364 | Ga0496118_0068364_1450_1713 | 87 |
| 306 | 3300048922 | Ga0496119_0309677 | Ga0496119_0309677_65_328 | 87 |
| 307 | 3300048924 | Ga0496121_0024057 | Ga0496121_0024057_4556_4819 | 87 |
| 308 | 3300048924 | Ga0496121_0081855 | Ga0496121_0081855_1102_1365 | 87 |
| 309 | 3300048924 | Ga0496121_0210404 | Ga0496121_0210404_66_329 | 87 |
| 310 | 3300048924 | Ga0496121_0887436 | Ga0496121_0887436_111_389 | 87 |
| 311 | 3300048925 | Ga0496122_0027609 | Ga0496122_0027609_3562_3825 | 87 |
| 312 | 3300048925 | Ga0496122_0057655 | Ga0496122_0057655_1731_2009 | 87 |
| 313 | 3300048926 | Ga0496123_0005995 | Ga0496123_0005995_981_1244 | 87 |
| 314 | 3300048926 | Ga0496123_0424196 | Ga0496123_0424196_53_331 | 87 |
| 315 | 3300048927 | Ga0496124_0019949 | Ga0496124_0019949_3562_3825 | 87 |
| 316 | 3300048927 | Ga0496124_0040470 | Ga0496124_0040470_1471_1734 | 87 |
| 317 | 3300048928 | Ga0496125_0019563 | Ga0496125_0019563_2208_2471 | 87 |
| 318 | 3300048928 | Ga0496125_0134631 | Ga0496125_0134631_1455_1718 | 87 |
| 319 | 3300048929 | Ga0496126_0202994 | Ga0496126_0202994_1057_1320 | 87 |
| 320 | 3300048929 | Ga0496126_0284634 | Ga0496126_0284634_474_752 | 87 |
| 321 | 3300049571 | Ga0501034_0457405 | Ga0501034_0457405_205_468 | 87 |
| 322 | 3300049572 | Ga0501036_0044841 | Ga0501036_0044841_1329_1592 | 87 |
| 323 | 3300049573 | Ga0501037_0075453 | Ga0501037_0075453_197_460 | 87 |
| 324 | 3300049574 | Ga0501038_0009558 | Ga0501038_0009558_8386_8649 | 87 |
| 325 | 3300049575 | Ga0501039_0121899 | Ga0501039_0121899_367_630 | 87 |
| 326 | 3300049579 | Ga0501043_0095339 | Ga0501043_0095339_206_469 | 87 |
| 327 | 3300049581 | Ga0501047_0124767 | Ga0501047_0124767_2012_2275 | 87 |
| 328 | 3300049586 | Ga0501070_0148773 | Ga0501070_0148773_793_1056 | 87 |
| 329 | 3300049592 | Ga0501076_1017097 | Ga0501076_1017097_74_337 | 87 |
| 330 | 3300049742 | Ga0501080_0115020 | Ga0501080_0115020_907_1170 | 87 |
| 331 | 3300049822 | Ga0501035_0016789 | Ga0501035_0016789_6076_6339 | 87 |
| 332 | 3300049823 | Ga0501044_0031444 | Ga0501044_0031444_2635_2898 | 87 |
| 333 | 3300049824 | Ga0501045_0788382 | Ga0501045_0788382_174_437 | 87 |
| 334 | 3300050496 | nmdc:mga07m45_151375_c1 | nmdc:mga07m45_151375_c1_1040_1303 | 87 |
| 335 | 3300060353 | Ga0501082_0270789 | Ga0501082_0270789_833_1096 | 87 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3u97-assembly1.cif.gz_A | 1.1 angstrom-resolution crystal structure of the brucella abortus ribonuclease toxin, brnt | 0.9449 | 1 | 75 |
| 3u97-assembly1.cif.gz_A | 1.1 angstrom-resolution crystal structure of the brucella abortus ribonuclease toxin, brnt | 0.9099 | 1 | 75 |
| 7vd7-assembly1.cif.gz_A | toxin - antitoxin complex from salmonella enterica serovar typhimurium | 0.7857 | 1 | 82 |
| 2o62-assembly1.cif.gz_A | crystal structure of a protein with unknown function from duf3598 family (npun_r4044) from nostoc punctiforme pcc 73102 at 1.75 a resolution | 0.7477 | 32 | 62 |
| 3hfq-assembly2.cif.gz_B | crystal structure of the lp_2219 protein from lactobacillus plantarum. northeast structural genomics consortium target lpr118. | 0.7371 | 34 | 73 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3u97A00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;Ribonuclease toxin, BrnT, of type II toxin-antitoxin system | 0.9193 | 1 | 75 | 3.10.450.530 |
| 3u97A00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;Ribonuclease toxin, BrnT, of type II toxin-antitoxin system | 0.9076 | 1 | 75 | 3.10.450.530 |
| af_Q9XWI6_325_613_2.120.10.30 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.6891 | 41 | 74 | 2.120.10.30 |
| af_Q960N3_111_453_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.6864 | 34 | 76 | 2.130.10.10 |
| af_Q4G061_490_685_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.681 | 41 | 74 | 2.130.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W5WRB7-F1-model_v4 | deleted | 1.006 | 1 | 87 |
|
| AF-A0A644XWL4-F1-model_v4 | BrnT family toxin | 0.9944 | 1 | 80 |
|
| AF-A0A2N4Y0H8-F1-model_v4 | BrnT family toxin | 0.9917 | 1 | 81 |
|
| AF-A0A530AXP4-F1-model_v4 | BrnT family toxin | 0.991 | 1 | 55 |
|
| AF-K5CZE1-F1-model_v4 | deleted | 0.9906 | 1 | 78 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar