F411981
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 334 | 185 | 334 | 142 |
Family's Representative Sequence
| Representative Sequence | 3300049584|Ga0501068_0165675|Ga0501068_0165675_388_801 |
| Length | 130 |
| Sequence | MAGTTRKRGIVAEINVTPLVDIMLVLLIIFMLTAHLIAKQAIEVELPRAASTIAITLTRDGKLYLGDAPVEPDALRTAIRTALAKDPKTQALIIGDKSVAHGRVVWVLDTIRSLGVGSFAIQIDPSSTIP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 2 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 3 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 4 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 17 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 26 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 27 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 28 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 29 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 30 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 31 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 32 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 33 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 34 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 35 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 40 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 41 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 42 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 44 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 55 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 76 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 77 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 78 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 79 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 80 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 81 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 82 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 83 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 84 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 85 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 86 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 87 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 88 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 89 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 90 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 91 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 92 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 93 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 94 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 95 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 96 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 97 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 98 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 99 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 100 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 101 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 102 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 103 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 104 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 105 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 106 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 107 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 108 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 109 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 110 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 111 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 112 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 113 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 114 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 115 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 116 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 117 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 118 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 119 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 120 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 121 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 122 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 123 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 124 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 125 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 126 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 142 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 143 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 144 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 145 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 146 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 148 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 149 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 150 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 151 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 153 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 154 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 156 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 158 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 160 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 161 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 162 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 163 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 164 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 165 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 166 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 167 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 168 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 169 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 170 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 171 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 172 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 173 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 174 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 175 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 176 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 177 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 178 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 179 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 180 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 181 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 182 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 183 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 184 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 185 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.28 |
| Nodule | 0 |
| Rhizoplane | 3.29 |
| Rhizosphere | 79.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.79 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070683_100018669 | 3300005329 | Bacteria | 6147 |
| 2 | Ga0070683_100423241 | 3300005329 | Bacteria | 1270 |
| 3 | Ga0068869_100177130 | 3300005334 | Bacteria | 1670 |
| 4 | Ga0068869_100984216 | 3300005334 | Bacteria | 734 |
| 5 | Ga0068869_101141391 | 3300005334 | Bacteria | 683 |
| 6 | Ga0068868_100324154 | 3300005338 | Bacteria | 1313 |
| 7 | Ga0070689_101309966 | 3300005340 | Bacteria | 652 |
| 8 | Ga0070687_100012426 | 3300005343 | Bacteria | 3761 |
| 9 | Ga0070687_100325371 | 3300005343 | Bacteria | 984 |
| 10 | Ga0070687_100752141 | 3300005343 | Bacteria | 686 |
| 11 | Ga0070675_100956273 | 3300005354 | Bacteria | 786 |
| 12 | Ga0070674_100452822 | 3300005356 | Bacteria | 1060 |
| 13 | Ga0070688_100143183 | 3300005365 | Bacteria | 1626 |
| 14 | Ga0070713_101149710 | 3300005436 | Bacteria | 751 |
| 15 | Ga0070710_10068773 | 3300005437 | Bacteria | 2036 |
| 16 | Ga0070711_100155902 | 3300005439 | Bacteria | 1727 |
| 17 | Ga0070700_100277568 | 3300005441 | Bacteria | 1214 |
| 18 | Ga0070694_100219358 | 3300005444 | Bacteria | 1426 |
| 19 | Ga0070708_101479483 | 3300005445 | Bacteria | 633 |
| 20 | Ga0070681_10073906 | 3300005458 | Bacteria | 3371 |
| 21 | Ga0070681_11035615 | 3300005458 | Bacteria | 741 |
| 22 | Ga0068867_100769601 | 3300005459 | Bacteria | 856 |
| 23 | Ga0070706_100003152 | 3300005467 | Bacteria | 16302 |
| 24 | Ga0070699_101202202 | 3300005518 | Bacteria | 695 |
| 25 | Ga0070679_100031210 | 3300005530 | Bacteria | 5262 |
| 26 | Ga0070684_100244182 | 3300005535 | Bacteria | 1641 |
| 27 | Ga0070684_100880240 | 3300005535 | Bacteria | 839 |
| 28 | Ga0070684_101042905 | 3300005535 | Bacteria | 768 |
| 29 | Ga0070697_101372149 | 3300005536 | Bacteria | 631 |
| 30 | Ga0070686_100374010 | 3300005544 | Bacteria | 1077 |
| 31 | Ga0070695_100052544 | 3300005545 | Bacteria | 2619 |
| 32 | Ga0070696_100938316 | 3300005546 | Bacteria | 720 |
| 33 | Ga0068856_100161070 | 3300005614 | Bacteria | 2254 |
| 34 | Ga0068859_100927423 | 3300005617 | Bacteria | 955 |
| 35 | Ga0068864_101457556 | 3300005618 | Bacteria | 687 |
| 36 | Ga0068866_10268791 | 3300005718 | Bacteria | 1051 |
| 37 | Ga0068861_100179544 | 3300005719 | Bacteria | 1761 |
| 38 | Ga0068861_100400427 | 3300005719 | Bacteria | 1218 |
| 39 | Ga0068861_100795113 | 3300005719 | Bacteria | 887 |
| 40 | Ga0068870_10677786 | 3300005840 | Bacteria | 709 |
| 41 | Ga0068863_100021818 | 3300005841 | Bacteria | 6111 |
| 42 | Ga0068860_101307927 | 3300005843 | Bacteria | 746 |
| 43 | Ga0068862_100167481 | 3300005844 | Bacteria | 1965 |
| 44 | Ga0081455_10258425 | 3300005937 | Bacteria | 1269 |
| 45 | Ga0070717_10187560 | 3300006028 | Bacteria | 1805 |
| 46 | Ga0070717_10858737 | 3300006028 | Bacteria | 826 |
| 47 | Ga0070716_100616676 | 3300006173 | Bacteria | 818 |
| 48 | Ga0070712_100840640 | 3300006175 | Bacteria | 789 |
| 49 | Ga0097621_100142109 | 3300006237 | Bacteria | 2052 |
| 50 | Ga0068871_100679791 | 3300006358 | Bacteria | 942 |
| 51 | Ga0068871_101543314 | 3300006358 | Bacteria | 628 |
| 52 | Ga0075430_100680519 | 3300006846 | Bacteria | 848 |
| 53 | Ga0075434_101287842 | 3300006871 | Bacteria | 742 |
| 54 | Ga0097620_100927327 | 3300006931 | Bacteria | 955 |
| 55 | Ga0075435_100670437 | 3300007076 | Bacteria | 901 |
| 56 | Ga0075435_101009005 | 3300007076 | Bacteria | 727 |
| 57 | Ga0105240_11582369 | 3300009093 | Bacteria | 686 |
| 58 | Ga0105245_10000046 | 3300009098 | Bacteria | 132997 |
| 59 | Ga0105245_10036465 | 3300009098 | Bacteria | 4368 |
| 60 | Ga0105247_10480015 | 3300009101 | Bacteria | 902 |
| 61 | Ga0105243_10753442 | 3300009148 | Bacteria | 955 |
| 62 | Ga0105243_10849809 | 3300009148 | Bacteria | 904 |
| 63 | Ga0105249_10060688 | 3300009553 | Bacteria | 3469 |
| 64 | Ga0157374_10058597 | 3300013296 | Bacteria | 3599 |
| 65 | Ga0157374_10538941 | 3300013296 | Bacteria | 1174 |
| 66 | Ga0157374_12036145 | 3300013296 | Bacteria | 601 |
| 67 | Ga0157378_10680762 | 3300013297 | Bacteria | 1046 |
| 68 | Ga0157372_13101430 | 3300013307 | Bacteria | 530 |
| 69 | Ga0163163_10333852 | 3300014325 | Bacteria | 1571 |
| 70 | Ga0157376_10013907 | 3300014969 | Bacteria | 6018 |
| 71 | Ga0157376_11399596 | 3300014969 | Bacteria | 731 |
| 72 | Ga0213876_10507916 | 3300021384 | Bacteria | 641 |
| 73 | Ga0207692_10032969 | 3300025898 | Bacteria | 2494 |
| 74 | Ga0207692_10457867 | 3300025898 | Bacteria | 804 |
| 75 | Ga0207642_10022704 | 3300025899 | Bacteria | 2494 |
| 76 | Ga0207699_10586901 | 3300025906 | Bacteria | 811 |
| 77 | Ga0207643_10636978 | 3300025908 | Bacteria | 687 |
| 78 | Ga0207684_10035216 | 3300025910 | Bacteria | 4252 |
| 79 | Ga0207707_10101889 | 3300025912 | Bacteria | 2510 |
| 80 | Ga0207707_11077852 | 3300025912 | Bacteria | 656 |
| 81 | Ga0207663_10061521 | 3300025916 | Bacteria | 2383 |
| 82 | Ga0207652_10179907 | 3300025921 | Bacteria | 1900 |
| 83 | Ga0207652_11516516 | 3300025921 | Bacteria | 574 |
| 84 | Ga0207687_10000034 | 3300025927 | Bacteria | 132465 |
| 85 | Ga0207700_10656110 | 3300025928 | Bacteria | 935 |
| 86 | Ga0207670_10505471 | 3300025936 | Bacteria | 982 |
| 87 | Ga0207689_10120694 | 3300025942 | Bacteria | 2156 |
| 88 | Ga0207689_10137235 | 3300025942 | Bacteria | 2014 |
| 89 | Ga0207689_10507958 | 3300025942 | Bacteria | 1010 |
| 90 | Ga0207661_10028299 | 3300025944 | Bacteria | 4291 |
| 91 | Ga0207661_10314793 | 3300025944 | Bacteria | 1406 |
| 92 | Ga0207661_11096026 | 3300025944 | Bacteria | 733 |
| 93 | Ga0207661_11425127 | 3300025944 | Bacteria | 635 |
| 94 | Ga0207677_10334075 | 3300026023 | Bacteria | 1264 |
| 95 | Ga0207708_10142152 | 3300026075 | Bacteria | 1884 |
| 96 | Ga0207702_10543122 | 3300026078 | Bacteria | 1136 |
| 97 | Ga0207641_10022356 | 3300026088 | Bacteria | 5206 |
| 98 | Ga0207683_10030393 | 3300026121 | Bacteria | 4681 |
| 99 | Ga0268265_10102547 | 3300028380 | Bacteria | 2315 |
| 100 | Ga0268264_10967060 | 3300028381 | Bacteria | 857 |
| 101 | Ga0265337_1014367 | 3300028556 | Bacteria | 2626 |
| 102 | Ga0265337_1029284 | 3300028556 | Bacteria | 1647 |
| 103 | Ga0265326_10061104 | 3300028558 | Bacteria | 1066 |
| 104 | Ga0265326_10119867 | 3300028558 | Bacteria | 748 |
| 105 | Ga0265319_1026552 | 3300028563 | Bacteria | 2061 |
| 106 | Ga0265319_1086202 | 3300028563 | Bacteria | 994 |
| 107 | Ga0265334_10143603 | 3300028573 | Bacteria | 844 |
| 108 | Ga0265318_10000033 | 3300028577 | Bacteria | 143214 |
| 109 | Ga0265318_10102279 | 3300028577 | Bacteria | 1054 |
| 110 | Ga0265318_10218123 | 3300028577 | Bacteria | 697 |
| 111 | Ga0265318_10347626 | 3300028577 | Bacteria | 541 |
| 112 | Ga0265323_10007722 | 3300028653 | Bacteria | 4454 |
| 113 | Ga0265323_10017072 | 3300028653 | Bacteria | 2825 |
| 114 | Ga0265323_10019055 | 3300028653 | Bacteria | 2651 |
| 115 | Ga0265323_10039476 | 3300028653 | Bacteria | 1721 |
| 116 | Ga0265322_10024666 | 3300028654 | Bacteria | 1720 |
| 117 | Ga0265336_10026121 | 3300028666 | Bacteria | 1836 |
| 118 | Ga0307515_10035968 | 3300028794 | Bacteria | 8032 |
| 119 | Ga0265338_10007129 | 3300028800 | Bacteria | 13998 |
| 120 | Ga0265338_10034433 | 3300028800 | Bacteria | 4895 |
| 121 | Ga0265338_10046956 | 3300028800 | Bacteria | 3950 |
| 122 | Ga0265338_10062450 | 3300028800 | Bacteria | 3255 |
| 123 | Ga0265338_10158397 | 3300028800 | Bacteria | 1751 |
| 124 | Ga0265338_10587078 | 3300028800 | Bacteria | 777 |
| 125 | Ga0265324_10000150 | 3300029957 | Bacteria | 53542 |
| 126 | Ga0265324_10006188 | 3300029957 | Bacteria | 5041 |
| 127 | Ga0265330_10000029 | 3300031235 | Bacteria | 138185 |
| 128 | Ga0265330_10000936 | 3300031235 | Bacteria | 17963 |
| 129 | Ga0265330_10001227 | 3300031235 | Bacteria | 15069 |
| 130 | Ga0265330_10001411 | 3300031235 | Bacteria | 14065 |
| 131 | Ga0265330_10004670 | 3300031235 | Bacteria | 6923 |
| 132 | Ga0265330_10007249 | 3300031235 | Bacteria | 5423 |
| 133 | Ga0265330_10014650 | 3300031235 | Bacteria | 3637 |
| 134 | Ga0265330_10156909 | 3300031235 | Bacteria | 966 |
| 135 | Ga0265332_10000144 | 3300031238 | Bacteria | 58090 |
| 136 | Ga0265332_10008915 | 3300031238 | Bacteria | 4487 |
| 137 | Ga0265332_10016388 | 3300031238 | Bacteria | 3270 |
| 138 | Ga0265332_10019090 | 3300031238 | Bacteria | 3026 |
| 139 | Ga0265332_10051931 | 3300031238 | Bacteria | 1760 |
| 140 | Ga0265328_10000381 | 3300031239 | Bacteria | 20711 |
| 141 | Ga0265320_10000062 | 3300031240 | Bacteria | 99515 |
| 142 | Ga0265320_10001835 | 3300031240 | Bacteria | 15067 |
| 143 | Ga0265320_10056765 | 3300031240 | Bacteria | 1880 |
| 144 | Ga0265320_10077577 | 3300031240 | Bacteria | 1554 |
| 145 | Ga0265320_10094946 | 3300031240 | Bacteria | 1379 |
| 146 | Ga0265325_10002312 | 3300031241 | Bacteria | 12925 |
| 147 | Ga0265325_10050669 | 3300031241 | Bacteria | 2137 |
| 148 | Ga0265325_10134779 | 3300031241 | Bacteria | 1179 |
| 149 | Ga0265325_10189710 | 3300031241 | Bacteria | 953 |
| 150 | Ga0265329_10000097 | 3300031242 | Bacteria | 41368 |
| 151 | Ga0265329_10000589 | 3300031242 | Bacteria | 18813 |
| 152 | Ga0265329_10066102 | 3300031242 | Bacteria | 1144 |
| 153 | Ga0265329_10121520 | 3300031242 | Bacteria | 838 |
| 154 | Ga0265329_10242335 | 3300031242 | Bacteria | 600 |
| 155 | Ga0265340_10000089 | 3300031247 | Bacteria | 42937 |
| 156 | Ga0265340_10334064 | 3300031247 | Bacteria | 670 |
| 157 | Ga0265339_10000180 | 3300031249 | Bacteria | 53583 |
| 158 | Ga0265339_10003659 | 3300031249 | Bacteria | 10725 |
| 159 | Ga0265339_10033076 | 3300031249 | Bacteria | 2914 |
| 160 | Ga0265339_10047811 | 3300031249 | Bacteria | 2348 |
| 161 | Ga0265339_10054994 | 3300031249 | Bacteria | 2160 |
| 162 | Ga0265339_10116674 | 3300031249 | Bacteria | 1376 |
| 163 | Ga0265339_10164814 | 3300031249 | Bacteria | 1113 |
| 164 | Ga0265331_10000079 | 3300031250 | Bacteria | 138758 |
| 165 | Ga0265331_10011118 | 3300031250 | Bacteria | 4938 |
| 166 | Ga0265331_10082922 | 3300031250 | Bacteria | 1487 |
| 167 | Ga0265316_10000010 | 3300031344 | Bacteria | 230553 |
| 168 | Ga0265316_10000286 | 3300031344 | Bacteria | 56796 |
| 169 | Ga0265316_10000573 | 3300031344 | Bacteria | 41152 |
| 170 | Ga0265316_10000660 | 3300031344 | Bacteria | 38374 |
| 171 | Ga0265316_10016042 | 3300031344 | Bacteria | 6517 |
| 172 | Ga0265316_10029020 | 3300031344 | Bacteria | 4555 |
| 173 | Ga0265316_10033969 | 3300031344 | Bacteria | 4147 |
| 174 | Ga0265316_10043861 | 3300031344 | Bacteria | 3560 |
| 175 | Ga0265316_10074821 | 3300031344 | Bacteria | 2606 |
| 176 | Ga0265316_10095052 | 3300031344 | Bacteria | 2270 |
| 177 | Ga0265316_10095737 | 3300031344 | Bacteria | 2261 |
| 178 | Ga0265316_10249504 | 3300031344 | Bacteria | 1303 |
| 179 | Ga0265316_10299713 | 3300031344 | Bacteria | 1171 |
| 180 | Ga0265316_10508817 | 3300031344 | Bacteria | 860 |
| 181 | Ga0307513_10018764 | 3300031456 | Bacteria | 8256 |
| 182 | Ga0307509_10000111 | 3300031507 | Bacteria | 117078 |
| 183 | Ga0307509_10000248 | 3300031507 | Bacteria | 87123 |
| 184 | Ga0307509_10004505 | 3300031507 | Bacteria | 20029 |
| 185 | Ga0307509_10044812 | 3300031507 | Bacteria | 4776 |
| 186 | Ga0307509_10174461 | 3300031507 | Bacteria | 2024 |
| 187 | Ga0307509_10327257 | 3300031507 | Bacteria | 1266 |
| 188 | Ga0265313_10000114 | 3300031595 | Bacteria | 81527 |
| 189 | Ga0265313_10013529 | 3300031595 | Bacteria | 4891 |
| 190 | Ga0265313_10019532 | 3300031595 | Bacteria | 3765 |
| 191 | Ga0265313_10032581 | 3300031595 | Bacteria | 2659 |
| 192 | Ga0265313_10366839 | 3300031595 | Bacteria | 569 |
| 193 | Ga0307508_10006408 | 3300031616 | Bacteria | 11067 |
| 194 | Ga0307508_10504301 | 3300031616 | Bacteria | 805 |
| 195 | Ga0307514_10533311 | 3300031649 | Bacteria | 547 |
| 196 | Ga0265314_10000138 | 3300031711 | Bacteria | 109255 |
| 197 | Ga0265314_10000256 | 3300031711 | Bacteria | 78367 |
| 198 | Ga0265314_10001627 | 3300031711 | Bacteria | 24594 |
| 199 | Ga0265314_10006926 | 3300031711 | Bacteria | 9929 |
| 200 | Ga0265314_10015756 | 3300031711 | Bacteria | 5987 |
| 201 | Ga0265314_10019860 | 3300031711 | Bacteria | 5196 |
| 202 | Ga0265342_10000120 | 3300031712 | Bacteria | 87596 |
| 203 | Ga0265342_10000655 | 3300031712 | Bacteria | 36250 |
| 204 | Ga0265342_10000871 | 3300031712 | Bacteria | 30164 |
| 205 | Ga0265342_10001079 | 3300031712 | Bacteria | 26449 |
| 206 | Ga0265342_10001106 | 3300031712 | Bacteria | 25862 |
| 207 | Ga0265342_10001107 | 3300031712 | Bacteria | 25846 |
| 208 | Ga0265342_10016344 | 3300031712 | Bacteria | 4855 |
| 209 | Ga0265342_10019551 | 3300031712 | Bacteria | 4362 |
| 210 | Ga0265342_10028667 | 3300031712 | Bacteria | 3464 |
| 211 | Ga0265342_10052669 | 3300031712 | Bacteria | 2425 |
| 212 | Ga0265342_10097086 | 3300031712 | Bacteria | 1683 |
| 213 | Ga0265342_10194197 | 3300031712 | Bacteria | 1106 |
| 214 | Ga0307516_10034624 | 3300031730 | Bacteria | 5073 |
| 215 | Ga0307516_10508078 | 3300031730 | Bacteria | 859 |
| 216 | Ga0307516_10609524 | 3300031730 | Bacteria | 746 |
| 217 | Ga0373934_0069634 | 3300035086 | Bacteria | 1406 |
| 218 | Ga0373949_0002085 | 3300035090 | Bacteria | 5272 |
| 219 | Ga0373939_0202509 | 3300035114 | Bacteria | 751 |
| 220 | Ga0373941_0003810 | 3300035115 | Bacteria | 3451 |
| 221 | Ga0373941_0245726 | 3300035115 | Bacteria | 697 |
| 222 | Ga0373941_0249881 | 3300035115 | Bacteria | 692 |
| 223 | Ga0373954_0012959 | 3300035118 | Bacteria | 3713 |
| 224 | Ga0373956_0059247 | 3300035119 | Bacteria | 1732 |
| 225 | Ga0373943_0552431 | 3300035170 | Bacteria | 676 |
| 226 | Ga0373943_0874656 | 3300035170 | Bacteria | 536 |
| 227 | Ga0373946_0209739 | 3300035171 | Bacteria | 936 |
| 228 | Ga0373955_0091297 | 3300035172 | Bacteria | 1736 |
| 229 | Ga0373955_0319977 | 3300035172 | Bacteria | 937 |
| 230 | Ga0373961_0000126 | 3300035241 | Bacteria | 39091 |
| 231 | Ga0373935_0390418 | 3300035692 | Bacteria | 998 |
| 232 | Ga0373935_0474986 | 3300035692 | Bacteria | 905 |
| 233 | Ga0373935_1373118 | 3300035692 | Bacteria | 528 |
| 234 | Ga0373927_0325539 | 3300035695 | Bacteria | 1012 |
| 235 | Ga0373933_0012901 | 3300035724 | Bacteria | 4623 |
| 236 | Ga0373933_0041881 | 3300035724 | Bacteria | 2705 |
| 237 | Ga0373933_0256399 | 3300035724 | Bacteria | 1127 |
| 238 | Ga0373937_0038637 | 3300036401 | Bacteria | 4349 |
| 239 | Ga0373937_0115528 | 3300036401 | Bacteria | 2499 |
| 240 | Ga0373937_0357785 | 3300036401 | Bacteria | 1383 |
| 241 | Ga0373925_0035166 | 3300037068 | Bacteria | 3696 |
| 242 | Ga0373925_0130625 | 3300037068 | Bacteria | 1958 |
| 243 | Ga0373925_0160499 | 3300037068 | Bacteria | 1770 |
| 244 | Ga0395899_0015193 | 3300037312 | Bacteria | 5870 |
| 245 | Ga0395900_0170728 | 3300037418 | Bacteria | 2214 |
| 246 | Ga0395901_0061948 | 3300038443 | Bacteria | 3892 |
| 247 | Ga0436365_0805369 | 3300039437 | Bacteria | 757 |
| 248 | Ga0451804_0192711 | 3300041463 | Bacteria | 922 |
| 249 | Ga0466963_0278569 | 3300044694 | Bacteria | 1175 |
| 250 | Ga0466963_0582969 | 3300044694 | Bacteria | 790 |
| 251 | Ga0466967_0955913 | 3300045976 | Bacteria | 853 |
| 252 | Ga0495603_0583370 | 3300046455 | Bacteria | 640 |
| 253 | Ga0495650_0027599 | 3300046471 | Bacteria | 2620 |
| 254 | Ga0495664_0005836 | 3300046477 | Bacteria | 6776 |
| 255 | Ga0495596_0103289 | 3300046500 | Bacteria | 1107 |
| 256 | Ga0495628_0698890 | 3300046516 | Bacteria | 716 |
| 257 | Ga0495630_0098735 | 3300046517 | Bacteria | 2209 |
| 258 | Ga0495630_0689557 | 3300046517 | Bacteria | 782 |
| 259 | Ga0495632_0138907 | 3300046519 | Bacteria | 1128 |
| 260 | Ga0495652_0555484 | 3300046529 | Bacteria | 789 |
| 261 | Ga0495586_0232490 | 3300046535 | Bacteria | 1049 |
| 262 | Ga0495634_0002281 | 3300046642 | Bacteria | 16054 |
| 263 | Ga0495634_0177872 | 3300046642 | Bacteria | 1334 |
| 264 | Ga0495657_0082595 | 3300046675 | Bacteria | 2076 |
| 265 | Ga0495624_0534064 | 3300046690 | Bacteria | 701 |
| 266 | Ga0495674_0003103 | 3300047319 | Bacteria | 16138 |
| 267 | Ga0495680_0830235 | 3300047322 | Bacteria | 602 |
| 268 | Ga0495686_0057588 | 3300047472 | Bacteria | 2425 |
| 269 | Ga0496101_0179106 | 3300048904 | Bacteria | 1632 |
| 270 | Ga0496101_1213654 | 3300048904 | Bacteria | 591 |
| 271 | Ga0496104_0357342 | 3300048907 | Bacteria | 1373 |
| 272 | Ga0496104_0397716 | 3300048907 | Bacteria | 1290 |
| 273 | Ga0496104_1207004 | 3300048907 | Bacteria | 660 |
| 274 | Ga0496112_0083963 | 3300048915 | Bacteria | 3150 |
| 275 | Ga0496112_0780521 | 3300048915 | Bacteria | 881 |
| 276 | Ga0496114_0526520 | 3300048917 | Bacteria | 1045 |
| 277 | Ga0496114_0635084 | 3300048917 | Bacteria | 940 |
| 278 | Ga0496115_0663653 | 3300048918 | Bacteria | 823 |
| 279 | Ga0501068_0165675 | 3300049584 | Bacteria | 1394 |
| 280 | Ga0501069_0031697 | 3300049585 | Bacteria | 2909 |
| 281 | Ga0501070_0103814 | 3300049586 | Bacteria | 2350 |
| 282 | Ga0501070_0130573 | 3300049586 | Bacteria | 2075 |
| 283 | Ga0501071_0070110 | 3300049587 | Bacteria | 2553 |
| 284 | Ga0501072_0322955 | 3300049588 | Bacteria | 1227 |
| 285 | Ga0501080_0073676 | 3300049742 | Bacteria | 3177 |
| 286 | Ga0501081_0122061 | 3300049743 | Bacteria | 1857 |
| 287 | nmdc:mga0qj67_1002064_c1 | 3300050509 | Bacteria | 655 |
| 288 | nmdc:mga0qj67_190182_c1 | 3300050509 | Bacteria | 1668 |
| 289 | nmdc:mga0n895_696302_c1 | 3300050512 | Bacteria | 1012 |
| 290 | nmdc:mga0rr50_24943_c1 | 3300050513 | Bacteria | 4150 |
| 291 | Ga0495601_0222846 | 3300053077 | Bacteria | 1232 |
| 292 | Ga0495601_0352144 | 3300053077 | Bacteria | 957 |
| 293 | Ga0500635_0002349 | 3300053080 | Bacteria | 4671 |
| 294 | Ga0495595_0455135 | 3300053084 | Bacteria | 651 |
| 295 | Ga0500578_0464603 | 3300053086 | Bacteria | 718 |
| 296 | Ga0500646_0095879 | 3300053090 | Bacteria | 925 |
| 297 | Ga0500583_0126951 | 3300053092 | Bacteria | 1264 |
| 298 | Ga0500566_0001313 | 3300053094 | Bacteria | 14500 |
| 299 | Ga0500566_0004900 | 3300053094 | Bacteria | 7973 |
| 300 | Ga0500566_0040119 | 3300053094 | Bacteria | 2706 |
| 301 | Ga0500566_0157412 | 3300053094 | Bacteria | 1188 |
| 302 | Ga0500566_0515028 | 3300053094 | Bacteria | 512 |
| 303 | Ga0500640_000046 | 3300053095 | Bacteria | 18314 |
| 304 | Ga0500640_000066 | 3300053095 | Bacteria | 17189 |
| 305 | Ga0500554_000030 | 3300053102 | Bacteria | 23871 |
| 306 | Ga0500554_000079 | 3300053102 | Bacteria | 17589 |
| 307 | Ga0500562_057352 | 3300053108 | Bacteria | 1044 |
| 308 | Ga0500572_144312 | 3300053111 | Bacteria | 776 |
| 309 | Ga0500572_282400 | 3300053111 | Bacteria | 536 |
| 310 | Ga0500595_000073 | 3300053119 | Bacteria | 70983 |
| 311 | Ga0500595_000168 | 3300053119 | Bacteria | 43413 |
| 312 | Ga0500595_022656 | 3300053119 | Bacteria | 2219 |
| 313 | Ga0500597_091737 | 3300053120 | Bacteria | 1320 |
| 314 | Ga0500614_000103 | 3300053123 | Bacteria | 20403 |
| 315 | Ga0500614_000453 | 3300053123 | Bacteria | 10614 |
| 316 | Ga0500614_027020 | 3300053123 | Bacteria | 1376 |
| 317 | Ga0500617_206862 | 3300053124 | Bacteria | 713 |
| 318 | Ga0500642_0020397 | 3300053130 | Bacteria | 2605 |
| 319 | Ga0500655_138249 | 3300053133 | Bacteria | 523 |
| 320 | Ga0500559_0039083 | 3300053136 | Bacteria | 2063 |
| 321 | Ga0500559_0052892 | 3300053136 | Bacteria | 1796 |
| 322 | Ga0500564_044990 | 3300053138 | Bacteria | 2026 |
| 323 | Ga0500585_245368 | 3300053144 | Bacteria | 571 |
| 324 | Ga0500586_271074 | 3300053145 | Bacteria | 523 |
| 325 | Ga0500590_225712 | 3300053148 | Bacteria | 768 |
| 326 | Ga0500603_002056 | 3300053150 | Bacteria | 4446 |
| 327 | Ga0500619_221201 | 3300053154 | Bacteria | 630 |
| 328 | Ga0500622_0113588 | 3300053156 | Bacteria | 1320 |
| 329 | Ga0500638_030300 | 3300053162 | Bacteria | 2605 |
| 330 | Ga0500639_164717 | 3300053163 | Bacteria | 1003 |
| 331 | Ga0500636_0157613 | 3300053177 | Bacteria | 1241 |
| 332 | Ga0500637_0115236 | 3300053178 | Bacteria | 1559 |
| 333 | Ga0500637_0381123 | 3300053178 | Bacteria | 739 |
| 334 | Ga0500661_115888 | 3300055283 | Bacteria | 516 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053094 | Ga0500566_0515028 | Ga0500566_0515028_11_382 | 118 |
| 2 | 3300049584 | Ga0501068_0165675 | Ga0501068_0165675_388_801 | 129 |
| 3 | 3300049585 | Ga0501069_0031697 | Ga0501069_0031697_325_738 | 129 |
| 4 | 3300049586 | Ga0501070_0103814 | Ga0501070_0103814_843_1256 | 129 |
| 5 | 3300049586 | Ga0501070_0130573 | Ga0501070_0130573_1073_1486 | 129 |
| 6 | 3300049587 | Ga0501071_0070110 | Ga0501071_0070110_526_939 | 129 |
| 7 | 3300049588 | Ga0501072_0322955 | Ga0501072_0322955_738_1151 | 129 |
| 8 | 3300049742 | Ga0501080_0073676 | Ga0501080_0073676_2335_2748 | 129 |
| 9 | 3300049743 | Ga0501081_0122061 | Ga0501081_0122061_1203_1616 | 129 |
| 10 | 3300005618 | Ga0068864_101457556 | Ga0068864_1014575562 | 134 |
| 11 | 3300046471 | Ga0495650_0027599 | Ga0495650_0027599_1185_1637 | 136 |
| 12 | 3300053084 | Ga0495595_0455135 | Ga0495595_0455135_177_587 | 136 |
| 13 | 3300009101 | Ga0105247_10480015 | Ga0105247_104800152 | 137 |
| 14 | 3300013297 | Ga0157378_10680762 | Ga0157378_106807622 | 137 |
| 15 | 3300028380 | Ga0268265_10102547 | Ga0268265_101025472 | 137 |
| 16 | 3300028556 | Ga0265337_1029284 | Ga0265337_10292842 | 137 |
| 17 | 3300028558 | Ga0265326_10061104 | Ga0265326_100611042 | 137 |
| 18 | 3300028573 | Ga0265334_10143603 | Ga0265334_101436032 | 137 |
| 19 | 3300028577 | Ga0265318_10102279 | Ga0265318_101022792 | 137 |
| 20 | 3300028653 | Ga0265323_10017072 | Ga0265323_100170722 | 137 |
| 21 | 3300028653 | Ga0265323_10039476 | Ga0265323_100394762 | 137 |
| 22 | 3300028654 | Ga0265322_10024666 | Ga0265322_100246663 | 137 |
| 23 | 3300028800 | Ga0265338_10062450 | Ga0265338_100624503 | 137 |
| 24 | 3300028800 | Ga0265338_10158397 | Ga0265338_101583973 | 137 |
| 25 | 3300029957 | Ga0265324_10006188 | Ga0265324_100061883 | 137 |
| 26 | 3300031235 | Ga0265330_10000936 | Ga0265330_100009363 | 137 |
| 27 | 3300031235 | Ga0265330_10001411 | Ga0265330_100014113 | 137 |
| 28 | 3300031235 | Ga0265330_10014650 | Ga0265330_100146502 | 137 |
| 29 | 3300031235 | Ga0265330_10156909 | Ga0265330_101569092 | 137 |
| 30 | 3300031238 | Ga0265332_10008915 | Ga0265332_100089152 | 137 |
| 31 | 3300031240 | Ga0265320_10056765 | Ga0265320_100567652 | 137 |
| 32 | 3300031240 | Ga0265320_10094946 | Ga0265320_100949462 | 137 |
| 33 | 3300031241 | Ga0265325_10002312 | Ga0265325_100023123 | 137 |
| 34 | 3300031241 | Ga0265325_10189710 | Ga0265325_101897102 | 137 |
| 35 | 3300031242 | Ga0265329_10000589 | Ga0265329_1000058912 | 137 |
| 36 | 3300031247 | Ga0265340_10000089 | Ga0265340_1000008922 | 137 |
| 37 | 3300031249 | Ga0265339_10054994 | Ga0265339_100549943 | 137 |
| 38 | 3300031249 | Ga0265339_10164814 | Ga0265339_101648142 | 137 |
| 39 | 3300031250 | Ga0265331_10011118 | Ga0265331_100111183 | 137 |
| 40 | 3300031344 | Ga0265316_10000286 | Ga0265316_1000028619 | 137 |
| 41 | 3300031344 | Ga0265316_10016042 | Ga0265316_100160424 | 137 |
| 42 | 3300031344 | Ga0265316_10029020 | Ga0265316_100290201 | 137 |
| 43 | 3300031344 | Ga0265316_10095737 | Ga0265316_100957372 | 137 |
| 44 | 3300031344 | Ga0265316_10249504 | Ga0265316_102495042 | 137 |
| 45 | 3300031344 | Ga0265316_10299713 | Ga0265316_102997132 | 137 |
| 46 | 3300031595 | Ga0265313_10013529 | Ga0265313_100135293 | 137 |
| 47 | 3300031711 | Ga0265314_10000256 | Ga0265314_1000025645 | 137 |
| 48 | 3300031711 | Ga0265314_10001627 | Ga0265314_100016273 | 137 |
| 49 | 3300031712 | Ga0265342_10000120 | Ga0265342_1000012023 | 137 |
| 50 | 3300031712 | Ga0265342_10000871 | Ga0265342_1000087118 | 137 |
| 51 | 3300031712 | Ga0265342_10001107 | Ga0265342_100011074 | 137 |
| 52 | 3300031712 | Ga0265342_10019551 | Ga0265342_100195514 | 137 |
| 53 | 3300031712 | Ga0265342_10097086 | Ga0265342_100970863 | 137 |
| 54 | 3300005844 | Ga0068862_100167481 | Ga0068862_1001674813 | 138 |
| 55 | 3300028556 | Ga0265337_1014367 | Ga0265337_10143673 | 138 |
| 56 | 3300028558 | Ga0265326_10119867 | Ga0265326_101198671 | 138 |
| 57 | 3300028653 | Ga0265323_10007722 | Ga0265323_100077225 | 138 |
| 58 | 3300028653 | Ga0265323_10019055 | Ga0265323_100190551 | 138 |
| 59 | 3300028800 | Ga0265338_10034433 | Ga0265338_100344333 | 138 |
| 60 | 3300028800 | Ga0265338_10587078 | Ga0265338_105870782 | 138 |
| 61 | 3300029957 | Ga0265324_10000150 | Ga0265324_1000015015 | 138 |
| 62 | 3300031235 | Ga0265330_10001227 | Ga0265330_100012279 | 138 |
| 63 | 3300031235 | Ga0265330_10004670 | Ga0265330_100046703 | 138 |
| 64 | 3300031235 | Ga0265330_10007249 | Ga0265330_100072493 | 138 |
| 65 | 3300031238 | Ga0265332_10051931 | Ga0265332_100519312 | 138 |
| 66 | 3300031241 | Ga0265325_10134779 | Ga0265325_101347792 | 138 |
| 67 | 3300031242 | Ga0265329_10000097 | Ga0265329_1000009712 | 138 |
| 68 | 3300031242 | Ga0265329_10121520 | Ga0265329_101215202 | 138 |
| 69 | 3300031242 | Ga0265329_10242335 | Ga0265329_102423352 | 138 |
| 70 | 3300031249 | Ga0265339_10000180 | Ga0265339_1000018033 | 138 |
| 71 | 3300031249 | Ga0265339_10033076 | Ga0265339_100330763 | 138 |
| 72 | 3300031344 | Ga0265316_10000010 | Ga0265316_1000001015 | 138 |
| 73 | 3300031344 | Ga0265316_10000573 | Ga0265316_100005733 | 138 |
| 74 | 3300031344 | Ga0265316_10000660 | Ga0265316_1000066021 | 138 |
| 75 | 3300031344 | Ga0265316_10033969 | Ga0265316_100339692 | 138 |
| 76 | 3300031344 | Ga0265316_10074821 | Ga0265316_100748213 | 138 |
| 77 | 3300031344 | Ga0265316_10095052 | Ga0265316_100950522 | 138 |
| 78 | 3300031344 | Ga0265316_10508817 | Ga0265316_105088172 | 138 |
| 79 | 3300031595 | Ga0265313_10019532 | Ga0265313_100195323 | 138 |
| 80 | 3300031711 | Ga0265314_10006926 | Ga0265314_100069263 | 138 |
| 81 | 3300031712 | Ga0265342_10000655 | Ga0265342_1000065513 | 138 |
| 82 | 3300031712 | Ga0265342_10016344 | Ga0265342_100163443 | 138 |
| 83 | 3300031712 | Ga0265342_10052669 | Ga0265342_100526694 | 138 |
| 84 | 3300031712 | Ga0265342_10194197 | Ga0265342_101941972 | 138 |
| 85 | 3300048907 | Ga0496104_0397716 | Ga0496104_0397716_117_542 | 138 |
| 86 | 3300053094 | Ga0500566_0001313 | Ga0500566_0001313_12510_12938 | 138 |
| 87 | 3300053095 | Ga0500640_000066 | Ga0500640_000066_2348_2776 | 138 |
| 88 | 3300053102 | Ga0500554_000079 | Ga0500554_000079_14867_15295 | 138 |
| 89 | 3300053108 | Ga0500562_057352 | Ga0500562_057352_264_728 | 138 |
| 90 | 3300053111 | Ga0500572_282400 | Ga0500572_282400_20_448 | 138 |
| 91 | 3300053119 | Ga0500595_000168 | Ga0500595_000168_15845_16273 | 138 |
| 92 | 3300053120 | Ga0500597_091737 | Ga0500597_091737_638_1066 | 138 |
| 93 | 3300053123 | Ga0500614_000453 | Ga0500614_000453_91_519 | 138 |
| 94 | 3300053124 | Ga0500617_206862 | Ga0500617_206862_108_572 | 138 |
| 95 | 3300053136 | Ga0500559_0052892 | Ga0500559_0052892_290_718 | 138 |
| 96 | 3300053154 | Ga0500619_221201 | Ga0500619_221201_87_515 | 138 |
| 97 | 3300053156 | Ga0500622_0113588 | Ga0500622_0113588_187_651 | 138 |
| 98 | 3300053178 | Ga0500637_0381123 | Ga0500637_0381123_87_515 | 138 |
| 99 | 3300005334 | Ga0068869_100984216 | Ga0068869_1009842162 | 139 |
| 100 | 3300005334 | Ga0068869_101141391 | Ga0068869_1011413911 | 139 |
| 101 | 3300005343 | Ga0070687_100325371 | Ga0070687_1003253711 | 139 |
| 102 | 3300005530 | Ga0070679_100031210 | Ga0070679_1000312102 | 139 |
| 103 | 3300005535 | Ga0070684_100880240 | Ga0070684_1008802401 | 139 |
| 104 | 3300005536 | Ga0070697_101372149 | Ga0070697_1013721492 | 139 |
| 105 | 3300005614 | Ga0068856_100161070 | Ga0068856_1001610703 | 139 |
| 106 | 3300005937 | Ga0081455_10258425 | Ga0081455_102584253 | 139 |
| 107 | 3300009093 | Ga0105240_11582369 | Ga0105240_115823692 | 139 |
| 108 | 3300009098 | Ga0105245_10000046 | Ga0105245_1000004645 | 139 |
| 109 | 3300013296 | Ga0157374_10538941 | Ga0157374_105389412 | 139 |
| 110 | 3300013307 | Ga0157372_13101430 | Ga0157372_131014301 | 139 |
| 111 | 3300014969 | Ga0157376_10013907 | Ga0157376_100139075 | 139 |
| 112 | 3300021384 | Ga0213876_10507916 | Ga0213876_105079162 | 139 |
| 113 | 3300025921 | Ga0207652_10179907 | Ga0207652_101799072 | 139 |
| 114 | 3300025927 | Ga0207687_10000034 | Ga0207687_1000003486 | 139 |
| 115 | 3300025942 | Ga0207689_10507958 | Ga0207689_105079582 | 139 |
| 116 | 3300025944 | Ga0207661_10314793 | Ga0207661_103147932 | 139 |
| 117 | 3300026075 | Ga0207708_10142152 | Ga0207708_101421524 | 139 |
| 118 | 3300026078 | Ga0207702_10543122 | Ga0207702_105431222 | 139 |
| 119 | 3300028381 | Ga0268264_10967060 | Ga0268264_109670602 | 139 |
| 120 | 3300028577 | Ga0265318_10218123 | Ga0265318_102181231 | 139 |
| 121 | 3300031507 | Ga0307509_10004505 | Ga0307509_100045059 | 139 |
| 122 | 3300035090 | Ga0373949_0002085 | Ga0373949_0002085_4471_4926 | 139 |
| 123 | 3300035115 | Ga0373941_0003810 | Ga0373941_0003810_860_1288 | 139 |
| 124 | 3300039437 | Ga0436365_0805369 | Ga0436365_0805369_230_652 | 139 |
| 125 | 3300044694 | Ga0466963_0278569 | Ga0466963_0278569_726_1148 | 139 |
| 126 | 3300044694 | Ga0466963_0582969 | Ga0466963_0582969_169_594 | 139 |
| 127 | 3300046500 | Ga0495596_0103289 | Ga0495596_0103289_329_754 | 139 |
| 128 | 3300046517 | Ga0495630_0689557 | Ga0495630_0689557_53_481 | 139 |
| 129 | 3300046519 | Ga0495632_0138907 | Ga0495632_0138907_460_891 | 139 |
| 130 | 3300053090 | Ga0500646_0095879 | Ga0500646_0095879_338_778 | 139 |
| 131 | 3300005334 | Ga0068869_100177130 | Ga0068869_1001771302 | 140 |
| 132 | 3300005340 | Ga0070689_101309966 | Ga0070689_1013099662 | 140 |
| 133 | 3300005343 | Ga0070687_100012426 | Ga0070687_1000124261 | 140 |
| 134 | 3300005441 | Ga0070700_100277568 | Ga0070700_1002775682 | 140 |
| 135 | 3300005444 | Ga0070694_100219358 | Ga0070694_1002193582 | 140 |
| 136 | 3300005445 | Ga0070708_101479483 | Ga0070708_1014794832 | 140 |
| 137 | 3300005458 | Ga0070681_11035615 | Ga0070681_110356152 | 140 |
| 138 | 3300005459 | Ga0068867_100769601 | Ga0068867_1007696012 | 140 |
| 139 | 3300005535 | Ga0070684_100244182 | Ga0070684_1002441823 | 140 |
| 140 | 3300005544 | Ga0070686_100374010 | Ga0070686_1003740102 | 140 |
| 141 | 3300005545 | Ga0070695_100052544 | Ga0070695_1000525443 | 140 |
| 142 | 3300005546 | Ga0070696_100938316 | Ga0070696_1009383162 | 140 |
| 143 | 3300005617 | Ga0068859_100927423 | Ga0068859_1009274232 | 140 |
| 144 | 3300005718 | Ga0068866_10268791 | Ga0068866_102687912 | 140 |
| 145 | 3300005719 | Ga0068861_100179544 | Ga0068861_1001795442 | 140 |
| 146 | 3300005719 | Ga0068861_100400427 | Ga0068861_1004004271 | 140 |
| 147 | 3300005840 | Ga0068870_10677786 | Ga0068870_106777862 | 140 |
| 148 | 3300005841 | Ga0068863_100021818 | Ga0068863_1000218183 | 140 |
| 149 | 3300005843 | Ga0068860_101307927 | Ga0068860_1013079271 | 140 |
| 150 | 3300006028 | Ga0070717_10187560 | Ga0070717_101875603 | 140 |
| 151 | 3300006175 | Ga0070712_100840640 | Ga0070712_1008406402 | 140 |
| 152 | 3300006237 | Ga0097621_100142109 | Ga0097621_1001421093 | 140 |
| 153 | 3300006358 | Ga0068871_100679791 | Ga0068871_1006797912 | 140 |
| 154 | 3300006931 | Ga0097620_100927327 | Ga0097620_1009273272 | 140 |
| 155 | 3300007076 | Ga0075435_101009005 | Ga0075435_1010090052 | 140 |
| 156 | 3300009098 | Ga0105245_10036465 | Ga0105245_100364653 | 140 |
| 157 | 3300009148 | Ga0105243_10753442 | Ga0105243_107534422 | 140 |
| 158 | 3300014325 | Ga0163163_10333852 | Ga0163163_103338522 | 140 |
| 159 | 3300014969 | Ga0157376_11399596 | Ga0157376_113995962 | 140 |
| 160 | 3300025899 | Ga0207642_10022704 | Ga0207642_100227042 | 140 |
| 161 | 3300025908 | Ga0207643_10636978 | Ga0207643_106369782 | 140 |
| 162 | 3300025912 | Ga0207707_11077852 | Ga0207707_110778521 | 140 |
| 163 | 3300025936 | Ga0207670_10505471 | Ga0207670_105054711 | 140 |
| 164 | 3300025942 | Ga0207689_10120694 | Ga0207689_101206942 | 140 |
| 165 | 3300025942 | Ga0207689_10137235 | Ga0207689_101372353 | 140 |
| 166 | 3300026088 | Ga0207641_10022356 | Ga0207641_100223566 | 140 |
| 167 | 3300028794 | Ga0307515_10035968 | Ga0307515_100359686 | 140 |
| 168 | 3300031238 | Ga0265332_10019090 | Ga0265332_100190903 | 140 |
| 169 | 3300031456 | Ga0307513_10018764 | Ga0307513_100187643 | 140 |
| 170 | 3300031507 | Ga0307509_10044812 | Ga0307509_100448122 | 140 |
| 171 | 3300031507 | Ga0307509_10174461 | Ga0307509_101744613 | 140 |
| 172 | 3300031507 | Ga0307509_10327257 | Ga0307509_103272572 | 140 |
| 173 | 3300031616 | Ga0307508_10006408 | Ga0307508_100064084 | 140 |
| 174 | 3300031616 | Ga0307508_10504301 | Ga0307508_105043012 | 140 |
| 175 | 3300031730 | Ga0307516_10508078 | Ga0307516_105080782 | 140 |
| 176 | 3300031730 | Ga0307516_10609524 | Ga0307516_106095242 | 140 |
| 177 | 3300035114 | Ga0373939_0202509 | Ga0373939_0202509_140_571 | 140 |
| 178 | 3300035115 | Ga0373941_0245726 | Ga0373941_0245726_181_606 | 140 |
| 179 | 3300035115 | Ga0373941_0249881 | Ga0373941_0249881_188_619 | 140 |
| 180 | 3300035119 | Ga0373956_0059247 | Ga0373956_0059247_895_1326 | 140 |
| 181 | 3300035241 | Ga0373961_0000126 | Ga0373961_0000126_29175_29615 | 140 |
| 182 | 3300047472 | Ga0495686_0057588 | Ga0495686_0057588_550_978 | 140 |
| 183 | 3300048904 | Ga0496101_0179106 | Ga0496101_0179106_475_906 | 140 |
| 184 | 3300050512 | nmdc:mga0n895_696302_c1 | nmdc:mga0n895_696302_c1_156_587 | 140 |
| 185 | 3300050513 | nmdc:mga0rr50_24943_c1 | nmdc:mga0rr50_24943_c1_3489_3920 | 140 |
| 186 | 3300053080 | Ga0500635_0002349 | Ga0500635_0002349_2700_3140 | 140 |
| 187 | 3300053086 | Ga0500578_0464603 | Ga0500578_0464603_150_584 | 140 |
| 188 | 3300053092 | Ga0500583_0126951 | Ga0500583_0126951_376_807 | 140 |
| 189 | 3300053094 | Ga0500566_0004900 | Ga0500566_0004900_6250_6681 | 140 |
| 190 | 3300053094 | Ga0500566_0040119 | Ga0500566_0040119_1170_1622 | 140 |
| 191 | 3300053094 | Ga0500566_0157412 | Ga0500566_0157412_706_1137 | 140 |
| 192 | 3300053095 | Ga0500640_000046 | Ga0500640_000046_11652_12083 | 140 |
| 193 | 3300053102 | Ga0500554_000030 | Ga0500554_000030_6108_6539 | 140 |
| 194 | 3300053111 | Ga0500572_144312 | Ga0500572_144312_213_644 | 140 |
| 195 | 3300053119 | Ga0500595_000073 | Ga0500595_000073_17333_17764 | 140 |
| 196 | 3300053119 | Ga0500595_022656 | Ga0500595_022656_1771_2202 | 140 |
| 197 | 3300053123 | Ga0500614_000103 | Ga0500614_000103_12174_12605 | 140 |
| 198 | 3300053123 | Ga0500614_027020 | Ga0500614_027020_576_1007 | 140 |
| 199 | 3300053130 | Ga0500642_0020397 | Ga0500642_0020397_1764_2195 | 140 |
| 200 | 3300053133 | Ga0500655_138249 | Ga0500655_138249_29_457 | 140 |
| 201 | 3300053136 | Ga0500559_0039083 | Ga0500559_0039083_273_704 | 140 |
| 202 | 3300053138 | Ga0500564_044990 | Ga0500564_044990_356_796 | 140 |
| 203 | 3300053144 | Ga0500585_245368 | Ga0500585_245368_98_529 | 140 |
| 204 | 3300053145 | Ga0500586_271074 | Ga0500586_271074_63_494 | 140 |
| 205 | 3300053148 | Ga0500590_225712 | Ga0500590_225712_24_464 | 140 |
| 206 | 3300053150 | Ga0500603_002056 | Ga0500603_002056_1692_2132 | 140 |
| 207 | 3300053162 | Ga0500638_030300 | Ga0500638_030300_119_550 | 140 |
| 208 | 3300053163 | Ga0500639_164717 | Ga0500639_164717_483_914 | 140 |
| 209 | 3300053177 | Ga0500636_0157613 | Ga0500636_0157613_472_915 | 140 |
| 210 | 3300053178 | Ga0500637_0115236 | Ga0500637_0115236_1046_1477 | 140 |
| 211 | 3300055283 | Ga0500661_115888 | Ga0500661_115888_22_453 | 140 |
| 212 | 3300005329 | Ga0070683_100018669 | Ga0070683_1000186694 | 141 |
| 213 | 3300005329 | Ga0070683_100423241 | Ga0070683_1004232412 | 141 |
| 214 | 3300005338 | Ga0068868_100324154 | Ga0068868_1003241542 | 141 |
| 215 | 3300005343 | Ga0070687_100752141 | Ga0070687_1007521411 | 141 |
| 216 | 3300005354 | Ga0070675_100956273 | Ga0070675_1009562732 | 141 |
| 217 | 3300005356 | Ga0070674_100452822 | Ga0070674_1004528222 | 141 |
| 218 | 3300005365 | Ga0070688_100143183 | Ga0070688_1001431832 | 141 |
| 219 | 3300005436 | Ga0070713_101149710 | Ga0070713_1011497102 | 141 |
| 220 | 3300005437 | Ga0070710_10068773 | Ga0070710_100687733 | 141 |
| 221 | 3300005439 | Ga0070711_100155902 | Ga0070711_1001559023 | 141 |
| 222 | 3300005458 | Ga0070681_10073906 | Ga0070681_100739063 | 141 |
| 223 | 3300005467 | Ga0070706_100003152 | Ga0070706_1000031527 | 141 |
| 224 | 3300005518 | Ga0070699_101202202 | Ga0070699_1012022022 | 141 |
| 225 | 3300005535 | Ga0070684_101042905 | Ga0070684_1010429052 | 141 |
| 226 | 3300005719 | Ga0068861_100795113 | Ga0068861_1007951132 | 141 |
| 227 | 3300006028 | Ga0070717_10858737 | Ga0070717_108587372 | 141 |
| 228 | 3300006173 | Ga0070716_100616676 | Ga0070716_1006166762 | 141 |
| 229 | 3300006358 | Ga0068871_101543314 | Ga0068871_1015433142 | 141 |
| 230 | 3300006846 | Ga0075430_100680519 | Ga0075430_1006805192 | 141 |
| 231 | 3300006871 | Ga0075434_101287842 | Ga0075434_1012878422 | 141 |
| 232 | 3300007076 | Ga0075435_100670437 | Ga0075435_1006704372 | 141 |
| 233 | 3300009148 | Ga0105243_10849809 | Ga0105243_108498092 | 141 |
| 234 | 3300009553 | Ga0105249_10060688 | Ga0105249_100606883 | 141 |
| 235 | 3300013296 | Ga0157374_10058597 | Ga0157374_100585972 | 141 |
| 236 | 3300013296 | Ga0157374_12036145 | Ga0157374_120361451 | 141 |
| 237 | 3300025898 | Ga0207692_10032969 | Ga0207692_100329693 | 141 |
| 238 | 3300025898 | Ga0207692_10457867 | Ga0207692_104578672 | 141 |
| 239 | 3300025906 | Ga0207699_10586901 | Ga0207699_105869012 | 141 |
| 240 | 3300025910 | Ga0207684_10035216 | Ga0207684_100352162 | 141 |
| 241 | 3300025912 | Ga0207707_10101889 | Ga0207707_101018891 | 141 |
| 242 | 3300025916 | Ga0207663_10061521 | Ga0207663_100615213 | 141 |
| 243 | 3300025921 | Ga0207652_11516516 | Ga0207652_115165162 | 141 |
| 244 | 3300025928 | Ga0207700_10656110 | Ga0207700_106561102 | 141 |
| 245 | 3300025944 | Ga0207661_10028299 | Ga0207661_100282992 | 141 |
| 246 | 3300025944 | Ga0207661_11096026 | Ga0207661_110960262 | 141 |
| 247 | 3300025944 | Ga0207661_11425127 | Ga0207661_114251271 | 141 |
| 248 | 3300026023 | Ga0207677_10334075 | Ga0207677_103340752 | 141 |
| 249 | 3300026121 | Ga0207683_10030393 | Ga0207683_100303934 | 141 |
| 250 | 3300028563 | Ga0265319_1026552 | Ga0265319_10265523 | 141 |
| 251 | 3300028563 | Ga0265319_1086202 | Ga0265319_10862022 | 141 |
| 252 | 3300028577 | Ga0265318_10000033 | Ga0265318_1000003362 | 141 |
| 253 | 3300028577 | Ga0265318_10347626 | Ga0265318_103476261 | 141 |
| 254 | 3300028666 | Ga0265336_10026121 | Ga0265336_100261212 | 141 |
| 255 | 3300028800 | Ga0265338_10007129 | Ga0265338_100071291 | 141 |
| 256 | 3300028800 | Ga0265338_10046956 | Ga0265338_100469563 | 141 |
| 257 | 3300031235 | Ga0265330_10000029 | Ga0265330_1000002965 | 141 |
| 258 | 3300031238 | Ga0265332_10000144 | Ga0265332_1000014434 | 141 |
| 259 | 3300031238 | Ga0265332_10016388 | Ga0265332_100163882 | 141 |
| 260 | 3300031239 | Ga0265328_10000381 | Ga0265328_1000038113 | 141 |
| 261 | 3300031240 | Ga0265320_10000062 | Ga0265320_1000006267 | 141 |
| 262 | 3300031240 | Ga0265320_10001835 | Ga0265320_100018355 | 141 |
| 263 | 3300031240 | Ga0265320_10077577 | Ga0265320_100775772 | 141 |
| 264 | 3300031241 | Ga0265325_10050669 | Ga0265325_100506692 | 141 |
| 265 | 3300031242 | Ga0265329_10066102 | Ga0265329_100661022 | 141 |
| 266 | 3300031247 | Ga0265340_10334064 | Ga0265340_103340642 | 141 |
| 267 | 3300031249 | Ga0265339_10003659 | Ga0265339_100036594 | 141 |
| 268 | 3300031249 | Ga0265339_10047811 | Ga0265339_100478112 | 141 |
| 269 | 3300031249 | Ga0265339_10116674 | Ga0265339_101166742 | 141 |
| 270 | 3300031250 | Ga0265331_10000079 | Ga0265331_1000007959 | 141 |
| 271 | 3300031250 | Ga0265331_10082922 | Ga0265331_100829222 | 141 |
| 272 | 3300031344 | Ga0265316_10043861 | Ga0265316_100438613 | 141 |
| 273 | 3300031507 | Ga0307509_10000111 | Ga0307509_1000011139 | 141 |
| 274 | 3300031507 | Ga0307509_10000248 | Ga0307509_1000024830 | 141 |
| 275 | 3300031595 | Ga0265313_10000114 | Ga0265313_1000011416 | 141 |
| 276 | 3300031595 | Ga0265313_10032581 | Ga0265313_100325811 | 141 |
| 277 | 3300031595 | Ga0265313_10366839 | Ga0265313_103668392 | 141 |
| 278 | 3300031649 | Ga0307514_10533311 | Ga0307514_105333111 | 141 |
| 279 | 3300031711 | Ga0265314_10000138 | Ga0265314_1000013836 | 141 |
| 280 | 3300031711 | Ga0265314_10015756 | Ga0265314_100157562 | 141 |
| 281 | 3300031711 | Ga0265314_10019860 | Ga0265314_100198603 | 141 |
| 282 | 3300031712 | Ga0265342_10001079 | Ga0265342_1000107916 | 141 |
| 283 | 3300031712 | Ga0265342_10001106 | Ga0265342_100011066 | 141 |
| 284 | 3300031712 | Ga0265342_10028667 | Ga0265342_100286672 | 141 |
| 285 | 3300031730 | Ga0307516_10034624 | Ga0307516_100346243 | 141 |
| 286 | 3300035086 | Ga0373934_0069634 | Ga0373934_0069634_193_618 | 141 |
| 287 | 3300035118 | Ga0373954_0012959 | Ga0373954_0012959_1384_1812 | 141 |
| 288 | 3300035170 | Ga0373943_0552431 | Ga0373943_0552431_18_443 | 141 |
| 289 | 3300035170 | Ga0373943_0874656 | Ga0373943_0874656_42_470 | 141 |
| 290 | 3300035171 | Ga0373946_0209739 | Ga0373946_0209739_427_855 | 141 |
| 291 | 3300035172 | Ga0373955_0091297 | Ga0373955_0091297_580_1008 | 141 |
| 292 | 3300035172 | Ga0373955_0319977 | Ga0373955_0319977_395_820 | 141 |
| 293 | 3300035692 | Ga0373935_0390418 | Ga0373935_0390418_223_648 | 141 |
| 294 | 3300035692 | Ga0373935_0474986 | Ga0373935_0474986_66_491 | 141 |
| 295 | 3300035692 | Ga0373935_1373118 | Ga0373935_1373118_78_503 | 141 |
| 296 | 3300035695 | Ga0373927_0325539 | Ga0373927_0325539_191_616 | 141 |
| 297 | 3300035724 | Ga0373933_0012901 | Ga0373933_0012901_2471_2899 | 141 |
| 298 | 3300035724 | Ga0373933_0041881 | Ga0373933_0041881_712_1137 | 141 |
| 299 | 3300035724 | Ga0373933_0256399 | Ga0373933_0256399_678_1103 | 141 |
| 300 | 3300036401 | Ga0373937_0038637 | Ga0373937_0038637_267_695 | 141 |
| 301 | 3300036401 | Ga0373937_0115528 | Ga0373937_0115528_23_451 | 141 |
| 302 | 3300036401 | Ga0373937_0357785 | Ga0373937_0357785_40_465 | 141 |
| 303 | 3300037068 | Ga0373925_0035166 | Ga0373925_0035166_3194_3619 | 141 |
| 304 | 3300037068 | Ga0373925_0130625 | Ga0373925_0130625_1257_1685 | 141 |
| 305 | 3300037068 | Ga0373925_0160499 | Ga0373925_0160499_631_1056 | 141 |
| 306 | 3300037312 | Ga0395899_0015193 | Ga0395899_0015193_693_1121 | 141 |
| 307 | 3300037418 | Ga0395900_0170728 | Ga0395900_0170728_806_1234 | 141 |
| 308 | 3300038443 | Ga0395901_0061948 | Ga0395901_0061948_119_547 | 141 |
| 309 | 3300041463 | Ga0451804_0192711 | Ga0451804_0192711_216_644 | 141 |
| 310 | 3300045976 | Ga0466967_0955913 | Ga0466967_0955913_373_810 | 141 |
| 311 | 3300046455 | Ga0495603_0583370 | Ga0495603_0583370_166_591 | 141 |
| 312 | 3300046477 | Ga0495664_0005836 | Ga0495664_0005836_3870_4295 | 141 |
| 313 | 3300046516 | Ga0495628_0698890 | Ga0495628_0698890_223_648 | 141 |
| 314 | 3300046517 | Ga0495630_0098735 | Ga0495630_0098735_1592_2017 | 141 |
| 315 | 3300046529 | Ga0495652_0555484 | Ga0495652_0555484_30_458 | 141 |
| 316 | 3300046535 | Ga0495586_0232490 | Ga0495586_0232490_99_524 | 141 |
| 317 | 3300046642 | Ga0495634_0002281 | Ga0495634_0002281_3069_3494 | 141 |
| 318 | 3300046642 | Ga0495634_0177872 | Ga0495634_0177872_325_750 | 141 |
| 319 | 3300046675 | Ga0495657_0082595 | Ga0495657_0082595_52_480 | 141 |
| 320 | 3300046690 | Ga0495624_0534064 | Ga0495624_0534064_49_477 | 141 |
| 321 | 3300047319 | Ga0495674_0003103 | Ga0495674_0003103_3520_3945 | 141 |
| 322 | 3300047322 | Ga0495680_0830235 | Ga0495680_0830235_52_480 | 141 |
| 323 | 3300048904 | Ga0496101_1213654 | Ga0496101_1213654_138_563 | 141 |
| 324 | 3300048907 | Ga0496104_0357342 | Ga0496104_0357342_875_1300 | 141 |
| 325 | 3300048907 | Ga0496104_1207004 | Ga0496104_1207004_77_502 | 141 |
| 326 | 3300048915 | Ga0496112_0083963 | Ga0496112_0083963_1998_2423 | 141 |
| 327 | 3300048915 | Ga0496112_0780521 | Ga0496112_0780521_189_617 | 141 |
| 328 | 3300048917 | Ga0496114_0526520 | Ga0496114_0526520_181_606 | 141 |
| 329 | 3300048917 | Ga0496114_0635084 | Ga0496114_0635084_368_793 | 141 |
| 330 | 3300048918 | Ga0496115_0663653 | Ga0496115_0663653_136_561 | 141 |
| 331 | 3300050509 | nmdc:mga0qj67_1002064_c1 | nmdc:mga0qj67_1002064_c1_165_593 | 141 |
| 332 | 3300050509 | nmdc:mga0qj67_190182_c1 | nmdc:mga0qj67_190182_c1_178_606 | 141 |
| 333 | 3300053077 | Ga0495601_0222846 | Ga0495601_0222846_701_1129 | 141 |
| 334 | 3300053077 | Ga0495601_0352144 | Ga0495601_0352144_385_810 | 141 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8p9r-assembly1.cif.gz_B | structure of the periplasmic domain of exbd from e. coli in complex with tonb | 0.8609 | 58 | 130 |
| 8p9r-assembly1.cif.gz_B | structure of the periplasmic domain of exbd from e. coli in complex with tonb | 0.8505 | 58 | 130 |
| 2pg3-assembly1.cif.gz_A-2 | crystal structure of a queuosine biosynthesis protein quec (eca1155) from erwinia carotovora subsp. atroseptica scri1043 at 2.40 a resolution | 0.8116 | 85 | 129 |
| 1gph-assembly1.cif.gz_1 | structure of the allosteric regulatory enzyme of purine biosynthesis | 0.773 | 97 | 130 |
| 1z7g-assembly1.cif.gz_A-2 | free human hgprt | 0.7727 | 96 | 128 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O74553_20_249_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.7703 | 80 | 128 | 3.20.20.70 |
| 2jwlB00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.751 | 58 | 123 | 3.30.420.270 |
| af_Q2FZX4_3_265_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.7486 | 74 | 128 | 3.20.20.70 |
| 2pfuA01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.7107 | 57 | 127 | 3.30.420.270 |
| af_P60716_82_298_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.7029 | 83 | 134 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0C1GM14-F1-model_v4 | Biopolymer transporter ExbD | 0.8884 | 55 | 134 |
GO:0005886
GO:0015031 GO:0022857 |
| AF-A0A519LWY9-F1-model_v4 | Biopolymer transporter ExbD | 0.8858 | 51 | 132 |
GO:0005886
GO:0015031 GO:0022857 |
| AF-A0A7Z9FA47-F1-model_v4 | Protein TolR | 0.8679 | 51 | 133 |
GO:0005886
GO:0015031 GO:0022857 |
| AF-A0A519LWY9-F1-model_v4 | Biopolymer transporter ExbD | 0.8569 | 51 | 132 |
GO:0005886
GO:0015031 GO:0022857 |
| AF-A0A7Z9FA47-F1-model_v4 | Protein TolR | 0.8492 | 51 | 133 |
GO:0005886
GO:0015031 GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar