F411981

General Info

Members Datasets Scaffolds Average Seq Length
334 185 334 142

Family's Representative Sequence

Representative Sequence 3300049584|Ga0501068_0165675|Ga0501068_0165675_388_801
Length 130
Sequence MAGTTRKRGIVAEINVTPLVDIMLVLLIIFMLTAHLIAKQAIEVELPRAASTIAITLTRDGKLYLGDAPVEPDALRTAIRTALAKDPKTQALIIGDKSVAHGRVVWVLDTIRSLGVGSFAIQIDPSSTIP

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
76 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
77 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
78 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
79 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
80 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
81 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
82 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
83 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
84 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
85 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
86 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
87 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
88 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
89 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
90 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
91 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
92 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
93 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
94 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
95 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
96 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
97 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
98 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
99 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
100 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
101 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
102 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
103 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
104 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
105 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
106 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
107 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
108 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
109 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
110 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
111 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
112 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
113 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
114 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
116 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
124 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
127 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
128 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
129 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
130 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
131 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
132 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
133 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
134 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
135 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
136 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
137 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
138 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
139 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
140 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
141 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
145 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
146 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
147 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
150 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
151 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
152 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
153 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
154 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
155 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
156 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
157 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
158 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
159 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
160 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
161 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
162 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
163 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
164 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
165 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
166 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
167 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
168 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
169 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
170 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
171 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
172 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
173 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
174 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
175 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
176 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
177 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
178 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
179 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
180 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
181 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
182 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
183 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
184 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
185 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.28
Nodule 0
Rhizoplane 3.29
Rhizosphere 79.64
Stem 0
Stem Tuber 0
Unclassified 4.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100018669 3300005329 Bacteria 6147
2 Ga0070683_100423241 3300005329 Bacteria 1270
3 Ga0068869_100177130 3300005334 Bacteria 1670
4 Ga0068869_100984216 3300005334 Bacteria 734
5 Ga0068869_101141391 3300005334 Bacteria 683
6 Ga0068868_100324154 3300005338 Bacteria 1313
7 Ga0070689_101309966 3300005340 Bacteria 652
8 Ga0070687_100012426 3300005343 Bacteria 3761
9 Ga0070687_100325371 3300005343 Bacteria 984
10 Ga0070687_100752141 3300005343 Bacteria 686
11 Ga0070675_100956273 3300005354 Bacteria 786
12 Ga0070674_100452822 3300005356 Bacteria 1060
13 Ga0070688_100143183 3300005365 Bacteria 1626
14 Ga0070713_101149710 3300005436 Bacteria 751
15 Ga0070710_10068773 3300005437 Bacteria 2036
16 Ga0070711_100155902 3300005439 Bacteria 1727
17 Ga0070700_100277568 3300005441 Bacteria 1214
18 Ga0070694_100219358 3300005444 Bacteria 1426
19 Ga0070708_101479483 3300005445 Bacteria 633
20 Ga0070681_10073906 3300005458 Bacteria 3371
21 Ga0070681_11035615 3300005458 Bacteria 741
22 Ga0068867_100769601 3300005459 Bacteria 856
23 Ga0070706_100003152 3300005467 Bacteria 16302
24 Ga0070699_101202202 3300005518 Bacteria 695
25 Ga0070679_100031210 3300005530 Bacteria 5262
26 Ga0070684_100244182 3300005535 Bacteria 1641
27 Ga0070684_100880240 3300005535 Bacteria 839
28 Ga0070684_101042905 3300005535 Bacteria 768
29 Ga0070697_101372149 3300005536 Bacteria 631
30 Ga0070686_100374010 3300005544 Bacteria 1077
31 Ga0070695_100052544 3300005545 Bacteria 2619
32 Ga0070696_100938316 3300005546 Bacteria 720
33 Ga0068856_100161070 3300005614 Bacteria 2254
34 Ga0068859_100927423 3300005617 Bacteria 955
35 Ga0068864_101457556 3300005618 Bacteria 687
36 Ga0068866_10268791 3300005718 Bacteria 1051
37 Ga0068861_100179544 3300005719 Bacteria 1761
38 Ga0068861_100400427 3300005719 Bacteria 1218
39 Ga0068861_100795113 3300005719 Bacteria 887
40 Ga0068870_10677786 3300005840 Bacteria 709
41 Ga0068863_100021818 3300005841 Bacteria 6111
42 Ga0068860_101307927 3300005843 Bacteria 746
43 Ga0068862_100167481 3300005844 Bacteria 1965
44 Ga0081455_10258425 3300005937 Bacteria 1269
45 Ga0070717_10187560 3300006028 Bacteria 1805
46 Ga0070717_10858737 3300006028 Bacteria 826
47 Ga0070716_100616676 3300006173 Bacteria 818
48 Ga0070712_100840640 3300006175 Bacteria 789
49 Ga0097621_100142109 3300006237 Bacteria 2052
50 Ga0068871_100679791 3300006358 Bacteria 942
51 Ga0068871_101543314 3300006358 Bacteria 628
52 Ga0075430_100680519 3300006846 Bacteria 848
53 Ga0075434_101287842 3300006871 Bacteria 742
54 Ga0097620_100927327 3300006931 Bacteria 955
55 Ga0075435_100670437 3300007076 Bacteria 901
56 Ga0075435_101009005 3300007076 Bacteria 727
57 Ga0105240_11582369 3300009093 Bacteria 686
58 Ga0105245_10000046 3300009098 Bacteria 132997
59 Ga0105245_10036465 3300009098 Bacteria 4368
60 Ga0105247_10480015 3300009101 Bacteria 902
61 Ga0105243_10753442 3300009148 Bacteria 955
62 Ga0105243_10849809 3300009148 Bacteria 904
63 Ga0105249_10060688 3300009553 Bacteria 3469
64 Ga0157374_10058597 3300013296 Bacteria 3599
65 Ga0157374_10538941 3300013296 Bacteria 1174
66 Ga0157374_12036145 3300013296 Bacteria 601
67 Ga0157378_10680762 3300013297 Bacteria 1046
68 Ga0157372_13101430 3300013307 Bacteria 530
69 Ga0163163_10333852 3300014325 Bacteria 1571
70 Ga0157376_10013907 3300014969 Bacteria 6018
71 Ga0157376_11399596 3300014969 Bacteria 731
72 Ga0213876_10507916 3300021384 Bacteria 641
73 Ga0207692_10032969 3300025898 Bacteria 2494
74 Ga0207692_10457867 3300025898 Bacteria 804
75 Ga0207642_10022704 3300025899 Bacteria 2494
76 Ga0207699_10586901 3300025906 Bacteria 811
77 Ga0207643_10636978 3300025908 Bacteria 687
78 Ga0207684_10035216 3300025910 Bacteria 4252
79 Ga0207707_10101889 3300025912 Bacteria 2510
80 Ga0207707_11077852 3300025912 Bacteria 656
81 Ga0207663_10061521 3300025916 Bacteria 2383
82 Ga0207652_10179907 3300025921 Bacteria 1900
83 Ga0207652_11516516 3300025921 Bacteria 574
84 Ga0207687_10000034 3300025927 Bacteria 132465
85 Ga0207700_10656110 3300025928 Bacteria 935
86 Ga0207670_10505471 3300025936 Bacteria 982
87 Ga0207689_10120694 3300025942 Bacteria 2156
88 Ga0207689_10137235 3300025942 Bacteria 2014
89 Ga0207689_10507958 3300025942 Bacteria 1010
90 Ga0207661_10028299 3300025944 Bacteria 4291
91 Ga0207661_10314793 3300025944 Bacteria 1406
92 Ga0207661_11096026 3300025944 Bacteria 733
93 Ga0207661_11425127 3300025944 Bacteria 635
94 Ga0207677_10334075 3300026023 Bacteria 1264
95 Ga0207708_10142152 3300026075 Bacteria 1884
96 Ga0207702_10543122 3300026078 Bacteria 1136
97 Ga0207641_10022356 3300026088 Bacteria 5206
98 Ga0207683_10030393 3300026121 Bacteria 4681
99 Ga0268265_10102547 3300028380 Bacteria 2315
100 Ga0268264_10967060 3300028381 Bacteria 857
101 Ga0265337_1014367 3300028556 Bacteria 2626
102 Ga0265337_1029284 3300028556 Bacteria 1647
103 Ga0265326_10061104 3300028558 Bacteria 1066
104 Ga0265326_10119867 3300028558 Bacteria 748
105 Ga0265319_1026552 3300028563 Bacteria 2061
106 Ga0265319_1086202 3300028563 Bacteria 994
107 Ga0265334_10143603 3300028573 Bacteria 844
108 Ga0265318_10000033 3300028577 Bacteria 143214
109 Ga0265318_10102279 3300028577 Bacteria 1054
110 Ga0265318_10218123 3300028577 Bacteria 697
111 Ga0265318_10347626 3300028577 Bacteria 541
112 Ga0265323_10007722 3300028653 Bacteria 4454
113 Ga0265323_10017072 3300028653 Bacteria 2825
114 Ga0265323_10019055 3300028653 Bacteria 2651
115 Ga0265323_10039476 3300028653 Bacteria 1721
116 Ga0265322_10024666 3300028654 Bacteria 1720
117 Ga0265336_10026121 3300028666 Bacteria 1836
118 Ga0307515_10035968 3300028794 Bacteria 8032
119 Ga0265338_10007129 3300028800 Bacteria 13998
120 Ga0265338_10034433 3300028800 Bacteria 4895
121 Ga0265338_10046956 3300028800 Bacteria 3950
122 Ga0265338_10062450 3300028800 Bacteria 3255
123 Ga0265338_10158397 3300028800 Bacteria 1751
124 Ga0265338_10587078 3300028800 Bacteria 777
125 Ga0265324_10000150 3300029957 Bacteria 53542
126 Ga0265324_10006188 3300029957 Bacteria 5041
127 Ga0265330_10000029 3300031235 Bacteria 138185
128 Ga0265330_10000936 3300031235 Bacteria 17963
129 Ga0265330_10001227 3300031235 Bacteria 15069
130 Ga0265330_10001411 3300031235 Bacteria 14065
131 Ga0265330_10004670 3300031235 Bacteria 6923
132 Ga0265330_10007249 3300031235 Bacteria 5423
133 Ga0265330_10014650 3300031235 Bacteria 3637
134 Ga0265330_10156909 3300031235 Bacteria 966
135 Ga0265332_10000144 3300031238 Bacteria 58090
136 Ga0265332_10008915 3300031238 Bacteria 4487
137 Ga0265332_10016388 3300031238 Bacteria 3270
138 Ga0265332_10019090 3300031238 Bacteria 3026
139 Ga0265332_10051931 3300031238 Bacteria 1760
140 Ga0265328_10000381 3300031239 Bacteria 20711
141 Ga0265320_10000062 3300031240 Bacteria 99515
142 Ga0265320_10001835 3300031240 Bacteria 15067
143 Ga0265320_10056765 3300031240 Bacteria 1880
144 Ga0265320_10077577 3300031240 Bacteria 1554
145 Ga0265320_10094946 3300031240 Bacteria 1379
146 Ga0265325_10002312 3300031241 Bacteria 12925
147 Ga0265325_10050669 3300031241 Bacteria 2137
148 Ga0265325_10134779 3300031241 Bacteria 1179
149 Ga0265325_10189710 3300031241 Bacteria 953
150 Ga0265329_10000097 3300031242 Bacteria 41368
151 Ga0265329_10000589 3300031242 Bacteria 18813
152 Ga0265329_10066102 3300031242 Bacteria 1144
153 Ga0265329_10121520 3300031242 Bacteria 838
154 Ga0265329_10242335 3300031242 Bacteria 600
155 Ga0265340_10000089 3300031247 Bacteria 42937
156 Ga0265340_10334064 3300031247 Bacteria 670
157 Ga0265339_10000180 3300031249 Bacteria 53583
158 Ga0265339_10003659 3300031249 Bacteria 10725
159 Ga0265339_10033076 3300031249 Bacteria 2914
160 Ga0265339_10047811 3300031249 Bacteria 2348
161 Ga0265339_10054994 3300031249 Bacteria 2160
162 Ga0265339_10116674 3300031249 Bacteria 1376
163 Ga0265339_10164814 3300031249 Bacteria 1113
164 Ga0265331_10000079 3300031250 Bacteria 138758
165 Ga0265331_10011118 3300031250 Bacteria 4938
166 Ga0265331_10082922 3300031250 Bacteria 1487
167 Ga0265316_10000010 3300031344 Bacteria 230553
168 Ga0265316_10000286 3300031344 Bacteria 56796
169 Ga0265316_10000573 3300031344 Bacteria 41152
170 Ga0265316_10000660 3300031344 Bacteria 38374
171 Ga0265316_10016042 3300031344 Bacteria 6517
172 Ga0265316_10029020 3300031344 Bacteria 4555
173 Ga0265316_10033969 3300031344 Bacteria 4147
174 Ga0265316_10043861 3300031344 Bacteria 3560
175 Ga0265316_10074821 3300031344 Bacteria 2606
176 Ga0265316_10095052 3300031344 Bacteria 2270
177 Ga0265316_10095737 3300031344 Bacteria 2261
178 Ga0265316_10249504 3300031344 Bacteria 1303
179 Ga0265316_10299713 3300031344 Bacteria 1171
180 Ga0265316_10508817 3300031344 Bacteria 860
181 Ga0307513_10018764 3300031456 Bacteria 8256
182 Ga0307509_10000111 3300031507 Bacteria 117078
183 Ga0307509_10000248 3300031507 Bacteria 87123
184 Ga0307509_10004505 3300031507 Bacteria 20029
185 Ga0307509_10044812 3300031507 Bacteria 4776
186 Ga0307509_10174461 3300031507 Bacteria 2024
187 Ga0307509_10327257 3300031507 Bacteria 1266
188 Ga0265313_10000114 3300031595 Bacteria 81527
189 Ga0265313_10013529 3300031595 Bacteria 4891
190 Ga0265313_10019532 3300031595 Bacteria 3765
191 Ga0265313_10032581 3300031595 Bacteria 2659
192 Ga0265313_10366839 3300031595 Bacteria 569
193 Ga0307508_10006408 3300031616 Bacteria 11067
194 Ga0307508_10504301 3300031616 Bacteria 805
195 Ga0307514_10533311 3300031649 Bacteria 547
196 Ga0265314_10000138 3300031711 Bacteria 109255
197 Ga0265314_10000256 3300031711 Bacteria 78367
198 Ga0265314_10001627 3300031711 Bacteria 24594
199 Ga0265314_10006926 3300031711 Bacteria 9929
200 Ga0265314_10015756 3300031711 Bacteria 5987
201 Ga0265314_10019860 3300031711 Bacteria 5196
202 Ga0265342_10000120 3300031712 Bacteria 87596
203 Ga0265342_10000655 3300031712 Bacteria 36250
204 Ga0265342_10000871 3300031712 Bacteria 30164
205 Ga0265342_10001079 3300031712 Bacteria 26449
206 Ga0265342_10001106 3300031712 Bacteria 25862
207 Ga0265342_10001107 3300031712 Bacteria 25846
208 Ga0265342_10016344 3300031712 Bacteria 4855
209 Ga0265342_10019551 3300031712 Bacteria 4362
210 Ga0265342_10028667 3300031712 Bacteria 3464
211 Ga0265342_10052669 3300031712 Bacteria 2425
212 Ga0265342_10097086 3300031712 Bacteria 1683
213 Ga0265342_10194197 3300031712 Bacteria 1106
214 Ga0307516_10034624 3300031730 Bacteria 5073
215 Ga0307516_10508078 3300031730 Bacteria 859
216 Ga0307516_10609524 3300031730 Bacteria 746
217 Ga0373934_0069634 3300035086 Bacteria 1406
218 Ga0373949_0002085 3300035090 Bacteria 5272
219 Ga0373939_0202509 3300035114 Bacteria 751
220 Ga0373941_0003810 3300035115 Bacteria 3451
221 Ga0373941_0245726 3300035115 Bacteria 697
222 Ga0373941_0249881 3300035115 Bacteria 692
223 Ga0373954_0012959 3300035118 Bacteria 3713
224 Ga0373956_0059247 3300035119 Bacteria 1732
225 Ga0373943_0552431 3300035170 Bacteria 676
226 Ga0373943_0874656 3300035170 Bacteria 536
227 Ga0373946_0209739 3300035171 Bacteria 936
228 Ga0373955_0091297 3300035172 Bacteria 1736
229 Ga0373955_0319977 3300035172 Bacteria 937
230 Ga0373961_0000126 3300035241 Bacteria 39091
231 Ga0373935_0390418 3300035692 Bacteria 998
232 Ga0373935_0474986 3300035692 Bacteria 905
233 Ga0373935_1373118 3300035692 Bacteria 528
234 Ga0373927_0325539 3300035695 Bacteria 1012
235 Ga0373933_0012901 3300035724 Bacteria 4623
236 Ga0373933_0041881 3300035724 Bacteria 2705
237 Ga0373933_0256399 3300035724 Bacteria 1127
238 Ga0373937_0038637 3300036401 Bacteria 4349
239 Ga0373937_0115528 3300036401 Bacteria 2499
240 Ga0373937_0357785 3300036401 Bacteria 1383
241 Ga0373925_0035166 3300037068 Bacteria 3696
242 Ga0373925_0130625 3300037068 Bacteria 1958
243 Ga0373925_0160499 3300037068 Bacteria 1770
244 Ga0395899_0015193 3300037312 Bacteria 5870
245 Ga0395900_0170728 3300037418 Bacteria 2214
246 Ga0395901_0061948 3300038443 Bacteria 3892
247 Ga0436365_0805369 3300039437 Bacteria 757
248 Ga0451804_0192711 3300041463 Bacteria 922
249 Ga0466963_0278569 3300044694 Bacteria 1175
250 Ga0466963_0582969 3300044694 Bacteria 790
251 Ga0466967_0955913 3300045976 Bacteria 853
252 Ga0495603_0583370 3300046455 Bacteria 640
253 Ga0495650_0027599 3300046471 Bacteria 2620
254 Ga0495664_0005836 3300046477 Bacteria 6776
255 Ga0495596_0103289 3300046500 Bacteria 1107
256 Ga0495628_0698890 3300046516 Bacteria 716
257 Ga0495630_0098735 3300046517 Bacteria 2209
258 Ga0495630_0689557 3300046517 Bacteria 782
259 Ga0495632_0138907 3300046519 Bacteria 1128
260 Ga0495652_0555484 3300046529 Bacteria 789
261 Ga0495586_0232490 3300046535 Bacteria 1049
262 Ga0495634_0002281 3300046642 Bacteria 16054
263 Ga0495634_0177872 3300046642 Bacteria 1334
264 Ga0495657_0082595 3300046675 Bacteria 2076
265 Ga0495624_0534064 3300046690 Bacteria 701
266 Ga0495674_0003103 3300047319 Bacteria 16138
267 Ga0495680_0830235 3300047322 Bacteria 602
268 Ga0495686_0057588 3300047472 Bacteria 2425
269 Ga0496101_0179106 3300048904 Bacteria 1632
270 Ga0496101_1213654 3300048904 Bacteria 591
271 Ga0496104_0357342 3300048907 Bacteria 1373
272 Ga0496104_0397716 3300048907 Bacteria 1290
273 Ga0496104_1207004 3300048907 Bacteria 660
274 Ga0496112_0083963 3300048915 Bacteria 3150
275 Ga0496112_0780521 3300048915 Bacteria 881
276 Ga0496114_0526520 3300048917 Bacteria 1045
277 Ga0496114_0635084 3300048917 Bacteria 940
278 Ga0496115_0663653 3300048918 Bacteria 823
279 Ga0501068_0165675 3300049584 Bacteria 1394
280 Ga0501069_0031697 3300049585 Bacteria 2909
281 Ga0501070_0103814 3300049586 Bacteria 2350
282 Ga0501070_0130573 3300049586 Bacteria 2075
283 Ga0501071_0070110 3300049587 Bacteria 2553
284 Ga0501072_0322955 3300049588 Bacteria 1227
285 Ga0501080_0073676 3300049742 Bacteria 3177
286 Ga0501081_0122061 3300049743 Bacteria 1857
287 nmdc:mga0qj67_1002064_c1 3300050509 Bacteria 655
288 nmdc:mga0qj67_190182_c1 3300050509 Bacteria 1668
289 nmdc:mga0n895_696302_c1 3300050512 Bacteria 1012
290 nmdc:mga0rr50_24943_c1 3300050513 Bacteria 4150
291 Ga0495601_0222846 3300053077 Bacteria 1232
292 Ga0495601_0352144 3300053077 Bacteria 957
293 Ga0500635_0002349 3300053080 Bacteria 4671
294 Ga0495595_0455135 3300053084 Bacteria 651
295 Ga0500578_0464603 3300053086 Bacteria 718
296 Ga0500646_0095879 3300053090 Bacteria 925
297 Ga0500583_0126951 3300053092 Bacteria 1264
298 Ga0500566_0001313 3300053094 Bacteria 14500
299 Ga0500566_0004900 3300053094 Bacteria 7973
300 Ga0500566_0040119 3300053094 Bacteria 2706
301 Ga0500566_0157412 3300053094 Bacteria 1188
302 Ga0500566_0515028 3300053094 Bacteria 512
303 Ga0500640_000046 3300053095 Bacteria 18314
304 Ga0500640_000066 3300053095 Bacteria 17189
305 Ga0500554_000030 3300053102 Bacteria 23871
306 Ga0500554_000079 3300053102 Bacteria 17589
307 Ga0500562_057352 3300053108 Bacteria 1044
308 Ga0500572_144312 3300053111 Bacteria 776
309 Ga0500572_282400 3300053111 Bacteria 536
310 Ga0500595_000073 3300053119 Bacteria 70983
311 Ga0500595_000168 3300053119 Bacteria 43413
312 Ga0500595_022656 3300053119 Bacteria 2219
313 Ga0500597_091737 3300053120 Bacteria 1320
314 Ga0500614_000103 3300053123 Bacteria 20403
315 Ga0500614_000453 3300053123 Bacteria 10614
316 Ga0500614_027020 3300053123 Bacteria 1376
317 Ga0500617_206862 3300053124 Bacteria 713
318 Ga0500642_0020397 3300053130 Bacteria 2605
319 Ga0500655_138249 3300053133 Bacteria 523
320 Ga0500559_0039083 3300053136 Bacteria 2063
321 Ga0500559_0052892 3300053136 Bacteria 1796
322 Ga0500564_044990 3300053138 Bacteria 2026
323 Ga0500585_245368 3300053144 Bacteria 571
324 Ga0500586_271074 3300053145 Bacteria 523
325 Ga0500590_225712 3300053148 Bacteria 768
326 Ga0500603_002056 3300053150 Bacteria 4446
327 Ga0500619_221201 3300053154 Bacteria 630
328 Ga0500622_0113588 3300053156 Bacteria 1320
329 Ga0500638_030300 3300053162 Bacteria 2605
330 Ga0500639_164717 3300053163 Bacteria 1003
331 Ga0500636_0157613 3300053177 Bacteria 1241
332 Ga0500637_0115236 3300053178 Bacteria 1559
333 Ga0500637_0381123 3300053178 Bacteria 739
334 Ga0500661_115888 3300055283 Bacteria 516

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053094 Ga0500566_0515028 Ga0500566_0515028_11_382 118
2 3300049584 Ga0501068_0165675 Ga0501068_0165675_388_801 129
3 3300049585 Ga0501069_0031697 Ga0501069_0031697_325_738 129
4 3300049586 Ga0501070_0103814 Ga0501070_0103814_843_1256 129
5 3300049586 Ga0501070_0130573 Ga0501070_0130573_1073_1486 129
6 3300049587 Ga0501071_0070110 Ga0501071_0070110_526_939 129
7 3300049588 Ga0501072_0322955 Ga0501072_0322955_738_1151 129
8 3300049742 Ga0501080_0073676 Ga0501080_0073676_2335_2748 129
9 3300049743 Ga0501081_0122061 Ga0501081_0122061_1203_1616 129
10 3300005618 Ga0068864_101457556 Ga0068864_1014575562 134
11 3300046471 Ga0495650_0027599 Ga0495650_0027599_1185_1637 136
12 3300053084 Ga0495595_0455135 Ga0495595_0455135_177_587 136
13 3300009101 Ga0105247_10480015 Ga0105247_104800152 137
14 3300013297 Ga0157378_10680762 Ga0157378_106807622 137
15 3300028380 Ga0268265_10102547 Ga0268265_101025472 137
16 3300028556 Ga0265337_1029284 Ga0265337_10292842 137
17 3300028558 Ga0265326_10061104 Ga0265326_100611042 137
18 3300028573 Ga0265334_10143603 Ga0265334_101436032 137
19 3300028577 Ga0265318_10102279 Ga0265318_101022792 137
20 3300028653 Ga0265323_10017072 Ga0265323_100170722 137
21 3300028653 Ga0265323_10039476 Ga0265323_100394762 137
22 3300028654 Ga0265322_10024666 Ga0265322_100246663 137
23 3300028800 Ga0265338_10062450 Ga0265338_100624503 137
24 3300028800 Ga0265338_10158397 Ga0265338_101583973 137
25 3300029957 Ga0265324_10006188 Ga0265324_100061883 137
26 3300031235 Ga0265330_10000936 Ga0265330_100009363 137
27 3300031235 Ga0265330_10001411 Ga0265330_100014113 137
28 3300031235 Ga0265330_10014650 Ga0265330_100146502 137
29 3300031235 Ga0265330_10156909 Ga0265330_101569092 137
30 3300031238 Ga0265332_10008915 Ga0265332_100089152 137
31 3300031240 Ga0265320_10056765 Ga0265320_100567652 137
32 3300031240 Ga0265320_10094946 Ga0265320_100949462 137
33 3300031241 Ga0265325_10002312 Ga0265325_100023123 137
34 3300031241 Ga0265325_10189710 Ga0265325_101897102 137
35 3300031242 Ga0265329_10000589 Ga0265329_1000058912 137
36 3300031247 Ga0265340_10000089 Ga0265340_1000008922 137
37 3300031249 Ga0265339_10054994 Ga0265339_100549943 137
38 3300031249 Ga0265339_10164814 Ga0265339_101648142 137
39 3300031250 Ga0265331_10011118 Ga0265331_100111183 137
40 3300031344 Ga0265316_10000286 Ga0265316_1000028619 137
41 3300031344 Ga0265316_10016042 Ga0265316_100160424 137
42 3300031344 Ga0265316_10029020 Ga0265316_100290201 137
43 3300031344 Ga0265316_10095737 Ga0265316_100957372 137
44 3300031344 Ga0265316_10249504 Ga0265316_102495042 137
45 3300031344 Ga0265316_10299713 Ga0265316_102997132 137
46 3300031595 Ga0265313_10013529 Ga0265313_100135293 137
47 3300031711 Ga0265314_10000256 Ga0265314_1000025645 137
48 3300031711 Ga0265314_10001627 Ga0265314_100016273 137
49 3300031712 Ga0265342_10000120 Ga0265342_1000012023 137
50 3300031712 Ga0265342_10000871 Ga0265342_1000087118 137
51 3300031712 Ga0265342_10001107 Ga0265342_100011074 137
52 3300031712 Ga0265342_10019551 Ga0265342_100195514 137
53 3300031712 Ga0265342_10097086 Ga0265342_100970863 137
54 3300005844 Ga0068862_100167481 Ga0068862_1001674813 138
55 3300028556 Ga0265337_1014367 Ga0265337_10143673 138
56 3300028558 Ga0265326_10119867 Ga0265326_101198671 138
57 3300028653 Ga0265323_10007722 Ga0265323_100077225 138
58 3300028653 Ga0265323_10019055 Ga0265323_100190551 138
59 3300028800 Ga0265338_10034433 Ga0265338_100344333 138
60 3300028800 Ga0265338_10587078 Ga0265338_105870782 138
61 3300029957 Ga0265324_10000150 Ga0265324_1000015015 138
62 3300031235 Ga0265330_10001227 Ga0265330_100012279 138
63 3300031235 Ga0265330_10004670 Ga0265330_100046703 138
64 3300031235 Ga0265330_10007249 Ga0265330_100072493 138
65 3300031238 Ga0265332_10051931 Ga0265332_100519312 138
66 3300031241 Ga0265325_10134779 Ga0265325_101347792 138
67 3300031242 Ga0265329_10000097 Ga0265329_1000009712 138
68 3300031242 Ga0265329_10121520 Ga0265329_101215202 138
69 3300031242 Ga0265329_10242335 Ga0265329_102423352 138
70 3300031249 Ga0265339_10000180 Ga0265339_1000018033 138
71 3300031249 Ga0265339_10033076 Ga0265339_100330763 138
72 3300031344 Ga0265316_10000010 Ga0265316_1000001015 138
73 3300031344 Ga0265316_10000573 Ga0265316_100005733 138
74 3300031344 Ga0265316_10000660 Ga0265316_1000066021 138
75 3300031344 Ga0265316_10033969 Ga0265316_100339692 138
76 3300031344 Ga0265316_10074821 Ga0265316_100748213 138
77 3300031344 Ga0265316_10095052 Ga0265316_100950522 138
78 3300031344 Ga0265316_10508817 Ga0265316_105088172 138
79 3300031595 Ga0265313_10019532 Ga0265313_100195323 138
80 3300031711 Ga0265314_10006926 Ga0265314_100069263 138
81 3300031712 Ga0265342_10000655 Ga0265342_1000065513 138
82 3300031712 Ga0265342_10016344 Ga0265342_100163443 138
83 3300031712 Ga0265342_10052669 Ga0265342_100526694 138
84 3300031712 Ga0265342_10194197 Ga0265342_101941972 138
85 3300048907 Ga0496104_0397716 Ga0496104_0397716_117_542 138
86 3300053094 Ga0500566_0001313 Ga0500566_0001313_12510_12938 138
87 3300053095 Ga0500640_000066 Ga0500640_000066_2348_2776 138
88 3300053102 Ga0500554_000079 Ga0500554_000079_14867_15295 138
89 3300053108 Ga0500562_057352 Ga0500562_057352_264_728 138
90 3300053111 Ga0500572_282400 Ga0500572_282400_20_448 138
91 3300053119 Ga0500595_000168 Ga0500595_000168_15845_16273 138
92 3300053120 Ga0500597_091737 Ga0500597_091737_638_1066 138
93 3300053123 Ga0500614_000453 Ga0500614_000453_91_519 138
94 3300053124 Ga0500617_206862 Ga0500617_206862_108_572 138
95 3300053136 Ga0500559_0052892 Ga0500559_0052892_290_718 138
96 3300053154 Ga0500619_221201 Ga0500619_221201_87_515 138
97 3300053156 Ga0500622_0113588 Ga0500622_0113588_187_651 138
98 3300053178 Ga0500637_0381123 Ga0500637_0381123_87_515 138
99 3300005334 Ga0068869_100984216 Ga0068869_1009842162 139
100 3300005334 Ga0068869_101141391 Ga0068869_1011413911 139
101 3300005343 Ga0070687_100325371 Ga0070687_1003253711 139
102 3300005530 Ga0070679_100031210 Ga0070679_1000312102 139
103 3300005535 Ga0070684_100880240 Ga0070684_1008802401 139
104 3300005536 Ga0070697_101372149 Ga0070697_1013721492 139
105 3300005614 Ga0068856_100161070 Ga0068856_1001610703 139
106 3300005937 Ga0081455_10258425 Ga0081455_102584253 139
107 3300009093 Ga0105240_11582369 Ga0105240_115823692 139
108 3300009098 Ga0105245_10000046 Ga0105245_1000004645 139
109 3300013296 Ga0157374_10538941 Ga0157374_105389412 139
110 3300013307 Ga0157372_13101430 Ga0157372_131014301 139
111 3300014969 Ga0157376_10013907 Ga0157376_100139075 139
112 3300021384 Ga0213876_10507916 Ga0213876_105079162 139
113 3300025921 Ga0207652_10179907 Ga0207652_101799072 139
114 3300025927 Ga0207687_10000034 Ga0207687_1000003486 139
115 3300025942 Ga0207689_10507958 Ga0207689_105079582 139
116 3300025944 Ga0207661_10314793 Ga0207661_103147932 139
117 3300026075 Ga0207708_10142152 Ga0207708_101421524 139
118 3300026078 Ga0207702_10543122 Ga0207702_105431222 139
119 3300028381 Ga0268264_10967060 Ga0268264_109670602 139
120 3300028577 Ga0265318_10218123 Ga0265318_102181231 139
121 3300031507 Ga0307509_10004505 Ga0307509_100045059 139
122 3300035090 Ga0373949_0002085 Ga0373949_0002085_4471_4926 139
123 3300035115 Ga0373941_0003810 Ga0373941_0003810_860_1288 139
124 3300039437 Ga0436365_0805369 Ga0436365_0805369_230_652 139
125 3300044694 Ga0466963_0278569 Ga0466963_0278569_726_1148 139
126 3300044694 Ga0466963_0582969 Ga0466963_0582969_169_594 139
127 3300046500 Ga0495596_0103289 Ga0495596_0103289_329_754 139
128 3300046517 Ga0495630_0689557 Ga0495630_0689557_53_481 139
129 3300046519 Ga0495632_0138907 Ga0495632_0138907_460_891 139
130 3300053090 Ga0500646_0095879 Ga0500646_0095879_338_778 139
131 3300005334 Ga0068869_100177130 Ga0068869_1001771302 140
132 3300005340 Ga0070689_101309966 Ga0070689_1013099662 140
133 3300005343 Ga0070687_100012426 Ga0070687_1000124261 140
134 3300005441 Ga0070700_100277568 Ga0070700_1002775682 140
135 3300005444 Ga0070694_100219358 Ga0070694_1002193582 140
136 3300005445 Ga0070708_101479483 Ga0070708_1014794832 140
137 3300005458 Ga0070681_11035615 Ga0070681_110356152 140
138 3300005459 Ga0068867_100769601 Ga0068867_1007696012 140
139 3300005535 Ga0070684_100244182 Ga0070684_1002441823 140
140 3300005544 Ga0070686_100374010 Ga0070686_1003740102 140
141 3300005545 Ga0070695_100052544 Ga0070695_1000525443 140
142 3300005546 Ga0070696_100938316 Ga0070696_1009383162 140
143 3300005617 Ga0068859_100927423 Ga0068859_1009274232 140
144 3300005718 Ga0068866_10268791 Ga0068866_102687912 140
145 3300005719 Ga0068861_100179544 Ga0068861_1001795442 140
146 3300005719 Ga0068861_100400427 Ga0068861_1004004271 140
147 3300005840 Ga0068870_10677786 Ga0068870_106777862 140
148 3300005841 Ga0068863_100021818 Ga0068863_1000218183 140
149 3300005843 Ga0068860_101307927 Ga0068860_1013079271 140
150 3300006028 Ga0070717_10187560 Ga0070717_101875603 140
151 3300006175 Ga0070712_100840640 Ga0070712_1008406402 140
152 3300006237 Ga0097621_100142109 Ga0097621_1001421093 140
153 3300006358 Ga0068871_100679791 Ga0068871_1006797912 140
154 3300006931 Ga0097620_100927327 Ga0097620_1009273272 140
155 3300007076 Ga0075435_101009005 Ga0075435_1010090052 140
156 3300009098 Ga0105245_10036465 Ga0105245_100364653 140
157 3300009148 Ga0105243_10753442 Ga0105243_107534422 140
158 3300014325 Ga0163163_10333852 Ga0163163_103338522 140
159 3300014969 Ga0157376_11399596 Ga0157376_113995962 140
160 3300025899 Ga0207642_10022704 Ga0207642_100227042 140
161 3300025908 Ga0207643_10636978 Ga0207643_106369782 140
162 3300025912 Ga0207707_11077852 Ga0207707_110778521 140
163 3300025936 Ga0207670_10505471 Ga0207670_105054711 140
164 3300025942 Ga0207689_10120694 Ga0207689_101206942 140
165 3300025942 Ga0207689_10137235 Ga0207689_101372353 140
166 3300026088 Ga0207641_10022356 Ga0207641_100223566 140
167 3300028794 Ga0307515_10035968 Ga0307515_100359686 140
168 3300031238 Ga0265332_10019090 Ga0265332_100190903 140
169 3300031456 Ga0307513_10018764 Ga0307513_100187643 140
170 3300031507 Ga0307509_10044812 Ga0307509_100448122 140
171 3300031507 Ga0307509_10174461 Ga0307509_101744613 140
172 3300031507 Ga0307509_10327257 Ga0307509_103272572 140
173 3300031616 Ga0307508_10006408 Ga0307508_100064084 140
174 3300031616 Ga0307508_10504301 Ga0307508_105043012 140
175 3300031730 Ga0307516_10508078 Ga0307516_105080782 140
176 3300031730 Ga0307516_10609524 Ga0307516_106095242 140
177 3300035114 Ga0373939_0202509 Ga0373939_0202509_140_571 140
178 3300035115 Ga0373941_0245726 Ga0373941_0245726_181_606 140
179 3300035115 Ga0373941_0249881 Ga0373941_0249881_188_619 140
180 3300035119 Ga0373956_0059247 Ga0373956_0059247_895_1326 140
181 3300035241 Ga0373961_0000126 Ga0373961_0000126_29175_29615 140
182 3300047472 Ga0495686_0057588 Ga0495686_0057588_550_978 140
183 3300048904 Ga0496101_0179106 Ga0496101_0179106_475_906 140
184 3300050512 nmdc:mga0n895_696302_c1 nmdc:mga0n895_696302_c1_156_587 140
185 3300050513 nmdc:mga0rr50_24943_c1 nmdc:mga0rr50_24943_c1_3489_3920 140
186 3300053080 Ga0500635_0002349 Ga0500635_0002349_2700_3140 140
187 3300053086 Ga0500578_0464603 Ga0500578_0464603_150_584 140
188 3300053092 Ga0500583_0126951 Ga0500583_0126951_376_807 140
189 3300053094 Ga0500566_0004900 Ga0500566_0004900_6250_6681 140
190 3300053094 Ga0500566_0040119 Ga0500566_0040119_1170_1622 140
191 3300053094 Ga0500566_0157412 Ga0500566_0157412_706_1137 140
192 3300053095 Ga0500640_000046 Ga0500640_000046_11652_12083 140
193 3300053102 Ga0500554_000030 Ga0500554_000030_6108_6539 140
194 3300053111 Ga0500572_144312 Ga0500572_144312_213_644 140
195 3300053119 Ga0500595_000073 Ga0500595_000073_17333_17764 140
196 3300053119 Ga0500595_022656 Ga0500595_022656_1771_2202 140
197 3300053123 Ga0500614_000103 Ga0500614_000103_12174_12605 140
198 3300053123 Ga0500614_027020 Ga0500614_027020_576_1007 140
199 3300053130 Ga0500642_0020397 Ga0500642_0020397_1764_2195 140
200 3300053133 Ga0500655_138249 Ga0500655_138249_29_457 140
201 3300053136 Ga0500559_0039083 Ga0500559_0039083_273_704 140
202 3300053138 Ga0500564_044990 Ga0500564_044990_356_796 140
203 3300053144 Ga0500585_245368 Ga0500585_245368_98_529 140
204 3300053145 Ga0500586_271074 Ga0500586_271074_63_494 140
205 3300053148 Ga0500590_225712 Ga0500590_225712_24_464 140
206 3300053150 Ga0500603_002056 Ga0500603_002056_1692_2132 140
207 3300053162 Ga0500638_030300 Ga0500638_030300_119_550 140
208 3300053163 Ga0500639_164717 Ga0500639_164717_483_914 140
209 3300053177 Ga0500636_0157613 Ga0500636_0157613_472_915 140
210 3300053178 Ga0500637_0115236 Ga0500637_0115236_1046_1477 140
211 3300055283 Ga0500661_115888 Ga0500661_115888_22_453 140
212 3300005329 Ga0070683_100018669 Ga0070683_1000186694 141
213 3300005329 Ga0070683_100423241 Ga0070683_1004232412 141
214 3300005338 Ga0068868_100324154 Ga0068868_1003241542 141
215 3300005343 Ga0070687_100752141 Ga0070687_1007521411 141
216 3300005354 Ga0070675_100956273 Ga0070675_1009562732 141
217 3300005356 Ga0070674_100452822 Ga0070674_1004528222 141
218 3300005365 Ga0070688_100143183 Ga0070688_1001431832 141
219 3300005436 Ga0070713_101149710 Ga0070713_1011497102 141
220 3300005437 Ga0070710_10068773 Ga0070710_100687733 141
221 3300005439 Ga0070711_100155902 Ga0070711_1001559023 141
222 3300005458 Ga0070681_10073906 Ga0070681_100739063 141
223 3300005467 Ga0070706_100003152 Ga0070706_1000031527 141
224 3300005518 Ga0070699_101202202 Ga0070699_1012022022 141
225 3300005535 Ga0070684_101042905 Ga0070684_1010429052 141
226 3300005719 Ga0068861_100795113 Ga0068861_1007951132 141
227 3300006028 Ga0070717_10858737 Ga0070717_108587372 141
228 3300006173 Ga0070716_100616676 Ga0070716_1006166762 141
229 3300006358 Ga0068871_101543314 Ga0068871_1015433142 141
230 3300006846 Ga0075430_100680519 Ga0075430_1006805192 141
231 3300006871 Ga0075434_101287842 Ga0075434_1012878422 141
232 3300007076 Ga0075435_100670437 Ga0075435_1006704372 141
233 3300009148 Ga0105243_10849809 Ga0105243_108498092 141
234 3300009553 Ga0105249_10060688 Ga0105249_100606883 141
235 3300013296 Ga0157374_10058597 Ga0157374_100585972 141
236 3300013296 Ga0157374_12036145 Ga0157374_120361451 141
237 3300025898 Ga0207692_10032969 Ga0207692_100329693 141
238 3300025898 Ga0207692_10457867 Ga0207692_104578672 141
239 3300025906 Ga0207699_10586901 Ga0207699_105869012 141
240 3300025910 Ga0207684_10035216 Ga0207684_100352162 141
241 3300025912 Ga0207707_10101889 Ga0207707_101018891 141
242 3300025916 Ga0207663_10061521 Ga0207663_100615213 141
243 3300025921 Ga0207652_11516516 Ga0207652_115165162 141
244 3300025928 Ga0207700_10656110 Ga0207700_106561102 141
245 3300025944 Ga0207661_10028299 Ga0207661_100282992 141
246 3300025944 Ga0207661_11096026 Ga0207661_110960262 141
247 3300025944 Ga0207661_11425127 Ga0207661_114251271 141
248 3300026023 Ga0207677_10334075 Ga0207677_103340752 141
249 3300026121 Ga0207683_10030393 Ga0207683_100303934 141
250 3300028563 Ga0265319_1026552 Ga0265319_10265523 141
251 3300028563 Ga0265319_1086202 Ga0265319_10862022 141
252 3300028577 Ga0265318_10000033 Ga0265318_1000003362 141
253 3300028577 Ga0265318_10347626 Ga0265318_103476261 141
254 3300028666 Ga0265336_10026121 Ga0265336_100261212 141
255 3300028800 Ga0265338_10007129 Ga0265338_100071291 141
256 3300028800 Ga0265338_10046956 Ga0265338_100469563 141
257 3300031235 Ga0265330_10000029 Ga0265330_1000002965 141
258 3300031238 Ga0265332_10000144 Ga0265332_1000014434 141
259 3300031238 Ga0265332_10016388 Ga0265332_100163882 141
260 3300031239 Ga0265328_10000381 Ga0265328_1000038113 141
261 3300031240 Ga0265320_10000062 Ga0265320_1000006267 141
262 3300031240 Ga0265320_10001835 Ga0265320_100018355 141
263 3300031240 Ga0265320_10077577 Ga0265320_100775772 141
264 3300031241 Ga0265325_10050669 Ga0265325_100506692 141
265 3300031242 Ga0265329_10066102 Ga0265329_100661022 141
266 3300031247 Ga0265340_10334064 Ga0265340_103340642 141
267 3300031249 Ga0265339_10003659 Ga0265339_100036594 141
268 3300031249 Ga0265339_10047811 Ga0265339_100478112 141
269 3300031249 Ga0265339_10116674 Ga0265339_101166742 141
270 3300031250 Ga0265331_10000079 Ga0265331_1000007959 141
271 3300031250 Ga0265331_10082922 Ga0265331_100829222 141
272 3300031344 Ga0265316_10043861 Ga0265316_100438613 141
273 3300031507 Ga0307509_10000111 Ga0307509_1000011139 141
274 3300031507 Ga0307509_10000248 Ga0307509_1000024830 141
275 3300031595 Ga0265313_10000114 Ga0265313_1000011416 141
276 3300031595 Ga0265313_10032581 Ga0265313_100325811 141
277 3300031595 Ga0265313_10366839 Ga0265313_103668392 141
278 3300031649 Ga0307514_10533311 Ga0307514_105333111 141
279 3300031711 Ga0265314_10000138 Ga0265314_1000013836 141
280 3300031711 Ga0265314_10015756 Ga0265314_100157562 141
281 3300031711 Ga0265314_10019860 Ga0265314_100198603 141
282 3300031712 Ga0265342_10001079 Ga0265342_1000107916 141
283 3300031712 Ga0265342_10001106 Ga0265342_100011066 141
284 3300031712 Ga0265342_10028667 Ga0265342_100286672 141
285 3300031730 Ga0307516_10034624 Ga0307516_100346243 141
286 3300035086 Ga0373934_0069634 Ga0373934_0069634_193_618 141
287 3300035118 Ga0373954_0012959 Ga0373954_0012959_1384_1812 141
288 3300035170 Ga0373943_0552431 Ga0373943_0552431_18_443 141
289 3300035170 Ga0373943_0874656 Ga0373943_0874656_42_470 141
290 3300035171 Ga0373946_0209739 Ga0373946_0209739_427_855 141
291 3300035172 Ga0373955_0091297 Ga0373955_0091297_580_1008 141
292 3300035172 Ga0373955_0319977 Ga0373955_0319977_395_820 141
293 3300035692 Ga0373935_0390418 Ga0373935_0390418_223_648 141
294 3300035692 Ga0373935_0474986 Ga0373935_0474986_66_491 141
295 3300035692 Ga0373935_1373118 Ga0373935_1373118_78_503 141
296 3300035695 Ga0373927_0325539 Ga0373927_0325539_191_616 141
297 3300035724 Ga0373933_0012901 Ga0373933_0012901_2471_2899 141
298 3300035724 Ga0373933_0041881 Ga0373933_0041881_712_1137 141
299 3300035724 Ga0373933_0256399 Ga0373933_0256399_678_1103 141
300 3300036401 Ga0373937_0038637 Ga0373937_0038637_267_695 141
301 3300036401 Ga0373937_0115528 Ga0373937_0115528_23_451 141
302 3300036401 Ga0373937_0357785 Ga0373937_0357785_40_465 141
303 3300037068 Ga0373925_0035166 Ga0373925_0035166_3194_3619 141
304 3300037068 Ga0373925_0130625 Ga0373925_0130625_1257_1685 141
305 3300037068 Ga0373925_0160499 Ga0373925_0160499_631_1056 141
306 3300037312 Ga0395899_0015193 Ga0395899_0015193_693_1121 141
307 3300037418 Ga0395900_0170728 Ga0395900_0170728_806_1234 141
308 3300038443 Ga0395901_0061948 Ga0395901_0061948_119_547 141
309 3300041463 Ga0451804_0192711 Ga0451804_0192711_216_644 141
310 3300045976 Ga0466967_0955913 Ga0466967_0955913_373_810 141
311 3300046455 Ga0495603_0583370 Ga0495603_0583370_166_591 141
312 3300046477 Ga0495664_0005836 Ga0495664_0005836_3870_4295 141
313 3300046516 Ga0495628_0698890 Ga0495628_0698890_223_648 141
314 3300046517 Ga0495630_0098735 Ga0495630_0098735_1592_2017 141
315 3300046529 Ga0495652_0555484 Ga0495652_0555484_30_458 141
316 3300046535 Ga0495586_0232490 Ga0495586_0232490_99_524 141
317 3300046642 Ga0495634_0002281 Ga0495634_0002281_3069_3494 141
318 3300046642 Ga0495634_0177872 Ga0495634_0177872_325_750 141
319 3300046675 Ga0495657_0082595 Ga0495657_0082595_52_480 141
320 3300046690 Ga0495624_0534064 Ga0495624_0534064_49_477 141
321 3300047319 Ga0495674_0003103 Ga0495674_0003103_3520_3945 141
322 3300047322 Ga0495680_0830235 Ga0495680_0830235_52_480 141
323 3300048904 Ga0496101_1213654 Ga0496101_1213654_138_563 141
324 3300048907 Ga0496104_0357342 Ga0496104_0357342_875_1300 141
325 3300048907 Ga0496104_1207004 Ga0496104_1207004_77_502 141
326 3300048915 Ga0496112_0083963 Ga0496112_0083963_1998_2423 141
327 3300048915 Ga0496112_0780521 Ga0496112_0780521_189_617 141
328 3300048917 Ga0496114_0526520 Ga0496114_0526520_181_606 141
329 3300048917 Ga0496114_0635084 Ga0496114_0635084_368_793 141
330 3300048918 Ga0496115_0663653 Ga0496115_0663653_136_561 141
331 3300050509 nmdc:mga0qj67_1002064_c1 nmdc:mga0qj67_1002064_c1_165_593 141
332 3300050509 nmdc:mga0qj67_190182_c1 nmdc:mga0qj67_190182_c1_178_606 141
333 3300053077 Ga0495601_0222846 Ga0495601_0222846_701_1129 141
334 3300053077 Ga0495601_0352144 Ga0495601_0352144_385_810 141

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

7

126

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.8609 58 130
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.8505 58 130
2pg3-assembly1.cif.gz_A-2 crystal structure of a queuosine biosynthesis protein quec (eca1155) from erwinia carotovora subsp. atroseptica scri1043 at 2.40 a resolution 0.8116 85 129
1gph-assembly1.cif.gz_1 structure of the allosteric regulatory enzyme of purine biosynthesis 0.773 97 130
1z7g-assembly1.cif.gz_A-2 free human hgprt 0.7727 96 128
ID Description Score Start End Superfamily
af_O74553_20_249_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7703 80 128 3.20.20.70
2jwlB00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.751 58 123 3.30.420.270
af_Q2FZX4_3_265_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7486 74 128 3.20.20.70
2pfuA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.7107 57 127 3.30.420.270
af_P60716_82_298_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7029 83 134 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A0C1GM14-F1-model_v4 Biopolymer transporter ExbD 0.8884 55 134 GO:0005886
GO:0015031
GO:0022857
AF-A0A519LWY9-F1-model_v4 Biopolymer transporter ExbD 0.8858 51 132 GO:0005886
GO:0015031
GO:0022857
AF-A0A7Z9FA47-F1-model_v4 Protein TolR 0.8679 51 133 GO:0005886
GO:0015031
GO:0022857
AF-A0A519LWY9-F1-model_v4 Biopolymer transporter ExbD 0.8569 51 132 GO:0005886
GO:0015031
GO:0022857
AF-A0A7Z9FA47-F1-model_v4 Protein TolR 0.8492 51 133 GO:0005886
GO:0015031
GO:0022857

Feature Viewer

pLDDT pTM Quality
76.15 0.52 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map