F411933

General Info

Members Datasets Scaffolds Average Seq Length
334 223 258 281

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0002388|Ga0495606_0002388_10322_11248
Length 308
Sequence MHFKYVTVKLPWSPRKPFQEIPMIIVTGATGQLGRIVIDQLLARGVPAAGIVAAVRNPAKAADFAARGIVVREADYARPETLEPAFAGAERVLLISSSEVGQRLSQHRVVIDAARKANARQLVYTSLLHADSSPLGLAGEHRDTEAAILASGLTHTILRNGWYTENYLASVPAARQHGAFIGAAGEGRIASATRKDYAAAAAAVLTQGVNGDKVYELAGDVAYTLAELVAELNRQTGGSVHYQNLPQADFAAALVGAGLPPPFAELLADSDAGAAKGALYDDSHQLSALIGRPTTPLAKAMKAALTAE

Samples

Sample ID Description Type Environment
1 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
2 2547132181 Kosakonia sacchari SP1 Isolate Stem
3 2547132512 Azospira oryzae 6a3 Isolate Unclassified
4 2561511199 Enterobacter sp. R4-368 Isolate Nodule
5 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
6 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
7 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
8 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
9 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
10 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
11 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
12 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
13 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
14 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
15 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
16 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
17 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
18 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
19 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
20 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
21 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
22 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
23 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
24 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
25 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
26 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
27 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
28 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
29 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
30 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
31 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
32 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
33 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
34 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
35 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
36 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
37 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
38 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
39 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
40 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
41 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
42 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
43 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
44 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
45 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
46 2636415599 Klebsiella variicola DX120E Isolate Unclassified
47 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
48 2643221638 Duganella sp. Root336D2 Isolate Unclassified
49 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
50 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
51 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
52 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
53 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
54 2775507074 Klebsiella sp. D5A Isolate Unclassified
55 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
56 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
57 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
58 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
59 2818991450 Burkholderia sp. 604 Isolate Unclassified
60 2876601092 Pantoea endophytica 596 Isolate Unclassified
61 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
62 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
63 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
64 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
65 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
66 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
67 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
68 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
69 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
70 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
71 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
72 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
73 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
74 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
75 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
76 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
77 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
78 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
79 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
80 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
81 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
82 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
83 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
84 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
85 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
86 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
87 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
88 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
89 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
90 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
91 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
92 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
93 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
94 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
95 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
96 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
97 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
110 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
111 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
112 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
113 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
114 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
117 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
120 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
130 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
134 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
135 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
136 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
137 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
138 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
141 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
142 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
143 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
144 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
145 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
146 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
147 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
148 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
149 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
150 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
151 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
152 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
153 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
154 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
155 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
156 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
157 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
158 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
163 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
164 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
165 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
166 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
167 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
168 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
169 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
170 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
171 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
172 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
173 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
174 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
175 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
176 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
177 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
178 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
179 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
180 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
181 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
182 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
183 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
184 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
187 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
188 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
189 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
190 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
195 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
196 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
197 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
198 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
199 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
200 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
201 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
202 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
203 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
204 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
205 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
206 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
209 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
210 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
211 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
212 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
213 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
214 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
215 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
216 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
217 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
218 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
219 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
220 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
221 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
222 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
223 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.25
Metatranscriptomes 0
Isolates 22.75

Biome Distribution

Category Percentage (%)
Aerial Root 0.6
Bulb 0
Endosphere 18.26
Nodule 1.5
Rhizoplane 14.37
Rhizosphere 46.41
Stem 0.3
Stem Tuber 0
Unclassified 18.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1001137 3300002739 Bacteria 4829
2 JGI25152J39213_1002807 3300002773 Bacteria 6292
3 JGI25152J39213_1017754 3300002773 Bacteria 1333
4 JGI25150J39212_1006968 3300002774 Bacteria 2299
5 JGI25159J45721_1000365 3300002987 Bacteria 21057
6 JGI25159J45721_1009244 3300002987 Bacteria 2617
7 rootL2_10159138 3300003322 Bacteria 2511
8 rootH1_10191020 3300003323 Bacteria 1013
9 JGI25161J50226_1000407 3300003374 Bacteria 21057
10 JGI25161J50226_1001312 3300003374 Bacteria 7803
11 Ga0055526_1026591 3300003771 Bacteria 1818
12 Ga0055526_1026643 3300003771 Bacteria 1814
13 Ga0055537_1001985 3300003773 Bacteria 7289
14 Ga0055524_1002578 3300003775 Bacteria 9237
15 Ga0055524_1003266 3300003775 Bacteria 7938
16 Ga0055524_1046379 3300003775 Bacteria 1034
17 Ga0055534_1001719 3300003784 Bacteria 8294
18 Ga0055534_1010030 3300003784 Bacteria 2010
19 Ga0055528_1021145 3300003790 Bacteria 2077
20 Ga0055530_10001783 3300003791 Bacteria 14969
21 Ga0055530_10005121 3300003791 Bacteria 6403
22 Ga0055531_10000818 3300003794 Bacteria 25805
23 Ga0055531_10028013 3300003794 Bacteria 1955
24 Ga0058692_1000088 3300003856 Bacteria 64251
25 Ga0058692_1000425 3300003856 Bacteria 19453
26 Ga0058692_1013074 3300003856 Bacteria 1946
27 Ga0055543_1000546 3300004625 Bacteria 21095
28 Ga0065165_1010796 3300005262 Bacteria 3894
29 Ga0068853_100013017 3300005539 Bacteria 6784
30 Ga0070665_100005069 3300005548 Bacteria 13668
31 Ga0068851_10082809 3300005834 Bacteria 1678
32 Ga0075366_10067166 3300006195 Bacteria 2134
33 Ga0079104_1000617 3300006946 Bacteria 34857
34 Ga0079104_1005403 3300006946 Bacteria 5115
35 Ga0105251_10004841 3300009011 Bacteria 8990
36 Ga0105251_10035055 3300009011 Bacteria 2478
37 Ga0105251_10051371 3300009011 Bacteria 1966
38 Ga0105251_10052378 3300009011 Bacteria 1943
39 Ga0105244_10031788 3300009036 Bacteria 2800
40 Ga0105244_10034325 3300009036 Bacteria 2671
41 Ga0105244_10048931 3300009036 Bacteria 2162
42 Ga0105250_10047670 3300009092 Bacteria 1718
43 Ga0105240_10007984 3300009093 Bacteria 15261
44 Ga0105238_10120336 3300009551 Bacteria 2605
45 Ga0105239_10042661 3300010375 Bacteria 4970
46 Ga0105246_10034116 3300011119 Bacteria 3387
47 Ga0105246_10598109 3300011119 Bacteria 952
48 Ga0157373_10001022 3300013100 Bacteria 21641
49 Ga0157371_10000586 3300013102 Bacteria 43215
50 Ga0157371_10005031 3300013102 Bacteria 11319
51 Ga0157371_10148058 3300013102 Bacteria 1674
52 Ga0157369_10010120 3300013105 Bacteria 10763
53 Ga0157369_10021142 3300013105 Bacteria 7276
54 Ga0163162_10021805 3300013306 Bacteria 6310
55 Ga0157372_10000169 3300013307 Bacteria 72057
56 Ga0157372_10028059 3300013307 Bacteria 6140
57 Ga0182006_1000025 3300015261 Bacteria 255969
58 Ga0163161_10140126 3300017792 Bacteria 1831
59 Ga0213872_10000073 3300021361 Bacteria 91302
60 Ga0213872_10012807 3300021361 Bacteria 3938
61 Ga0209436_100218 3300025208 Bacteria 26371
62 Ga0209436_100682 3300025208 Bacteria 14409
63 Ga0209437_100110 3300025233 Bacteria 215040
64 Ga0207425_1000001 3300025245 Bacteria 2525432
65 Ga0207425_1000109 3300025245 Bacteria 77611
66 Ga0207425_1000122 3300025245 Bacteria 73381
67 Ga0207425_1010532 3300025245 Bacteria 2246
68 Ga0207425_1019268 3300025245 Bacteria 1471
69 Ga0209129_1000003 3300025258 Bacteria 903689
70 Ga0209129_1000008 3300025258 Bacteria 640959
71 Ga0209129_1000964 3300025258 Bacteria 17293
72 Ga0209565_1000560 3300025263 Bacteria 25575
73 Ga0209565_1001427 3300025263 Bacteria 10566
74 Ga0209565_1001853 3300025263 Bacteria 8474
75 Ga0209565_1011866 3300025263 Bacteria 2102
76 Ga0209673_1013530 3300025273 Bacteria 3212
77 Ga0209130_1000171 3300025284 Bacteria 94371
78 Ga0209130_1001864 3300025284 Bacteria 12075
79 Ga0209675_1006570 3300025291 Bacteria 4632
80 Ga0209564_1000095 3300025295 Bacteria 237896
81 Ga0209564_1004770 3300025295 Bacteria 8098
82 Ga0209758_1000668 3300025297 Bacteria 51295
83 Ga0209050_1000011 3300025298 Bacteria 914037
84 Ga0209050_1002570 3300025298 Bacteria 15101
85 Ga0209050_1003063 3300025298 Bacteria 12876
86 Ga0209256_1000987 3300025299 Bacteria 34068
87 Ga0209256_1001953 3300025299 Bacteria 18689
88 Ga0209256_1002118 3300025299 Bacteria 17256
89 Ga0209051_1046146 3300025303 Bacteria 1501
90 Ga0209257_1000003 3300025304 Bacteria 1702593
91 Ga0209257_1004210 3300025304 Bacteria 11405
92 Ga0207696_1000232 3300025711 Bacteria 78423
93 Ga0207696_1009483 3300025711 Bacteria 3628
94 Ga0207696_1037597 3300025711 Bacteria 1432
95 Ga0207655_1002107 3300025728 Bacteria 16645
96 Ga0207655_1005438 3300025728 Bacteria 8659
97 Ga0207655_1012335 3300025728 Bacteria 5002
98 Ga0207655_1021796 3300025728 Bacteria 3236
99 Ga0207655_1028016 3300025728 Bacteria 2666
100 Ga0207713_1000028 3300025735 Bacteria 309074
101 Ga0207713_1015314 3300025735 Bacteria 3943
102 Ga0207713_1047916 3300025735 Bacteria 1725
103 Ga0207647_10003718 3300025904 Bacteria 11407
104 Ga0207695_10077572 3300025913 Bacteria 3374
105 Ga0209281_1000557 3300027111 Bacteria 45338
106 Ga0209281_1000592 3300027111 Bacteria 41903
107 Ga0209371_1000014 3300027312 Bacteria 661118
108 Ga0209371_1000046 3300027312 Bacteria 306549
109 Ga0209371_1000137 3300027312 Bacteria 120900
110 Ga0209371_1000184 3300027312 Bacteria 90920
111 Ga0209371_1000259 3300027312 Bacteria 64107
112 Ga0209371_1002911 3300027312 Bacteria 8939
113 Ga0209371_1004105 3300027312 Bacteria 6545
114 Ga0209371_1004399 3300027312 Bacteria 6167
115 Ga0209371_1031774 3300027312 Bacteria 1141
116 Ga0268266_10060533 3300028379 Bacteria 3264
117 Ga0268264_10208840 3300028381 Bacteria 1791
118 Ga0265337_1026979 3300028556 Bacteria 1735
119 Ga0265324_10000076 3300029957 Bacteria 76602
120 Ga0268256_1000012 3300030500 Bacteria 794553
121 Ga0268256_1000021 3300030500 Bacteria 542735
122 Ga0268256_1000062 3300030500 Bacteria 215802
123 Ga0268256_1000154 3300030500 Bacteria 91615
124 Ga0268256_1000510 3300030500 Bacteria 32695
125 Ga0268256_1002045 3300030500 Bacteria 10884
126 Ga0268256_1003849 3300030500 Bacteria 6545
127 Ga0268256_1004138 3300030500 Bacteria 6167
128 Ga0268256_1005430 3300030500 Bacteria 5002
129 Ga0268256_1018044 3300030500 Bacteria 1971
130 Ga0268256_1036065 3300030500 Bacteria 1143
131 Ga0265332_10000024 3300031238 Bacteria 209663
132 Ga0265339_10000086 3300031249 Bacteria 79034
133 Ga0307509_10023734 3300031507 Bacteria 6876
134 Ga0307408_100000140 3300031548 Bacteria 80709
135 Ga0307408_100001299 3300031548 Bacteria 18704
136 Ga0307408_100003513 3300031548 Bacteria 10675
137 Ga0265313_10002151 3300031595 Bacteria 17525
138 Ga0400484_33482 3300038725 Bacteria 2736
139 Ga0400485_05654 3300038735 Bacteria 11845
140 Ga0400485_15476 3300038735 Bacteria 17000
141 Ga0400488_33556 3300038741 Bacteria 5801
142 Ga0400488_37947 3300038741 Bacteria 5362
143 Ga0400486_16545 3300038742 Bacteria 17067
144 Ga0400486_31881 3300038742 Bacteria 17674
145 Ga0400489_00529 3300039093 Bacteria 8812
146 Ga0400487_06944 3300039110 Bacteria 16691
147 Ga0400487_54961 3300039110 Bacteria 48611
148 Ga0436361_0248769 3300039447 Bacteria 8364
149 Ga0436361_0736070 3300039447 Bacteria 84726
150 Ga0439438_022168 3300041405 Bacteria 1764
151 Ga0439447_002362 3300041407 Bacteria 6893
152 Ga0451800_0731357 3300041459 Unclassified 1342
153 Ga0439452_000005 3300042010 Bacteria 646919
154 Ga0439452_000007 3300042010 Bacteria 613625
155 Ga0439464_0013501 3300042439 Bacteria 2188
156 Ga0466969_0001080 3300044656 Bacteria 14743
157 Ga0466969_0071369 3300044656 Bacteria 1669
158 Ga0466966_0064145 3300044684 Bacteria 2314
159 Ga0466961_0023870 3300044693 Bacteria 3935
160 Ga0466963_0073040 3300044694 Bacteria 2312
161 Ga0466971_0004780 3300044719 Bacteria 5860
162 Ga0466971_0176122 3300044719 Bacteria 1004
163 Ga0466970_0102883 3300044765 Bacteria 1556
164 Ga0466970_0278609 3300044765 Bacteria 940
165 Ga0466959_0010748 3300045049 Bacteria 6557
166 Ga0466959_0258716 3300045049 Bacteria 1198
167 Ga0451576_0013435 3300045051 Bacteria 9162
168 Ga0451576_0121500 3300045051 Bacteria 2719
169 Ga0466958_0024149 3300045836 Bacteria 3576
170 Ga0466958_0062095 3300045836 Bacteria 2277
171 Ga0495627_019316 3300046453 Bacteria 2287
172 Ga0495592_0010299 3300046454 Bacteria 7049
173 Ga0495591_002246 3300046458 Bacteria 11002
174 Ga0495650_0000006 3300046471 Bacteria 721347
175 Ga0495650_0002709 3300046471 Bacteria 13735
176 Ga0495664_0115096 3300046477 Bacteria 1625
177 Ga0495606_0000748 3300046507 Bacteria 50196
178 Ga0495606_0002388 3300046507 Bacteria 22020
179 Ga0495610_0001373 3300046512 Bacteria 21636
180 Ga0495616_0009636 3300046513 Bacteria 5633
181 Ga0495618_0041261 3300046514 Bacteria 2906
182 Ga0495631_0000006 3300046518 Bacteria 132262
183 Ga0495643_0027005 3300046522 Bacteria 3231
184 Ga0495644_0013971 3300046523 Bacteria 3078
185 Ga0495648_0049305 3300046524 Bacteria 2582
186 Ga0495652_0000984 3300046529 Bacteria 32577
187 Ga0495654_0000168 3300046530 Bacteria 64288
188 Ga0495654_0003234 3300046530 Bacteria 10063
189 Ga0495640_0020228 3300046533 Bacteria 4901
190 Ga0495597_0053337 3300046542 Unclassified 1778
191 Ga0495645_0037735 3300046543 Bacteria 3523
192 Ga0495622_0000001 3300046557 Bacteria 365248
193 Ga0495611_0105733 3300046648 Bacteria 1309
194 Ga0495649_0106423 3300046694 Bacteria 1488
195 Ga0495589_0004074 3300046794 Bacteria 7831
196 Ga0495660_0000010 3300046810 Bacteria 370769
197 Ga0495674_0019218 3300047319 Bacteria 6346
198 Ga0495672_0000085 3300047320 Bacteria 156067
199 Ga0495683_0124338 3300047323 Bacteria 1221
200 Ga0495687_000255 3300047443 Bacteria 71830
201 Ga0495673_0000046 3300047469 Bacteria 274271
202 Ga0495673_0000086 3300047469 Bacteria 192268
203 Ga0495673_0018252 3300047469 Bacteria 3544
204 Ga0495602_0113998 3300048088 Bacteria 2190
205 Ga0496101_0000185 3300048904 Bacteria 49057
206 Ga0496102_0011653 3300048905 Bacteria 7588
207 Ga0496105_0059050 3300048908 Bacteria 3165
208 Ga0496105_0216001 3300048908 Bacteria 1562
209 Ga0496116_0117013 3300048919 Bacteria 1552
210 Ga0496117_0000043 3300048920 Bacteria 309583
211 Ga0496117_0002352 3300048920 Bacteria 24165
212 Ga0496117_0050490 3300048920 Bacteria 2949
213 Ga0496118_0000342 3300048921 Bacteria 79311
214 Ga0496118_0002507 3300048921 Bacteria 24636
215 Ga0496118_0003039 3300048921 Bacteria 21633
216 Ga0496118_0055826 3300048921 Bacteria 2975
217 Ga0496118_0208686 3300048921 Bacteria 1148
218 Ga0496119_0000059 3300048922 Bacteria 173056
219 Ga0496119_0000241 3300048922 Bacteria 77335
220 Ga0496119_0011119 3300048922 Bacteria 7496
221 Ga0496120_0000049 3300048923 Bacteria 187654
222 Ga0496120_0001287 3300048923 Bacteria 31253
223 Ga0496120_0036549 3300048923 Bacteria 2921
224 Ga0496121_0002301 3300048924 Bacteria 29625
225 Ga0496121_0177984 3300048924 Bacteria 1538
226 Ga0496122_0001334 3300048925 Bacteria 40363
227 Ga0496122_0011759 3300048925 Bacteria 8817
228 Ga0496122_0012574 3300048925 Bacteria 8404
229 Ga0496122_0024983 3300048925 Bacteria 5211
230 Ga0496122_0112904 3300048925 Bacteria 1777
231 Ga0496123_0001512 3300048926 Bacteria 32222
232 Ga0496123_0010578 3300048926 Bacteria 8127
233 Ga0496123_0021023 3300048926 Bacteria 5085
234 Ga0496123_0025862 3300048926 Bacteria 4411
235 Ga0496124_0005043 3300048927 Bacteria 15089
236 Ga0496124_0020265 3300048927 Bacteria 6152
237 Ga0496124_0064516 3300048927 Bacteria 3056
238 Ga0496125_0005126 3300048928 Bacteria 14741
239 Ga0496125_0008917 3300048928 Bacteria 10412
240 Ga0496126_0000065 3300048929 Bacteria 252549
241 Ga0496126_0096072 3300048929 Bacteria 2598
242 Ga0495678_000451 3300049459 Bacteria 40783
243 Ga0495682_0000024 3300049460 Bacteria 153545
244 Ga0501047_0164875 3300049581 Bacteria 2087
245 Ga0501069_0266373 3300049585 Bacteria 1001
246 Ga0501073_0006496 3300049589 Bacteria 8699
247 Ga0501080_0028970 3300049742 Bacteria 5155
248 nmdc:mga00v17_64599_c1 3300050491 Bacteria 2255
249 Ga0495601_0018187 3300053077 Bacteria 4274
250 Ga0495601_0066747 3300053077 Bacteria 2290
251 Ga0500578_0054713 3300053086 Bacteria 2555
252 Ga0500618_005769 3300053125 Bacteria 3723
253 Ga0500621_000007 3300053126 Bacteria 214505
254 Ga0500573_0023605 3300053140 Bacteria 3533
255 Ga0500616_0102463 3300053153 Bacteria 1396
256 Ga0501084_0380426 3300054114 Bacteria 1193
257 Ga0466962_0000767 3300061719 Bacteria 14401
258 Ga0466962_0011319 3300061719 Bacteria 4296

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041459 Ga0451800_0731357 Ga0451800_0731357_425_1216 200
2 3300002987 JGI25159J45721_1009244 JGI25159J45721_10092442 225
3 3300021361 Ga0213872_10012807 Ga0213872_100128074 237
4 3300039447 Ga0436361_0248769 Ga0436361_0248769_3600_4448 237
5 3300025263 Ga0209565_1011866 Ga0209565_10118663 239
6 3300031548 Ga0307408_100000140 Ga0307408_1000001404 239
7 3300053125 Ga0500618_005769 Ga0500618_005769_2245_3171 241
8 3300053153 Ga0500616_0102463 Ga0500616_0102463_459_1346 247
9 3300003856 Ga0058692_1000425 Ga0058692_100042516 255
10 3300006195 Ga0075366_10067166 Ga0075366_100671662 255
11 3300027312 Ga0209371_1000184 Ga0209371_100018421 255
12 3300030500 Ga0268256_1000154 Ga0268256_100015421 255
13 3300038741 Ga0400488_37947 Ga0400488_37947_3507_4361 258
14 3300031507 Ga0307509_10023734 Ga0307509_100237344 259
15 3300046543 Ga0495645_0037735 Ga0495645_0037735_1312_2172 259
16 3300002773 JGI25152J39213_1002807 JGI25152J39213_10028075 260
17 3300003775 Ga0055524_1046379 Ga0055524_10463792 260
18 3300025245 Ga0207425_1000001 Ga0207425_10000015 260
19 3300025258 Ga0209129_1000003 Ga0209129_10000035 260
20 3300025297 Ga0209758_1000668 Ga0209758_10006685 260
21 3300025299 Ga0209256_1000987 Ga0209256_10009872 260
22 3300005548 Ga0070665_100005069 Ga0070665_10000506912 262
23 3300028379 Ga0268266_10060533 Ga0268266_100605332 262
24 3300038735 Ga0400485_15476 Ga0400485_15476_4327_5181 262
25 3300038741 Ga0400488_33556 Ga0400488_33556_217_1071 262
26 3300038742 Ga0400486_16545 Ga0400486_16545_4405_5259 262
27 3300039093 Ga0400489_00529 Ga0400489_00529_7774_8628 262
28 3300039110 Ga0400487_06944 Ga0400487_06944_4555_5409 262
29 3300038742 Ga0400486_31881 Ga0400486_31881_11740_12642 263
30 3300049581 Ga0501047_0164875 Ga0501047_0164875_432_1307 263
31 3300049589 Ga0501073_0006496 Ga0501073_0006496_1777_2652 263
32 3300049742 Ga0501080_0028970 Ga0501080_0028970_4129_5004 263
33 3300054114 Ga0501084_0380426 Ga0501084_0380426_187_1062 263
34 3300009036 Ga0105244_10031788 Ga0105244_100317883 264
35 3300025728 Ga0207655_1005438 Ga0207655_10054384 264
36 3300028556 Ga0265337_1026979 Ga0265337_10269792 264
37 3300029957 Ga0265324_10000076 Ga0265324_1000007625 264
38 3300031249 Ga0265339_10000086 Ga0265339_1000008629 264
39 3300031595 Ga0265313_10002151 Ga0265313_1000215113 264
40 3300003322 rootL2_10159138 rootL2_101591383 265
41 3300003771 Ga0055526_1026643 Ga0055526_10266433 265
42 3300003775 Ga0055524_1002578 Ga0055524_10025789 265
43 3300003784 Ga0055534_1010030 Ga0055534_10100303 265
44 3300025295 Ga0209564_1000095 Ga0209564_1000095159 265
45 3300025299 Ga0209256_1001953 Ga0209256_10019536 265
46 3300003856 Ga0058692_1000088 Ga0058692_100008844 266
47 3300005539 Ga0068853_100013017 Ga0068853_1000130175 266
48 3300027312 Ga0209371_1000137 Ga0209371_100013780 266
49 3300030500 Ga0268256_1000062 Ga0268256_1000062106 266
50 3300038725 Ga0400484_33482 Ga0400484_33482_123_980 266
51 3300044765 Ga0466970_0278609 Ga0466970_0278609_56_898 266
52 iso_pu_bacteria 2547132181 2547697886 266
53 iso_pu_bacteria 2561511199 2562465666 266
54 iso_pu_bacteria 2599185169 2599412426 266
55 iso_pu_bacteria 2600255254 2601524861 266
56 iso_pu_bacteria 2600255255 2601530151 266
57 iso_pu_bacteria 2600255256 2601535674 266
58 iso_pu_bacteria 2600255257 2601541333 266
59 iso_pu_bacteria 2600255280 2601617245 266
60 iso_pu_bacteria 2600255281 2601622068 266
61 iso_pu_bacteria 2600255287 2601645613 266
62 iso_pu_bacteria 2600255288 2601650001 266
63 iso_pu_bacteria 2600255289 2601655291 266
64 iso_pu_bacteria 2600255290 2601660526 266
65 iso_pu_bacteria 2600255291 2601665752 266
66 iso_pu_bacteria 2600255298 2601698610 266
67 iso_pu_bacteria 2600255299 2601703761 266
68 iso_pu_bacteria 2600255300 2601708034 266
69 iso_pu_bacteria 2600255301 2601712991 266
70 iso_pu_bacteria 2600255302 2601718291 266
71 iso_pu_bacteria 2600255303 2601723697 266
72 iso_pu_bacteria 2600255304 2601728578 266
73 iso_pu_bacteria 2600255305 2601733239 266
74 iso_pu_bacteria 2600255306 2601737649 266
75 iso_pu_bacteria 2600255307 2601742034 266
76 iso_pu_bacteria 2600255309 2601752968 266
77 iso_pu_bacteria 2600255310 2601759711 266
78 iso_pu_bacteria 2600255311 2601762468 266
79 iso_pu_bacteria 2600255392 2602019456 266
80 iso_pu_bacteria 2602042046 2603641041 266
81 iso_pu_bacteria 2602042052 2603663286 266
82 iso_pu_bacteria 2602042053 2603668488 266
83 iso_pu_bacteria 2602042103 2603840920 266
84 iso_pu_bacteria 2602042104 2603846093 266
85 iso_pu_bacteria 2602042105 2603851067 266
86 iso_pu_bacteria 2602042106 2603856235 266
87 iso_pu_bacteria 2602042109 2603869175 266
88 iso_pu_bacteria 2602042110 2603873814 266
89 iso_pu_bacteria 2602042111 2603879116 266
90 iso_pu_bacteria 2603880178 2606050994 266
91 iso_pu_bacteria 2603880184 2606072911 266
92 iso_pu_bacteria 2603880202 2606148580 266
93 iso_pu_bacteria 2603880211 2606178886 266
94 iso_pu_bacteria 2636415599 2637227428 266
95 iso_pu_bacteria 2675903046 2676409265 266
96 iso_pu_bacteria 2775507074 2777021798 266
97 iso_pu_bacteria 2791355010 2792314238 266
98 iso_pu_bacteria 2791355275 2793407103 266
99 iso_pu_bacteria 2811995292 2813730900 266
100 iso_pu_bacteria 2814123068 2814698506 266
101 iso_pu_bacteria 2891670763 2891671675 266
102 iso_pu_bacteria 2896317667 2896318754 266
103 iso_pu_bacteria 2904513164 2904515766 266
104 iso_pu_bacteria 2935625433 2935627696 266
105 iso_pu_bacteria 2939617950 2939619895 266
106 iso_pu_bacteria 2969079654 2969084465 266
107 iso_pu_bacteria 2974435778 2974436715 266
108 iso_pu_bacteria 2984559226 2984561583 266
109 iso_pu_bacteria 2984595703 2984599648 266
110 iso_pu_bacteria 8019504834 8019506582 266
111 3300009551 Ga0105238_10120336 Ga0105238_101203363 267
112 iso_pu_bacteria 2547132512 2548846790 267
113 3300021361 Ga0213872_10000073 Ga0213872_1000007358 268
114 3300039447 Ga0436361_0736070 Ga0436361_0736070_30151_30996 268
115 iso_pu_bacteria 2511231025 2511381093 268
116 iso_pu_bacteria 2608642108 2608671095 268
117 iso_pu_bacteria 2643221554 2643787780 268
118 iso_pu_bacteria 2643221638 2644211889 268
119 iso_pu_bacteria 2667528174 2671113113 268
120 iso_pu_bacteria 2706794495 2707099152 268
121 iso_pu_bacteria 2818991450 2819619283 268
122 iso_pu_bacteria 2876601092 2876605394 268
123 iso_pu_bacteria 2881609920 2881612957 268
124 iso_pu_bacteria 2928503688 2928504688 268
125 iso_pu_bacteria 2939602548 2939605157 268
126 iso_pu_bacteria 8016733728 8016734509 268
127 iso_pu_bacteria 8019499862 8019503508 268
128 iso_pu_bacteria 8054844752 8054848295 268
129 3300003856 Ga0058692_1013074 Ga0058692_10130741 270
130 3300006946 Ga0079104_1000617 Ga0079104_100061710 270
131 3300006946 Ga0079104_1005403 Ga0079104_10054031 270
132 3300009011 Ga0105251_10051371 Ga0105251_100513711 270
133 3300009011 Ga0105251_10052378 Ga0105251_100523782 270
134 3300009036 Ga0105244_10048931 Ga0105244_100489312 270
135 3300013102 Ga0157371_10005031 Ga0157371_100050316 270
136 3300013105 Ga0157369_10010120 Ga0157369_100101209 270
137 3300013307 Ga0157372_10000169 Ga0157372_1000016925 270
138 3300015261 Ga0182006_1000025 Ga0182006_100002511 270
139 3300017792 Ga0163161_10140126 Ga0163161_101401262 270
140 3300025245 Ga0207425_1010532 Ga0207425_10105323 270
141 3300025258 Ga0209129_1000008 Ga0209129_1000008208 270
142 3300025711 Ga0207696_1009483 Ga0207696_10094835 270
143 3300025728 Ga0207655_1012335 Ga0207655_10123352 270
144 3300025735 Ga0207713_1047916 Ga0207713_10479162 270
145 3300027111 Ga0209281_1000557 Ga0209281_100055730 270
146 3300027111 Ga0209281_1000592 Ga0209281_100059227 270
147 3300027312 Ga0209371_1000014 Ga0209371_1000014390 270
148 3300027312 Ga0209371_1000046 Ga0209371_1000046242 270
149 3300027312 Ga0209371_1000259 Ga0209371_100025951 270
150 3300027312 Ga0209371_1002911 Ga0209371_10029114 270
151 3300028381 Ga0268264_10208840 Ga0268264_102088401 270
152 3300030500 Ga0268256_1000012 Ga0268256_1000012262 270
153 3300030500 Ga0268256_1000021 Ga0268256_1000021384 270
154 3300030500 Ga0268256_1000510 Ga0268256_100051025 270
155 3300030500 Ga0268256_1002045 Ga0268256_100204510 270
156 3300030500 Ga0268256_1018044 Ga0268256_10180441 270
157 3300042010 Ga0439452_000005 Ga0439452_000005_426252_427100 270
158 3300042010 Ga0439452_000007 Ga0439452_000007_435442_436290 270
159 3300042439 Ga0439464_0013501 Ga0439464_0013501_819_1667 270
160 3300045051 Ga0451576_0013435 Ga0451576_0013435_509_1363 270
161 3300046453 Ga0495627_019316 Ga0495627_019316_1327_2175 270
162 3300046530 Ga0495654_0003234 Ga0495654_0003234_7637_8485 270
163 3300047469 Ga0495673_0000046 Ga0495673_0000046_71674_72522 270
164 3300048908 Ga0496105_0216001 Ga0496105_0216001_45_893 270
165 3300048920 Ga0496117_0002352 Ga0496117_0002352_14812_15660 270
166 3300048920 Ga0496117_0050490 Ga0496117_0050490_1868_2716 270
167 3300048921 Ga0496118_0002507 Ga0496118_0002507_14681_15529 270
168 3300048922 Ga0496119_0000241 Ga0496119_0000241_65963_66811 270
169 3300048923 Ga0496120_0036549 Ga0496120_0036549_380_1228 270
170 3300048924 Ga0496121_0002301 Ga0496121_0002301_19622_20470 270
171 3300048925 Ga0496122_0024983 Ga0496122_0024983_796_1644 270
172 3300048925 Ga0496122_0112904 Ga0496122_0112904_19_867 270
173 3300048926 Ga0496123_0021023 Ga0496123_0021023_724_1572 270
174 3300048926 Ga0496123_0025862 Ga0496123_0025862_1087_1935 270
175 3300048927 Ga0496124_0005043 Ga0496124_0005043_4799_5647 270
176 3300048928 Ga0496125_0005126 Ga0496125_0005126_9441_10289 270
177 3300048928 Ga0496125_0008917 Ga0496125_0008917_2209_3057 270
178 3300048929 Ga0496126_0096072 Ga0496126_0096072_190_1038 270
179 3300031238 Ga0265332_10000024 Ga0265332_10000024123 271
180 3300038735 Ga0400485_05654 Ga0400485_05654_35_886 271
181 3300039110 Ga0400487_54961 Ga0400487_54961_38145_38996 271
182 3300046533 Ga0495640_0020228 Ga0495640_0020228_1715_2575 271
183 3300046557 Ga0495622_0000001 Ga0495622_0000001_313740_314588 271
184 3300049585 Ga0501069_0266373 Ga0501069_0266373_39_899 271
185 3300053140 Ga0500573_0023605 Ga0500573_0023605_480_1337 271
186 iso_pu_bacteria 2738541281 2738743490 271
187 iso_pu_bacteria 2738543032 2739352397 271
188 3300002739 JGI25158J39367_1001137 JGI25158J39367_10011373 272
189 3300002773 JGI25152J39213_1017754 JGI25152J39213_10177542 272
190 3300002774 JGI25150J39212_1006968 JGI25150J39212_10069683 272
191 3300002987 JGI25159J45721_1000365 JGI25159J45721_100036529 272
192 3300003323 rootH1_10191020 rootH1_101910201 272
193 3300003374 JGI25161J50226_1000407 JGI25161J50226_10004072 272
194 3300003374 JGI25161J50226_1001312 JGI25161J50226_10013129 272
195 3300003771 Ga0055526_1026591 Ga0055526_10265912 272
196 3300003773 Ga0055537_1001985 Ga0055537_10019856 272
197 3300003775 Ga0055524_1003266 Ga0055524_10032666 272
198 3300003784 Ga0055534_1001719 Ga0055534_10017197 272
199 3300003790 Ga0055528_1021145 Ga0055528_10211452 272
200 3300003791 Ga0055530_10001783 Ga0055530_1000178317 272
201 3300003791 Ga0055530_10005121 Ga0055530_100051217 272
202 3300003794 Ga0055531_10000818 Ga0055531_1000081823 272
203 3300003794 Ga0055531_10028013 Ga0055531_100280132 272
204 3300004625 Ga0055543_1000546 Ga0055543_100054629 272
205 3300005262 Ga0065165_1010796 Ga0065165_10107962 272
206 3300005834 Ga0068851_10082809 Ga0068851_100828091 272
207 3300009011 Ga0105251_10004841 Ga0105251_1000484111 272
208 3300009011 Ga0105251_10035055 Ga0105251_100350553 272
209 3300009036 Ga0105244_10034325 Ga0105244_100343251 272
210 3300009092 Ga0105250_10047670 Ga0105250_100476701 272
211 3300009093 Ga0105240_10007984 Ga0105240_100079844 272
212 3300010375 Ga0105239_10042661 Ga0105239_100426616 272
213 3300011119 Ga0105246_10034116 Ga0105246_100341164 272
214 3300011119 Ga0105246_10598109 Ga0105246_105981091 272
215 3300013100 Ga0157373_10001022 Ga0157373_1000102218 272
216 3300013102 Ga0157371_10000586 Ga0157371_1000058643 272
217 3300013102 Ga0157371_10148058 Ga0157371_101480583 272
218 3300013105 Ga0157369_10021142 Ga0157369_100211422 272
219 3300013306 Ga0163162_10021805 Ga0163162_100218052 272
220 3300013307 Ga0157372_10028059 Ga0157372_100280592 272
221 3300025208 Ga0209436_100218 Ga0209436_10021830 272
222 3300025208 Ga0209436_100682 Ga0209436_1006827 272
223 3300025233 Ga0209437_100110 Ga0209437_100110198 272
224 3300025245 Ga0207425_1000109 Ga0207425_100010977 272
225 3300025245 Ga0207425_1000122 Ga0207425_10001223 272
226 3300025245 Ga0207425_1019268 Ga0207425_10192681 272
227 3300025258 Ga0209129_1000964 Ga0209129_100096415 272
228 3300025263 Ga0209565_1000560 Ga0209565_100056011 272
229 3300025263 Ga0209565_1001427 Ga0209565_10014272 272
230 3300025263 Ga0209565_1001853 Ga0209565_10018537 272
231 3300025273 Ga0209673_1013530 Ga0209673_10135303 272
232 3300025284 Ga0209130_1000171 Ga0209130_10001712 272
233 3300025284 Ga0209130_1001864 Ga0209130_100186414 272
234 3300025291 Ga0209675_1006570 Ga0209675_10065704 272
235 3300025295 Ga0209564_1004770 Ga0209564_10047707 272
236 3300025298 Ga0209050_1000011 Ga0209050_1000011475 272
237 3300025298 Ga0209050_1002570 Ga0209050_100257017 272
238 3300025298 Ga0209050_1003063 Ga0209050_10030634 272
239 3300025299 Ga0209256_1002118 Ga0209256_10021182 272
240 3300025303 Ga0209051_1046146 Ga0209051_10461463 272
241 3300025304 Ga0209257_1000003 Ga0209257_10000031247 272
242 3300025304 Ga0209257_1004210 Ga0209257_100421012 272
243 3300025711 Ga0207696_1000232 Ga0207696_100023234 272
244 3300025711 Ga0207696_1037597 Ga0207696_10375973 272
245 3300025728 Ga0207655_1002107 Ga0207655_10021073 272
246 3300025728 Ga0207655_1021796 Ga0207655_10217965 272
247 3300025728 Ga0207655_1028016 Ga0207655_10280163 272
248 3300025735 Ga0207713_1000028 Ga0207713_100002893 272
249 3300025735 Ga0207713_1015314 Ga0207713_10153145 272
250 3300025904 Ga0207647_10003718 Ga0207647_1000371811 272
251 3300025913 Ga0207695_10077572 Ga0207695_100775723 272
252 3300027312 Ga0209371_1004105 Ga0209371_10041056 272
253 3300027312 Ga0209371_1004399 Ga0209371_10043995 272
254 3300027312 Ga0209371_1031774 Ga0209371_10317741 272
255 3300030500 Ga0268256_1003849 Ga0268256_10038492 272
256 3300030500 Ga0268256_1004138 Ga0268256_10041385 272
257 3300030500 Ga0268256_1005430 Ga0268256_10054304 272
258 3300030500 Ga0268256_1036065 Ga0268256_10360651 272
259 3300031548 Ga0307408_100001299 Ga0307408_1000012992 272
260 3300031548 Ga0307408_100003513 Ga0307408_10000351310 272
261 3300041405 Ga0439438_022168 Ga0439438_022168_94_951 272
262 3300041407 Ga0439447_002362 Ga0439447_002362_440_1297 272
263 3300044656 Ga0466969_0001080 Ga0466969_0001080_2916_3776 272
264 3300044656 Ga0466969_0071369 Ga0466969_0071369_609_1520 272
265 3300044684 Ga0466966_0064145 Ga0466966_0064145_1284_2144 272
266 3300044693 Ga0466961_0023870 Ga0466961_0023870_178_1038 272
267 3300044694 Ga0466963_0073040 Ga0466963_0073040_640_1551 272
268 3300044719 Ga0466971_0004780 Ga0466971_0004780_2571_3431 272
269 3300044719 Ga0466971_0176122 Ga0466971_0176122_50_961 272
270 3300044765 Ga0466970_0102883 Ga0466970_0102883_74_985 272
271 3300045049 Ga0466959_0010748 Ga0466959_0010748_4312_5172 272
272 3300045049 Ga0466959_0258716 Ga0466959_0258716_45_956 272
273 3300045051 Ga0451576_0121500 Ga0451576_0121500_647_1522 272
274 3300045836 Ga0466958_0024149 Ga0466958_0024149_2075_2935 272
275 3300045836 Ga0466958_0062095 Ga0466958_0062095_1220_2131 272
276 3300046454 Ga0495592_0010299 Ga0495592_0010299_4510_5370 272
277 3300046458 Ga0495591_002246 Ga0495591_002246_5630_6493 272
278 3300046471 Ga0495650_0000006 Ga0495650_0000006_691859_692713 272
279 3300046471 Ga0495650_0002709 Ga0495650_0002709_6244_7107 272
280 3300046477 Ga0495664_0115096 Ga0495664_0115096_647_1507 272
281 3300046507 Ga0495606_0000748 Ga0495606_0000748_7269_8132 272
282 3300046507 Ga0495606_0002388 Ga0495606_0002388_10322_11248 272
283 3300046512 Ga0495610_0001373 Ga0495610_0001373_20698_21618 272
284 3300046513 Ga0495616_0009636 Ga0495616_0009636_964_1827 272
285 3300046514 Ga0495618_0041261 Ga0495618_0041261_1104_1979 272
286 3300046518 Ga0495631_0000006 Ga0495631_0000006_103210_104130 272
287 3300046522 Ga0495643_0027005 Ga0495643_0027005_88_951 272
288 3300046523 Ga0495644_0013971 Ga0495644_0013971_1160_2023 272
289 3300046524 Ga0495648_0049305 Ga0495648_0049305_995_1858 272
290 3300046529 Ga0495652_0000984 Ga0495652_0000984_679_1539 272
291 3300046530 Ga0495654_0000168 Ga0495654_0000168_21948_22811 272
292 3300046542 Ga0495597_0053337 Ga0495597_0053337_363_1229 272
293 3300046648 Ga0495611_0105733 Ga0495611_0105733_126_989 272
294 3300046694 Ga0495649_0106423 Ga0495649_0106423_551_1414 272
295 3300046794 Ga0495589_0004074 Ga0495589_0004074_3305_4168 272
296 3300046810 Ga0495660_0000010 Ga0495660_0000010_256959_257822 272
297 3300047319 Ga0495674_0019218 Ga0495674_0019218_1861_2715 272
298 3300047320 Ga0495672_0000085 Ga0495672_0000085_147293_148156 272
299 3300047323 Ga0495683_0124338 Ga0495683_0124338_342_1205 272
300 3300047443 Ga0495687_000255 Ga0495687_000255_30611_31477 272
301 3300047469 Ga0495673_0000086 Ga0495673_0000086_135988_136851 272
302 3300047469 Ga0495673_0018252 Ga0495673_0018252_261_1115 272
303 3300048088 Ga0495602_0113998 Ga0495602_0113998_780_1640 272
304 3300048904 Ga0496101_0000185 Ga0496101_0000185_30126_30980 272
305 3300048905 Ga0496102_0011653 Ga0496102_0011653_2958_3815 272
306 3300048908 Ga0496105_0059050 Ga0496105_0059050_2261_3118 272
307 3300048919 Ga0496116_0117013 Ga0496116_0117013_516_1370 272
308 3300048920 Ga0496117_0000043 Ga0496117_0000043_207786_208643 272
309 3300048921 Ga0496118_0000342 Ga0496118_0000342_70764_71621 272
310 3300048921 Ga0496118_0003039 Ga0496118_0003039_13121_13975 272
311 3300048921 Ga0496118_0055826 Ga0496118_0055826_517_1398 272
312 3300048921 Ga0496118_0208686 Ga0496118_0208686_165_1022 272
313 3300048922 Ga0496119_0000059 Ga0496119_0000059_108201_109058 272
314 3300048922 Ga0496119_0011119 Ga0496119_0011119_1496_2350 272
315 3300048923 Ga0496120_0000049 Ga0496120_0000049_78597_79454 272
316 3300048923 Ga0496120_0001287 Ga0496120_0001287_12274_13128 272
317 3300048924 Ga0496121_0177984 Ga0496121_0177984_426_1283 272
318 3300048925 Ga0496122_0001334 Ga0496122_0001334_21427_22284 272
319 3300048925 Ga0496122_0011759 Ga0496122_0011759_797_1651 272
320 3300048925 Ga0496122_0012574 Ga0496122_0012574_2022_2888 272
321 3300048926 Ga0496123_0001512 Ga0496123_0001512_25206_26063 272
322 3300048926 Ga0496123_0010578 Ga0496123_0010578_5446_6300 272
323 3300048927 Ga0496124_0020265 Ga0496124_0020265_3949_4806 272
324 3300048927 Ga0496124_0064516 Ga0496124_0064516_1220_2077 272
325 3300048929 Ga0496126_0000065 Ga0496126_0000065_60779_61660 272
326 3300049459 Ga0495678_000451 Ga0495678_000451_7268_8131 272
327 3300049460 Ga0495682_0000024 Ga0495682_0000024_145183_146046 272
328 3300050491 nmdc:mga00v17_64599_c1 nmdc:mga00v17_64599_c1_248_1102 272
329 3300053077 Ga0495601_0018187 Ga0495601_0018187_755_1630 272
330 3300053077 Ga0495601_0066747 Ga0495601_0066747_1102_1962 272
331 3300053086 Ga0500578_0054713 Ga0500578_0054713_997_1869 272
332 3300053126 Ga0500621_000007 Ga0500621_000007_76810_77673 272
333 3300061719 Ga0466962_0000767 Ga0466962_0000767_2689_3549 272
334 3300061719 Ga0466962_0011319 Ga0466962_0011319_37_948 272

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05368

NmrA

NmrA-like family

24

244

0.87

PF13460

NAD_binding_10

NAD(P)H-binding

28

208

0.83

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

24

126

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zcv-assembly1.cif.gz_A crystal structure of nadph-dependent quinone oxidoreductase qor2 complexed with nadph from escherichia coli 0.9621 1 270
2zcv-assembly1.cif.gz_A crystal structure of nadph-dependent quinone oxidoreductase qor2 complexed with nadph from escherichia coli 0.9517 1 270
2vrb-assembly1.cif.gz_A-2 crystal structure of the citrobacter sp. triphenylmethane reductase complexed with nadp(h) 0.9261 1 268
2vrc-assembly1.cif.gz_C crystal structure of the citrobacter sp. triphenylmethane reductase complexed with nadp(h) 0.9216 2 268
2zcu-assembly1.cif.gz_A crystal structure of a new type of nadph-dependent quinone oxidoreductase (qor2) from escherichia coli 0.9212 1 270
ID Description Score Start End Superfamily
af_P39315_2_136_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9926 3 134 3.40.50.720
af_P39315_1_278_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9706 1 265 3.40.50.2300
af_P39315_2_136_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9635 3 134 3.40.50.720
2zcuA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.945 1 192 3.40.50.720
af_P39315_1_278_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9425 1 265 3.40.50.2300
ID Description Score Start End GO Terms
AF-L9LPG1-F1-model_v4 NADH(P)-binding protein, PF13460 family 0.9886 2 131
AF-A0A3L9I2Z5-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9878 1 91
AF-A0A4Q3FSL7-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9869 2 103
AF-A0A853BPS0-F1-model_v4 Uncharacterized protein YbjT (DUF2867 family) 0.9867 1 129
AF-A0A0L8QSE3-F1-model_v4 deleted 0.9867 1 101

Feature Viewer

pLDDT pTM Quality
90.85 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map