F412064

General Info

Members Datasets Scaffolds Average Seq Length
335 262 245 84

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10093422|rootL2_100934222
Length 92
Sequence VKIVWDEPKRFRNLAKHGLDFRELDLEFFADAVIIDARDRRLKAIGFAIGDILAVVFATLGSEGISIISMRPASRKERKLYEQIQADHSRPH

Samples

Sample ID Description Type Environment
1 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
2 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
3 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
4 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
5 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
6 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
7 2534681786 Brucella suis 92/29 Isolate Unclassified
8 2643221599 Rhizobium sp. Root708 Isolate Unclassified
9 2643221607 Rhizobium sp. Root73 Isolate Unclassified
10 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
11 2643221655 Ensifer sp. Root1252 Isolate Unclassified
12 2643221659 Ensifer sp. Root127 Isolate Unclassified
13 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
14 2643221712 Ensifer sp. Root258 Isolate Unclassified
15 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
16 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
17 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
18 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
19 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
20 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
21 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
22 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
23 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
24 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
25 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
26 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
27 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
28 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
29 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
30 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
31 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
32 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
33 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
34 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
35 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
36 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
37 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
38 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
39 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
40 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
41 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
42 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
43 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
44 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
45 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
46 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
47 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
48 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
49 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
50 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
51 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
52 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
53 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
54 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
55 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
56 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
57 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
58 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
59 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
60 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
61 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
62 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
63 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
64 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
65 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
66 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
67 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
68 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
69 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
70 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
71 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
72 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
73 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
74 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
75 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
76 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
77 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
78 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
79 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
80 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
81 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
82 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
83 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
84 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
85 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
86 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
87 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
88 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
89 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
90 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
91 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
92 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
93 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
94 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
95 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
96 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
97 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
98 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
99 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
100 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
101 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
102 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
103 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
104 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
105 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
106 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
107 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
108 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
109 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
110 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
111 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
112 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
113 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
114 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
115 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
116 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
117 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
118 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
119 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
120 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
121 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
130 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
132 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
133 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
136 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
138 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
139 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
157 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
158 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
159 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
160 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
161 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
162 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
173 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
180 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
181 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
182 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
183 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
184 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
185 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
188 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
189 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
190 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
191 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
192 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
193 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
194 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
195 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
196 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
197 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
198 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
199 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
200 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
201 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
202 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
203 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
212 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
213 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
214 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
215 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
216 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
217 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
218 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
219 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
220 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
221 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
222 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
234 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
235 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
236 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
237 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
238 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
239 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
240 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
241 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
242 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
243 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
246 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
247 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
248 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
249 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
250 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
251 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
252 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
253 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
254 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
255 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
256 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
257 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
258 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
259 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
260 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
261 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
262 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 72.84
Metatranscriptomes 0.3
Isolates 26.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.04
Nodule 20
Rhizoplane 2.69
Rhizosphere 48.36
Stem 0
Stem Tuber 0
Unclassified 17.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25150J39212_1000042 3300002774 Bacteria 84513
2 JGI25151J46595_10000565 3300003187 Bacteria 33453
3 JGI25153J46596_10005251 3300003215 Bacteria 6811
4 rootL2_10093422 3300003322 Bacteria 2548
5 rootH1_10056936 3300003323 Bacteria 1893
6 Ga0006562J51391_1031567 3300003578 Bacteria 2970
7 Ga0055529_1018028 3300003763 Bacteria 884
8 Ga0055536_1076202 3300003781 Bacteria 647
9 Ga0065165_1014490 3300005262 Bacteria 3059
10 Ga0070658_10822065 3300005327 Bacteria 807
11 Ga0070666_10599792 3300005335 Bacteria 803
12 Ga0070689_100562229 3300005340 Bacteria 984
13 Ga0070668_100183045 3300005347 Bacteria 1712
14 Ga0070668_101392044 3300005347 Bacteria 639
15 Ga0070663_100679331 3300005455 Bacteria 873
16 Ga0070678_100082195 3300005456 Bacteria 2445
17 Ga0070678_101331159 3300005456 Bacteria 669
18 Ga0070672_100091894 3300005543 Bacteria 2449
19 Ga0070665_100115199 3300005548 Bacteria 2690
20 Ga0070665_100583624 3300005548 Bacteria 1131
21 Ga0068857_100574606 3300005577 Bacteria 1063
22 Ga0070702_101533510 3300005615 Bacteria 549
23 Ga0068859_100271991 3300005617 Bacteria 1786
24 Ga0068861_101189250 3300005719 Bacteria 737
25 Ga0068870_10891983 3300005840 Unclassified 627
26 Ga0068870_11314141 3300005840 Bacteria 527
27 Ga0068863_100144372 3300005841 Bacteria 2276
28 Ga0081540_1059351 3300005983 Bacteria 1837
29 Ga0081539_10000051 3300005985 Bacteria 268337
30 Ga0081539_10415182 3300005985 Bacteria 559
31 Ga0075367_10274209 3300006178 Bacteria 1060
32 Ga0075370_10179720 3300006353 Bacteria 1245
33 Ga0068871_101847477 3300006358 Bacteria 574
34 Ga0097620_100271973 3300006931 Bacteria 1786
35 Ga0105245_11009720 3300009098 Bacteria 876
36 Ga0105245_12701481 3300009098 Bacteria 549
37 Ga0105247_10209671 3300009101 Bacteria 1314
38 Ga0105247_11823800 3300009101 Bacteria 507
39 Ga0105243_10049864 3300009148 Bacteria 3305
40 Ga0105243_11102884 3300009148 Bacteria 802
41 Ga0105242_10518063 3300009176 Bacteria 1137
42 Ga0105238_11108521 3300009551 Bacteria 814
43 Ga0105238_11518779 3300009551 Bacteria 699
44 Ga0105246_10179816 3300011119 Bacteria 1627
45 Ga0157370_11030156 3300013104 Bacteria 745
46 Ga0157378_10639166 3300013297 Bacteria 1079
47 Ga0157378_11774255 3300013297 Bacteria 665
48 Ga0163163_10219553 3300014325 Bacteria 1950
49 Ga0157380_10496643 3300014326 Bacteria 1184
50 Ga0157380_11508052 3300014326 Bacteria 726
51 Ga0157379_10956242 3300014968 Bacteria 815
52 Ga0207425_1000012 3300025245 Bacteria 528324
53 Ga0209148_1000505 3300025254 Bacteria 39613
54 Ga0209129_1000086 3300025258 Bacteria 181543
55 Ga0209233_1019048 3300025261 Bacteria 1832
56 Ga0209455_1003223 3300025272 Bacteria 5893
57 Ga0209673_1008627 3300025273 Bacteria 4517
58 Ga0209130_1004501 3300025284 Bacteria 5262
59 Ga0209676_1074220 3300025292 Bacteria 797
60 Ga0209025_1000024 3300025294 Bacteria 528324
61 Ga0209758_1000046 3300025297 Bacteria 364931
62 Ga0209051_1030564 3300025303 Bacteria 2088
63 Ga0209051_1066664 3300025303 Bacteria 1105
64 Ga0209257_1057468 3300025304 Bacteria 1070
65 Ga0207682_10045991 3300025893 Bacteria 1793
66 Ga0207710_10128260 3300025900 Bacteria 1217
67 Ga0207680_11083626 3300025903 Bacteria 573
68 Ga0207649_10922084 3300025920 Bacteria 685
69 Ga0207650_11104890 3300025925 Bacteria 675
70 Ga0207687_10284828 3300025927 Bacteria 1326
71 Ga0207687_10647052 3300025927 Bacteria 894
72 Ga0207691_10052626 3300025940 Bacteria 3719
73 Ga0207679_11811728 3300025945 Unclassified 558
74 Ga0207639_11261323 3300026041 Unclassified 694
75 Ga0207678_10233349 3300026067 Bacteria 1575
76 Ga0207648_11732906 3300026089 Bacteria 586
77 Ga0207675_100320039 3300026118 Bacteria 1514
78 Ga0207683_10088057 3300026121 Bacteria 2762
79 Ga0207683_12148635 3300026121 Bacteria 506
80 Ga0209281_1007626 3300027111 Bacteria 2702
81 Ga0268266_10028526 3300028379 Bacteria 4743
82 Ga0268266_11291143 3300028379 Bacteria 705
83 Ga0268266_11409121 3300028379 Bacteria 672
84 Ga0307515_10205505 3300028794 Bacteria 1831
85 Ga0265330_10018135 3300031235 Bacteria 3236
86 Ga0265325_10276151 3300031241 Bacteria 754
87 Ga0265325_10387825 3300031241 Bacteria 613
88 Ga0265316_11243817 3300031344 Bacteria 515
89 Ga0265342_10393103 3300031712 Bacteria 717
90 Ga0307516_10656910 3300031730 Bacteria 704
91 Ga0307405_10147509 3300031731 Bacteria 1650
92 Ga0307405_10555753 3300031731 Bacteria 930
93 Ga0307413_10832481 3300031824 Bacteria 778
94 Ga0307410_10523282 3300031852 Bacteria 979
95 Ga0307410_11176055 3300031852 Bacteria 667
96 Ga0307406_11161086 3300031901 Bacteria 669
97 Ga0307407_10092835 3300031903 Bacteria 1855
98 Ga0307412_10924045 3300031911 Bacteria 766
99 Ga0307416_100378371 3300032002 Bacteria 1445
100 Ga0307416_102711186 3300032002 Unclassified 592
101 Ga0307414_11980589 3300032004 Bacteria 544
102 Ga0307411_10457251 3300032005 Bacteria 1069
103 Ga0307415_100414165 3300032126 Bacteria 1154
104 Ga0373929_0065506 3300035085 Bacteria 859
105 Ga0373936_0030662 3300035113 Bacteria 2121
106 Ga0373937_0165696 3300036401 Bacteria 2072
107 Ga0395905_0026234 3300037471 Bacteria 5494
108 Ga0395905_0035438 3300037471 Bacteria 4686
109 Ga0436364_0101778 3300037853 Bacteria 1608
110 Ga0237819_16744 3300038705 Bacteria 820
111 Ga0436365_0584183 3300039437 Bacteria 699
112 Ga0436360_0290965 3300039438 Bacteria 706
113 Ga0436361_0533849 3300039447 Unclassified 672
114 Ga0436363_1540848 3300039450 Unclassified 645
115 Ga0451853_2483692 3300041512 Bacteria 817
116 Ga0439449_0103657 3300042007 Bacteria 1052
117 Ga0466972_0000200 3300044658 Bacteria 43953
118 Ga0466970_0133668 3300044765 Bacteria 1364
119 Ga0466967_0280029 3300045976 Bacteria 1600
120 Ga0495629_0009469 3300046459 Bacteria 7124
121 Ga0495653_0514427 3300046463 Bacteria 745
122 Ga0495608_0037660 3300046511 Bacteria 3252
123 Ga0495628_0413532 3300046516 Bacteria 984
124 Ga0495665_0319075 3300046531 Bacteria 794
125 Ga0495640_0049262 3300046533 Bacteria 2906
126 Ga0495622_0081307 3300046557 Bacteria 1490
127 Ga0495635_0008380 3300046663 Bacteria 7215
128 Ga0495657_0020494 3300046675 Bacteria 4752
129 Ga0495600_0097965 3300046809 Bacteria 1911
130 Ga0495604_0002639 3300047317 Bacteria 14394
131 Ga0495676_0365124 3300047321 Bacteria 963
132 Ga0495680_0468333 3300047322 Bacteria 860
133 Ga0495685_136878 3300047447 Unclassified 799
134 Ga0495684_1091688 3300047471 Bacteria 501
135 Ga0495602_0019615 3300048088 Bacteria 6709
136 Ga0495602_0578794 3300048088 Bacteria 775
137 Ga0496100_0290432 3300048903 Bacteria 1222
138 Ga0496102_0643569 3300048905 Bacteria 983
139 Ga0496102_1478815 3300048905 Bacteria 598
140 Ga0496104_0005151 3300048907 Bacteria 11419
141 Ga0496105_0010064 3300048908 Bacteria 7421
142 Ga0496107_1147243 3300048910 Bacteria 560
143 Ga0496112_1190100 3300048915 Bacteria 679
144 Ga0496113_1006021 3300048916 Bacteria 656
145 Ga0496114_0158126 3300048917 Bacteria 1969
146 Ga0496116_0020877 3300048919 Bacteria 4957
147 Ga0496116_0045304 3300048919 Bacteria 2978
148 Ga0496117_0026928 3300048920 Bacteria 4489
149 Ga0496118_0068364 3300048921 Bacteria 2580
150 Ga0496119_0002144 3300048922 Bacteria 22179
151 Ga0496119_0309677 3300048922 Bacteria 776
152 Ga0496120_0011576 3300048923 Bacteria 6059
153 Ga0496120_0040958 3300048923 Bacteria 2718
154 Ga0496121_0024057 3300048924 Bacteria 5836
155 Ga0496121_0027091 3300048924 Bacteria 5374
156 Ga0496121_0081855 3300048924 Bacteria 2554
157 Ga0496121_0210404 3300048924 Bacteria 1378
158 Ga0496121_0887436 3300048924 Bacteria 514
159 Ga0496122_0027609 3300048925 Bacteria 4845
160 Ga0496122_0057655 3300048925 Bacteria 2882
161 Ga0496123_0005995 3300048926 Bacteria 11950
162 Ga0496123_0127029 3300048926 Bacteria 1421
163 Ga0496123_0424196 3300048926 Bacteria 599
164 Ga0496124_0019949 3300048927 Bacteria 6216
165 Ga0496124_0040470 3300048927 Bacteria 4030
166 Ga0496124_0122792 3300048927 Bacteria 2073
167 Ga0496124_0556279 3300048927 Bacteria 756
168 Ga0496125_0000634 3300048928 Bacteria 58798
169 Ga0496125_0019563 3300048928 Bacteria 6380
170 Ga0496125_0134631 3300048928 Bacteria 1731
171 Ga0496125_0146642 3300048928 Bacteria 1630
172 Ga0496126_0044722 3300048929 Bacteria 4075
173 Ga0496126_0202994 3300048929 Bacteria 1673
174 Ga0496126_0284634 3300048929 Bacteria 1368
175 Ga0496126_1006006 3300048929 Bacteria 625
176 Ga0501031_0000036 3300049568 Bacteria 73760
177 Ga0501031_0012514 3300049568 Bacteria 5539
178 Ga0501032_0000100 3300049569 Bacteria 73505
179 Ga0501032_0005055 3300049569 Bacteria 9860
180 Ga0501033_0000088 3300049570 Bacteria 87638
181 Ga0501033_0000500 3300049570 Bacteria 36912
182 Ga0501033_1069991 3300049570 Unclassified 537
183 Ga0501034_0000397 3300049571 Bacteria 73511
184 Ga0501034_0200551 3300049571 Bacteria 1954
185 Ga0501034_0457405 3300049571 Bacteria 1193
186 Ga0501036_0000056 3300049572 Bacteria 73511
187 Ga0501036_0044841 3300049572 Bacteria 3746
188 Ga0501036_0309323 3300049572 Bacteria 1321
189 Ga0501037_0000119 3300049573 Bacteria 73510
190 Ga0501037_0000742 3300049573 Bacteria 24738
191 Ga0501037_0075453 3300049573 Bacteria 2448
192 Ga0501038_0000098 3300049574 Bacteria 73471
193 Ga0501038_0009558 3300049574 Bacteria 8896
194 Ga0501038_0152233 3300049574 Bacteria 1885
195 Ga0501039_0000013 3300049575 Bacteria 234418
196 Ga0501039_0121899 3300049575 Bacteria 2044
197 Ga0501039_1280178 3300049575 Unclassified 566
198 Ga0501043_0000022 3300049579 Bacteria 154467
199 Ga0501043_0004996 3300049579 Bacteria 10731
200 Ga0501043_0095339 3300049579 Bacteria 2338
201 Ga0501046_0296985 3300049580 Bacteria 1181
202 Ga0501047_0039087 3300049581 Bacteria 4590
203 Ga0501047_0124767 3300049581 Bacteria 2455
204 Ga0501047_0423603 3300049581 Bacteria 1162
205 Ga0501067_0160483 3300049583 Bacteria 1252
206 Ga0501068_0038478 3300049584 Bacteria 2866
207 Ga0501069_0000012 3300049585 Bacteria 148453
208 Ga0501070_0000103 3300049586 Bacteria 74597
209 Ga0501070_0054296 3300049586 Bacteria 3323
210 Ga0501070_0056386 3300049586 Bacteria 3257
211 Ga0501070_0148773 3300049586 Bacteria 1932
212 Ga0501071_0062113 3300049587 Bacteria 2706
213 Ga0501073_0030752 3300049589 Bacteria 3833
214 Ga0501073_0336718 3300049589 Bacteria 1042
215 Ga0501074_0000021 3300049590 Bacteria 71950
216 Ga0501076_1017097 3300049592 Unclassified 683
217 Ga0501076_1559965 3300049592 Unclassified 542
218 Ga0501080_0001356 3300049742 Bacteria 20452
219 Ga0501080_0115020 3300049742 Bacteria 2494
220 Ga0501083_0012886 3300049744 Bacteria 5847
221 Ga0501035_0000039 3300049822 Bacteria 156824
222 Ga0501035_0000053 3300049822 Bacteria 142860
223 Ga0501035_0016789 3300049822 Bacteria 6749
224 Ga0501044_0000047 3300049823 Bacteria 146449
225 Ga0501044_0000214 3300049823 Bacteria 73483
226 Ga0501044_0031444 3300049823 Bacteria 5587
227 Ga0501045_0788382 3300049824 Unclassified 700
228 nmdc:mga07m45_151375_c1 3300050496 Bacteria 1345
229 Ga0500578_0350299 3300053086 Bacteria 863
230 Ga0500646_0097299 3300053090 Unclassified 919
231 Ga0500651_0088703 3300053093 Bacteria 1907
232 Ga0500651_0352101 3300053093 Bacteria 835
233 Ga0500555_163633 3300053103 Bacteria 542
234 Ga0500569_009544 3300053109 Bacteria 2259
235 Ga0500655_057003 3300053133 Bacteria 783
236 Ga0500658_0207229 3300053134 Bacteria 897
237 Ga0500559_0160909 3300053136 Bacteria 1055
238 Ga0500616_0000104 3300053153 Bacteria 159954
239 Ga0500638_225690 3300053162 Bacteria 773
240 Ga0500636_0277777 3300053177 Bacteria 838
241 Ga0500645_006745 3300053730 Bacteria 4067
242 Ga0500645_092674 3300053730 Bacteria 856
243 Ga0500609_061693 3300053731 Bacteria 524
244 Ga0501082_0013345 3300060353 Bacteria 7066
245 Ga0501082_0270789 3300060353 Unclassified 1478

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2534681786 2535484705 76
2 iso_pu_bacteria 2891373044 2891377083 76
3 iso_pu_bacteria 2510065057 2510303413 77
4 iso_pu_bacteria 2510917026 2511171546 77
5 iso_pu_bacteria 2513237091 2513616078 77
6 iso_pu_bacteria 2513237140 2513884720 77
7 iso_pu_bacteria 2513237143 2513905115 77
8 iso_pu_bacteria 2515154107 2515613521 77
9 iso_pu_bacteria 2643221655 2644312690 77
10 iso_pu_bacteria 2643221659 2644336747 77
11 iso_pu_bacteria 2643221712 2644618421 77
12 iso_pu_bacteria 2855825444 2855827976 77
13 iso_pu_bacteria 2855839649 2855839749 77
14 iso_pu_bacteria 2858800743 2858803626 77
15 iso_pu_bacteria 2915986958 2915988694 77
16 iso_pu_bacteria 2915993759 2915997243 77
17 iso_pu_bacteria 2916028427 2916031492 77
18 iso_pu_bacteria 2916041962 2916045085 77
19 iso_pu_bacteria 2916048683 2916053581 77
20 iso_pu_bacteria 2916055098 2916057043 77
21 iso_pu_bacteria 2916076590 2916079744 77
22 iso_pu_bacteria 2921201388 2921207510 77
23 iso_pu_bacteria 2921263974 2921268789 77
24 iso_pu_bacteria 2921296804 2921297170 77
25 iso_pu_bacteria 2924150972 2924154300 77
26 iso_pu_bacteria 2924158325 2924164670 77
27 iso_pu_bacteria 2924172951 2924173734 77
28 iso_pu_bacteria 2937042894 2937047419 77
29 iso_pu_bacteria 2937049772 2937053290 77
30 iso_pu_bacteria 2937056579 2937060812 77
31 iso_pu_bacteria 2937063883 2937066802 77
32 iso_pu_bacteria 2937091812 2937098714 77
33 iso_pu_bacteria 2937098957 2937102775 77
34 iso_pu_bacteria 2937106411 2937106489 77
35 iso_pu_bacteria 2941499720 2941506355 77
36 iso_pu_bacteria 2957443900 2957447371 77
37 iso_pu_bacteria 2957478035 2957481906 77
38 iso_pu_bacteria 2960610863 2960611649 77
39 iso_pu_bacteria 2960617483 2960620101 77
40 iso_pu_bacteria 2960624210 2960626696 77
41 iso_pu_bacteria 2960652885 2960654402 77
42 iso_pu_bacteria 2960660292 2960660655 77
43 iso_pu_bacteria 2960687367 2960687428 77
44 iso_pu_bacteria 2964607997 2964613444 77
45 iso_pu_bacteria 2964649959 2964650088 77
46 iso_pu_bacteria 2964656573 2964661648 77
47 iso_pu_bacteria 2967664464 2967667486 77
48 iso_pu_bacteria 2967678726 2967682567 77
49 iso_pu_bacteria 2967714385 2967714421 77
50 iso_pu_bacteria 2967721400 2967723745 77
51 iso_pu_bacteria 2967735183 2967739171 77
52 iso_pu_bacteria 2967762386 2967768926 77
53 iso_pu_bacteria 2967775926 2967780074 77
54 iso_pu_bacteria 2970019648 2970021260 77
55 iso_pu_bacteria 2970033650 2970037454 77
56 iso_pu_bacteria 2970040964 2970041037 77
57 iso_pu_bacteria 2970047711 2970054010 77
58 iso_pu_bacteria 2970068827 2970074610 77
59 iso_pu_bacteria 2970082768 2970088112 77
60 iso_pu_bacteria 2970116247 2970118185 77
61 iso_pu_bacteria 2970177841 2970183581 77
62 iso_pu_bacteria 2970184632 2970188770 77
63 iso_pu_bacteria 2977516862 2977521037 77
64 iso_pu_bacteria 2977551784 2977554744 77
65 iso_pu_bacteria 2977579622 2977584361 77
66 iso_pu_bacteria 8003992118 8003992204 77
67 iso_pu_bacteria 8054563764 8054566402 77
68 3300006178 Ga0075367_10274209 Ga0075367_102742093 79
69 3300005327 Ga0070658_10822065 Ga0070658_108220652 80
70 3300005455 Ga0070663_100679331 Ga0070663_1006793311 80
71 3300026067 Ga0207678_10233349 Ga0207678_102333493 80
72 3300039438 Ga0436360_0290965 Ga0436360_0290965_344_592 80
73 3300039447 Ga0436361_0533849 Ga0436361_0533849_373_621 80
74 3300049570 Ga0501033_1069991 Ga0501033_1069991_154_399 80
75 iso_pu_bacteria 2643221607 2644050979 80
76 iso_pu_bacteria 2643221636 2644205482 80
77 iso_pu_bacteria 2643221686 2644483883 80
78 iso_pu_bacteria 2937813078 2937813107 80
79 3300027111 Ga0209281_1007626 Ga0209281_10076264 81
80 3300031731 Ga0307405_10555753 Ga0307405_105557532 81
81 3300031852 Ga0307410_11176055 Ga0307410_111760552 81
82 3300031901 Ga0307406_11161086 Ga0307406_111610861 81
83 3300031911 Ga0307412_10924045 Ga0307412_109240451 81
84 3300032004 Ga0307414_11980589 Ga0307414_119805891 81
85 3300037471 Ga0395905_0026234 Ga0395905_0026234_3460_3708 81
86 3300042007 Ga0439449_0103657 Ga0439449_0103657_326_571 81
87 3300045976 Ga0466967_0280029 Ga0466967_0280029_587_832 81
88 3300048926 Ga0496123_0127029 Ga0496123_0127029_310_558 81
89 3300048928 Ga0496125_0000634 Ga0496125_0000634_17997_18245 81
90 3300049568 Ga0501031_0012514 Ga0501031_0012514_4193_4441 81
91 3300049569 Ga0501032_0005055 Ga0501032_0005055_8350_8598 81
92 3300049570 Ga0501033_0000500 Ga0501033_0000500_19957_20205 81
93 3300049571 Ga0501034_0200551 Ga0501034_0200551_1014_1262 81
94 3300049572 Ga0501036_0309323 Ga0501036_0309323_656_904 81
95 3300049573 Ga0501037_0000742 Ga0501037_0000742_12590_12838 81
96 3300049574 Ga0501038_0152233 Ga0501038_0152233_1323_1571 81
97 3300049575 Ga0501039_1280178 Ga0501039_1280178_82_330 81
98 3300049579 Ga0501043_0000022 Ga0501043_0000022_120428_120676 81
99 3300049581 Ga0501047_0423603 Ga0501047_0423603_262_510 81
100 3300049583 Ga0501067_0160483 Ga0501067_0160483_894_1142 81
101 3300049584 Ga0501068_0038478 Ga0501068_0038478_751_999 81
102 3300049585 Ga0501069_0000012 Ga0501069_0000012_139012_139260 81
103 3300049586 Ga0501070_0000103 Ga0501070_0000103_67185_67433 81
104 3300049587 Ga0501071_0062113 Ga0501071_0062113_404_652 81
105 3300049589 Ga0501073_0030752 Ga0501073_0030752_1270_1518 81
106 3300049589 Ga0501073_0336718 Ga0501073_0336718_152_400 81
107 3300049590 Ga0501074_0000021 Ga0501074_0000021_62712_62960 81
108 3300049592 Ga0501076_1559965 Ga0501076_1559965_100_348 81
109 3300049742 Ga0501080_0001356 Ga0501080_0001356_16875_17123 81
110 3300049744 Ga0501083_0012886 Ga0501083_0012886_4726_4974 81
111 3300049822 Ga0501035_0000039 Ga0501035_0000039_17481_17729 81
112 3300049823 Ga0501044_0000047 Ga0501044_0000047_139175_139423 81
113 3300053153 Ga0500616_0000104 Ga0500616_0000104_84805_85071 81
114 3300060353 Ga0501082_0013345 Ga0501082_0013345_5293_5541 81
115 iso_pu_bacteria 2857349434 2857355279 81
116 iso_pu_bacteria 2871444079 2871447455 81
117 iso_pu_bacteria 2922158528 2922160399 81
118 iso_pu_bacteria 2924726620 2924729470 81
119 iso_pu_bacteria 2968128360 2968132898 81
120 iso_pu_bacteria 2977942078 2977948825 81
121 iso_pu_bacteria 2987636660 2987640412 81
122 iso_pu_bacteria 2996341866 2996343630 81
123 iso_pu_bacteria 3004203850 3004208610 81
124 3300035113 Ga0373936_0030662 Ga0373936_0030662_184_432 82
125 3300039450 Ga0436363_1540848 Ga0436363_1540848_261_509 82
126 3300053730 Ga0500645_092674 Ga0500645_092674_588_839 82
127 iso_pu_bacteria 2824679649 2824683015 82
128 iso_pu_bacteria 2824704595 2824714565 82
129 iso_pu_bacteria 2824753945 2824755592 82
130 iso_pu_bacteria 2824763712 2824766255 82
131 iso_pu_bacteria 2904711408 2904712106 82
132 iso_pu_bacteria 2906602504 2906609769 82
133 iso_pu_bacteria 3005483717 3005484917 82
134 3300003781 Ga0055536_1076202 Ga0055536_10762022 83
135 3300005347 Ga0070668_101392044 Ga0070668_1013920441 83
136 3300005456 Ga0070678_100082195 Ga0070678_1000821953 83
137 3300005983 Ga0081540_1059351 Ga0081540_10593512 83
138 3300005985 Ga0081539_10000051 Ga0081539_10000051163 83
139 3300009101 Ga0105247_11823800 Ga0105247_118238002 83
140 3300009176 Ga0105242_10518063 Ga0105242_105180633 83
141 3300009551 Ga0105238_11518779 Ga0105238_115187792 83
142 3300013297 Ga0157378_10639166 Ga0157378_106391662 83
143 3300014326 Ga0157380_11508052 Ga0157380_115080522 83
144 3300025292 Ga0209676_1074220 Ga0209676_10742201 83
145 3300026121 Ga0207683_10088057 Ga0207683_100880572 83
146 3300031730 Ga0307516_10656910 Ga0307516_106569102 83
147 3300031731 Ga0307405_10147509 Ga0307405_101475093 83
148 3300031824 Ga0307413_10832481 Ga0307413_108324811 83
149 3300031852 Ga0307410_10523282 Ga0307410_105232823 83
150 3300031903 Ga0307407_10092835 Ga0307407_100928353 83
151 3300032002 Ga0307416_100378371 Ga0307416_1003783713 83
152 3300032005 Ga0307411_10457251 Ga0307411_104572513 83
153 3300032126 Ga0307415_100414165 Ga0307415_1004141653 83
154 3300036401 Ga0373937_0165696 Ga0373937_0165696_1463_1729 83
155 3300048088 Ga0495602_0578794 Ga0495602_0578794_270_536 83
156 3300048923 Ga0496120_0040958 Ga0496120_0040958_229_480 83
157 3300048927 Ga0496124_0122792 Ga0496124_0122792_833_1087 83
158 3300048928 Ga0496125_0146642 Ga0496125_0146642_477_731 83
159 3300049568 Ga0501031_0000036 Ga0501031_0000036_8927_9181 83
160 3300049569 Ga0501032_0000100 Ga0501032_0000100_64624_64878 83
161 3300049570 Ga0501033_0000088 Ga0501033_0000088_8628_8882 83
162 3300049571 Ga0501034_0000397 Ga0501034_0000397_64630_64884 83
163 3300049572 Ga0501036_0000056 Ga0501036_0000056_64630_64884 83
164 3300049573 Ga0501037_0000119 Ga0501037_0000119_64629_64883 83
165 3300049574 Ga0501038_0000098 Ga0501038_0000098_64603_64857 83
166 3300049575 Ga0501039_0000013 Ga0501039_0000013_8628_8882 83
167 3300049579 Ga0501043_0004996 Ga0501043_0004996_1878_2132 83
168 3300049580 Ga0501046_0296985 Ga0501046_0296985_764_1018 83
169 3300049581 Ga0501047_0039087 Ga0501047_0039087_1861_2115 83
170 3300049586 Ga0501070_0054296 Ga0501070_0054296_829_1083 83
171 3300049586 Ga0501070_0056386 Ga0501070_0056386_2822_3076 83
172 3300049822 Ga0501035_0000053 Ga0501035_0000053_133979_134233 83
173 3300049823 Ga0501044_0000214 Ga0501044_0000214_8628_8882 83
174 3300053136 Ga0500559_0160909 Ga0500559_0160909_46_297 83
175 iso_pu_bacteria 2643221599 2644007422 83
176 iso_pu_bacteria 3005409236 3005411302 83
177 iso_pu_bacteria 3005452660 3005452909 83
178 3300013297 Ga0157378_11774255 Ga0157378_117742551 84
179 3300025920 Ga0207649_10922084 Ga0207649_109220842 84
180 3300025927 Ga0207687_10284828 Ga0207687_102848283 84
181 3300026041 Ga0207639_11261323 Ga0207639_112613232 84
182 3300031235 Ga0265330_10018135 Ga0265330_100181353 84
183 3300031241 Ga0265325_10276151 Ga0265325_102761512 84
184 3300031241 Ga0265325_10387825 Ga0265325_103878252 84
185 3300031344 Ga0265316_11243817 Ga0265316_112438171 84
186 3300031712 Ga0265342_10393103 Ga0265342_103931032 84
187 3300032002 Ga0307416_102711186 Ga0307416_1027111861 84
188 3300035085 Ga0373929_0065506 Ga0373929_0065506_567_821 84
189 3300005985 Ga0081539_10415182 Ga0081539_104151822 85
190 3300037471 Ga0395905_0035438 Ga0395905_0035438_3201_3458 85
191 3300003763 Ga0055529_1018028 Ga0055529_10180282 86
192 3300005335 Ga0070666_10599792 Ga0070666_105997921 86
193 3300005347 Ga0070668_100183045 Ga0070668_1001830453 86
194 3300005456 Ga0070678_101331159 Ga0070678_1013311591 86
195 3300005548 Ga0070665_100115199 Ga0070665_1001151994 86
196 3300005548 Ga0070665_100583624 Ga0070665_1005836243 86
197 3300005615 Ga0070702_101533510 Ga0070702_1015335101 86
198 3300005840 Ga0068870_11314141 Ga0068870_113141412 86
199 3300009551 Ga0105238_11108521 Ga0105238_111085212 86
200 3300014326 Ga0157380_10496643 Ga0157380_104966433 86
201 3300025254 Ga0209148_1000505 Ga0209148_100050526 86
202 3300025261 Ga0209233_1019048 Ga0209233_10190483 86
203 3300025272 Ga0209455_1003223 Ga0209455_10032232 86
204 3300026089 Ga0207648_11732906 Ga0207648_117329062 86
205 3300026121 Ga0207683_12148635 Ga0207683_121486352 86
206 3300028379 Ga0268266_10028526 Ga0268266_100285263 86
207 3300028379 Ga0268266_11409121 Ga0268266_114091212 86
208 3300028794 Ga0307515_10205505 Ga0307515_102055053 86
209 3300037853 Ga0436364_0101778 Ga0436364_0101778_394_654 86
210 3300039437 Ga0436365_0584183 Ga0436365_0584183_243_503 86
211 3300044658 Ga0466972_0000200 Ga0466972_0000200_28817_29077 86
212 3300044765 Ga0466970_0133668 Ga0466970_0133668_493_753 86
213 3300046459 Ga0495629_0009469 Ga0495629_0009469_6013_6273 86
214 3300046463 Ga0495653_0514427 Ga0495653_0514427_435_695 86
215 3300046511 Ga0495608_0037660 Ga0495608_0037660_1322_1582 86
216 3300046516 Ga0495628_0413532 Ga0495628_0413532_542_802 86
217 3300046531 Ga0495665_0319075 Ga0495665_0319075_492_752 86
218 3300046533 Ga0495640_0049262 Ga0495640_0049262_739_999 86
219 3300046557 Ga0495622_0081307 Ga0495622_0081307_250_510 86
220 3300046663 Ga0495635_0008380 Ga0495635_0008380_3024_3284 86
221 3300046675 Ga0495657_0020494 Ga0495657_0020494_3874_4134 86
222 3300046809 Ga0495600_0097965 Ga0495600_0097965_1450_1710 86
223 3300047317 Ga0495604_0002639 Ga0495604_0002639_9091_9351 86
224 3300047321 Ga0495676_0365124 Ga0495676_0365124_470_730 86
225 3300047322 Ga0495680_0468333 Ga0495680_0468333_82_342 86
226 3300047471 Ga0495684_1091688 Ga0495684_1091688_21_281 86
227 3300048088 Ga0495602_0019615 Ga0495602_0019615_6123_6383 86
228 3300048905 Ga0496102_0643569 Ga0496102_0643569_124_384 86
229 3300048907 Ga0496104_0005151 Ga0496104_0005151_5404_5664 86
230 3300048908 Ga0496105_0010064 Ga0496105_0010064_5373_5633 86
231 3300048915 Ga0496112_1190100 Ga0496112_1190100_293_553 86
232 3300048916 Ga0496113_1006021 Ga0496113_1006021_72_332 86
233 3300048917 Ga0496114_0158126 Ga0496114_0158126_214_474 86
234 3300048922 Ga0496119_0002144 Ga0496119_0002144_3685_3945 86
235 3300048923 Ga0496120_0011576 Ga0496120_0011576_885_1145 86
236 3300048924 Ga0496121_0027091 Ga0496121_0027091_1534_1794 86
237 3300048927 Ga0496124_0556279 Ga0496124_0556279_444_704 86
238 3300048929 Ga0496126_0044722 Ga0496126_0044722_57_317 86
239 3300048929 Ga0496126_1006006 Ga0496126_1006006_148_408 86
240 3300053086 Ga0500578_0350299 Ga0500578_0350299_51_311 86
241 3300053090 Ga0500646_0097299 Ga0500646_0097299_210_470 86
242 3300053093 Ga0500651_0088703 Ga0500651_0088703_470_730 86
243 3300053093 Ga0500651_0352101 Ga0500651_0352101_255_515 86
244 3300053103 Ga0500555_163633 Ga0500555_163633_101_361 86
245 3300053109 Ga0500569_009544 Ga0500569_009544_1822_2082 86
246 3300053133 Ga0500655_057003 Ga0500655_057003_213_473 86
247 3300053134 Ga0500658_0207229 Ga0500658_0207229_317_577 86
248 3300053162 Ga0500638_225690 Ga0500638_225690_245_505 86
249 3300053177 Ga0500636_0277777 Ga0500636_0277777_422_682 86
250 3300053730 Ga0500645_006745 Ga0500645_006745_2903_3163 86
251 3300053731 Ga0500609_061693 Ga0500609_061693_32_292 86
252 3300002774 JGI25150J39212_1000042 JGI25150J39212_100004286 87
253 3300003187 JGI25151J46595_10000565 JGI25151J46595_1000056528 87
254 3300003215 JGI25153J46596_10005251 JGI25153J46596_100052518 87
255 3300003322 rootL2_10093422 rootL2_100934222 87
256 3300003323 rootH1_10056936 rootH1_100569361 87
257 3300003578 Ga0006562J51391_1031567 Ga0006562J51391_10315673 87
258 3300005262 Ga0065165_1014490 Ga0065165_10144901 87
259 3300005340 Ga0070689_100562229 Ga0070689_1005622292 87
260 3300005543 Ga0070672_100091894 Ga0070672_1000918943 87
261 3300005577 Ga0068857_100574606 Ga0068857_1005746063 87
262 3300005617 Ga0068859_100271991 Ga0068859_1002719912 87
263 3300005719 Ga0068861_101189250 Ga0068861_1011892502 87
264 3300005840 Ga0068870_10891983 Ga0068870_108919832 87
265 3300005841 Ga0068863_100144372 Ga0068863_1001443722 87
266 3300006353 Ga0075370_10179720 Ga0075370_101797202 87
267 3300006358 Ga0068871_101847477 Ga0068871_1018474772 87
268 3300006931 Ga0097620_100271973 Ga0097620_1002719732 87
269 3300009098 Ga0105245_11009720 Ga0105245_110097202 87
270 3300009098 Ga0105245_12701481 Ga0105245_127014811 87
271 3300009101 Ga0105247_10209671 Ga0105247_102096713 87
272 3300009148 Ga0105243_10049864 Ga0105243_100498644 87
273 3300009148 Ga0105243_11102884 Ga0105243_111028842 87
274 3300011119 Ga0105246_10179816 Ga0105246_101798163 87
275 3300013104 Ga0157370_11030156 Ga0157370_110301563 87
276 3300014325 Ga0163163_10219553 Ga0163163_102195533 87
277 3300014968 Ga0157379_10956242 Ga0157379_109562422 87
278 3300025245 Ga0207425_1000012 Ga0207425_1000012412 87
279 3300025258 Ga0209129_1000086 Ga0209129_1000086129 87
280 3300025273 Ga0209673_1008627 Ga0209673_10086273 87
281 3300025284 Ga0209130_1004501 Ga0209130_10045015 87
282 3300025294 Ga0209025_1000024 Ga0209025_1000024412 87
283 3300025297 Ga0209758_1000046 Ga0209758_1000046129 87
284 3300025303 Ga0209051_1030564 Ga0209051_10305642 87
285 3300025303 Ga0209051_1066664 Ga0209051_10666642 87
286 3300025304 Ga0209257_1057468 Ga0209257_10574682 87
287 3300025893 Ga0207682_10045991 Ga0207682_100459913 87
288 3300025900 Ga0207710_10128260 Ga0207710_101282602 87
289 3300025903 Ga0207680_11083626 Ga0207680_110836262 87
290 3300025925 Ga0207650_11104890 Ga0207650_111048902 87
291 3300025927 Ga0207687_10647052 Ga0207687_106470522 87
292 3300025940 Ga0207691_10052626 Ga0207691_100526262 87
293 3300025945 Ga0207679_11811728 Ga0207679_118117282 87
294 3300026118 Ga0207675_100320039 Ga0207675_1003200393 87
295 3300028379 Ga0268266_11291143 Ga0268266_112911431 87
296 3300038705 Ga0237819_16744 Ga0237819_16744_308_586 87
297 3300041512 Ga0451853_2483692 Ga0451853_2483692_158_436 87
298 3300047447 Ga0495685_136878 Ga0495685_136878_26_289 87
299 3300048903 Ga0496100_0290432 Ga0496100_0290432_789_1052 87
300 3300048905 Ga0496102_1478815 Ga0496102_1478815_182_445 87
301 3300048910 Ga0496107_1147243 Ga0496107_1147243_134_397 87
302 3300048919 Ga0496116_0020877 Ga0496116_0020877_1133_1396 87
303 3300048919 Ga0496116_0045304 Ga0496116_0045304_1895_2158 87
304 3300048920 Ga0496117_0026928 Ga0496117_0026928_943_1206 87
305 3300048921 Ga0496118_0068364 Ga0496118_0068364_1450_1713 87
306 3300048922 Ga0496119_0309677 Ga0496119_0309677_65_328 87
307 3300048924 Ga0496121_0024057 Ga0496121_0024057_4556_4819 87
308 3300048924 Ga0496121_0081855 Ga0496121_0081855_1102_1365 87
309 3300048924 Ga0496121_0210404 Ga0496121_0210404_66_329 87
310 3300048924 Ga0496121_0887436 Ga0496121_0887436_111_389 87
311 3300048925 Ga0496122_0027609 Ga0496122_0027609_3562_3825 87
312 3300048925 Ga0496122_0057655 Ga0496122_0057655_1731_2009 87
313 3300048926 Ga0496123_0005995 Ga0496123_0005995_981_1244 87
314 3300048926 Ga0496123_0424196 Ga0496123_0424196_53_331 87
315 3300048927 Ga0496124_0019949 Ga0496124_0019949_3562_3825 87
316 3300048927 Ga0496124_0040470 Ga0496124_0040470_1471_1734 87
317 3300048928 Ga0496125_0019563 Ga0496125_0019563_2208_2471 87
318 3300048928 Ga0496125_0134631 Ga0496125_0134631_1455_1718 87
319 3300048929 Ga0496126_0202994 Ga0496126_0202994_1057_1320 87
320 3300048929 Ga0496126_0284634 Ga0496126_0284634_474_752 87
321 3300049571 Ga0501034_0457405 Ga0501034_0457405_205_468 87
322 3300049572 Ga0501036_0044841 Ga0501036_0044841_1329_1592 87
323 3300049573 Ga0501037_0075453 Ga0501037_0075453_197_460 87
324 3300049574 Ga0501038_0009558 Ga0501038_0009558_8386_8649 87
325 3300049575 Ga0501039_0121899 Ga0501039_0121899_367_630 87
326 3300049579 Ga0501043_0095339 Ga0501043_0095339_206_469 87
327 3300049581 Ga0501047_0124767 Ga0501047_0124767_2012_2275 87
328 3300049586 Ga0501070_0148773 Ga0501070_0148773_793_1056 87
329 3300049592 Ga0501076_1017097 Ga0501076_1017097_74_337 87
330 3300049742 Ga0501080_0115020 Ga0501080_0115020_907_1170 87
331 3300049822 Ga0501035_0016789 Ga0501035_0016789_6076_6339 87
332 3300049823 Ga0501044_0031444 Ga0501044_0031444_2635_2898 87
333 3300049824 Ga0501045_0788382 Ga0501045_0788382_174_437 87
334 3300050496 nmdc:mga07m45_151375_c1 nmdc:mga07m45_151375_c1_1040_1303 87
335 3300060353 Ga0501082_0270789 Ga0501082_0270789_833_1096 87

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04365

BrnT_toxin

Ribonuclease toxin, BrnT, of type II toxin-antitoxin system

5

77

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3u97-assembly1.cif.gz_A 1.1 angstrom-resolution crystal structure of the brucella abortus ribonuclease toxin, brnt 0.9449 1 75
3u97-assembly1.cif.gz_A 1.1 angstrom-resolution crystal structure of the brucella abortus ribonuclease toxin, brnt 0.9099 1 75
7vd7-assembly1.cif.gz_A toxin - antitoxin complex from salmonella enterica serovar typhimurium 0.7857 1 82
2o62-assembly1.cif.gz_A crystal structure of a protein with unknown function from duf3598 family (npun_r4044) from nostoc punctiforme pcc 73102 at 1.75 a resolution 0.7477 32 62
3hfq-assembly2.cif.gz_B crystal structure of the lp_2219 protein from lactobacillus plantarum. northeast structural genomics consortium target lpr118. 0.7371 34 73
ID Description Score Start End Superfamily
3u97A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;Ribonuclease toxin, BrnT, of type II toxin-antitoxin system 0.9193 1 75 3.10.450.530
3u97A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;Ribonuclease toxin, BrnT, of type II toxin-antitoxin system 0.9076 1 75 3.10.450.530
af_Q9XWI6_325_613_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.6891 41 74 2.120.10.30
af_Q960N3_111_453_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6864 34 76 2.130.10.10
af_Q4G061_490_685_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.681 41 74 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A7W5WRB7-F1-model_v4 deleted 1.006 1 87
AF-A0A644XWL4-F1-model_v4 BrnT family toxin 0.9944 1 80
AF-A0A2N4Y0H8-F1-model_v4 BrnT family toxin 0.9917 1 81
AF-A0A530AXP4-F1-model_v4 BrnT family toxin 0.991 1 55
AF-K5CZE1-F1-model_v4 deleted 0.9906 1 78

Feature Viewer

pLDDT pTM Quality
94.21 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map