F411877

General Info

Members Datasets Scaffolds Average Seq Length
334 154 668 414

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0032760|Ga0395899_0032760_2539_3885
Length 448
Sequence VDLVGAGGLGDLIERERLNSGLRAAEGGMMMMTITRRGLLGGATASAALGLTGLARAAVRDAEALPHIPIPPPIGVAERLQRLAKARALMAANGIGAMIVEAGPSLDYFTGVQWWRSERLTAAVIPASGDPIIVTPFFEKPSVAETLAIPAEIRTWNEDEEPLKLVAAFLGERGAARDPVAFEETDRFFILDRLRQQLPGLRAVSGNPVVRGCRMIKSPAELALMQAAANITVAALSYAGKRTREGMTPGDVDALIAAAHKRMGGAYDGGLVLIGEASAYPHGSHKPQVVKRGEVVLMDCGCSVHGYQSDISRSFIFGADPSPEQRKVASQVRRGQDIAMAAAKVGAPAGSVDDAVRRAYESWGYGPGYKLPGTPHRTGHGIGMEGHEPVNLVHGEATALAPGMCFSNEPGIYLPGKFGIRFEDCFHMTEAGAKWFTVPPPSIDQPFA

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
61 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
97 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
98 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
99 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
100 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
115 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
116 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
117 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
118 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
119 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
120 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
123 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
124 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
125 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
126 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
127 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
128 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
129 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
144 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
146 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
147 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
148 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
151 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
152 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
153 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
154 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.1
Metatranscriptomes 0
Isolates 0.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.6
Nodule 0
Rhizoplane 4.49
Rhizosphere 93.71
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0032760 3300037312 Bacteria 3905
2 JGI24737J22298_10000494 3300001990 Bacteria 13696
3 JGI24735J21928_10024643 3300002067 Bacteria 1819
4 Ga0070658_10015176 3300005327 Bacteria 6163
5 Ga0070658_10051828 3300005327 Bacteria 3326
6 Ga0070658_10221589 3300005327 Bacteria 1600
7 Ga0070683_100218281 3300005329 Bacteria 1812
8 Ga0070670_100002831 3300005331 Bacteria 14347
9 Ga0070670_100014116 3300005331 Bacteria 6852
10 Ga0070670_100037442 3300005331 Bacteria 4174
11 Ga0070670_100145477 3300005331 Bacteria 2050
12 Ga0070677_10018742 3300005333 Bacteria 2497
13 Ga0070666_10002901 3300005335 Bacteria 10357
14 Ga0070666_10033256 3300005335 Bacteria 3411
15 Ga0070680_100002421 3300005336 Bacteria 13826
16 Ga0070682_100119422 3300005337 Bacteria 1767
17 Ga0070660_100000891 3300005339 Bacteria 19975
18 Ga0070660_100030800 3300005339 Bacteria 4026
19 Ga0070660_100032210 3300005339 Bacteria 3943
20 Ga0070660_100069291 3300005339 Bacteria 2750
21 Ga0070660_100084409 3300005339 Bacteria 2496
22 Ga0070661_100007804 3300005344 Bacteria 7387
23 Ga0070661_100021299 3300005344 Bacteria 4629
24 Ga0070661_100056739 3300005344 Bacteria 2870
25 Ga0070661_100079551 3300005344 Bacteria 2419
26 Ga0070661_100178231 3300005344 Bacteria 1616
27 Ga0070692_10123000 3300005345 Bacteria 1449
28 Ga0070668_100187920 3300005347 Bacteria 1691
29 Ga0070669_100015016 3300005353 Bacteria 5522
30 Ga0070675_100003699 3300005354 Bacteria 11622
31 Ga0070675_100016552 3300005354 Bacteria 5854
32 Ga0070675_100020995 3300005354 Bacteria 5215
33 Ga0070671_100000229 3300005355 Bacteria 37462
34 Ga0070671_100000446 3300005355 Bacteria 28672
35 Ga0070671_100074188 3300005355 Bacteria 2842
36 Ga0070674_100087557 3300005356 Bacteria 2240
37 Ga0070673_100002722 3300005364 Bacteria 10843
38 Ga0070673_100009513 3300005364 Bacteria 6526
39 Ga0070673_100198738 3300005364 Bacteria 1726
40 Ga0070659_100025441 3300005366 Bacteria 4546
41 Ga0070659_100042316 3300005366 Bacteria 3561
42 Ga0070659_100055599 3300005366 Bacteria 3120
43 Ga0070659_100080597 3300005366 Bacteria 2599
44 Ga0070659_100143074 3300005366 Bacteria 1947
45 Ga0070659_100168913 3300005366 Bacteria 1791
46 Ga0070659_100269121 3300005366 Bacteria 1415
47 Ga0070667_100007606 3300005367 Bacteria 8985
48 Ga0070663_100000577 3300005455 Bacteria 19595
49 Ga0070678_100035190 3300005456 Bacteria 3494
50 Ga0070678_100035984 3300005456 Bacteria 3462
51 Ga0070678_100090082 3300005456 Bacteria 2350
52 Ga0070678_100137443 3300005456 Bacteria 1951
53 Ga0070662_100010153 3300005457 Bacteria 6169
54 Ga0070662_100014746 3300005457 Bacteria 5223
55 Ga0070662_100052559 3300005457 Bacteria 2946
56 Ga0070662_100105047 3300005457 Bacteria 2144
57 Ga0070681_10076740 3300005458 Bacteria 3299
58 Ga0070681_10144286 3300005458 Bacteria 2310
59 Ga0070684_100202107 3300005535 Bacteria 1810
60 Ga0068853_100323729 3300005539 Bacteria 1429
61 Ga0070672_100051905 3300005543 Bacteria 3200
62 Ga0070672_100167333 3300005543 Bacteria 1826
63 Ga0070665_100108268 3300005548 Bacteria 2781
64 Ga0068855_100080244 3300005563 Bacteria 3783
65 Ga0070664_100007048 3300005564 Bacteria 9070
66 Ga0070664_100022382 3300005564 Bacteria 5210
67 Ga0070664_100057884 3300005564 Bacteria 3296
68 Ga0068854_100025097 3300005578 Bacteria 4089
69 Ga0068856_100104165 3300005614 Bacteria 2831
70 Ga0068852_100047125 3300005616 Bacteria 3675
71 Ga0068852_100135861 3300005616 Bacteria 2270
72 Ga0068859_100139477 3300005617 Bacteria 2498
73 Ga0068864_100146419 3300005618 Bacteria 2136
74 Ga0068851_10002008 3300005834 Bacteria 8964
75 Ga0068863_100004857 3300005841 Bacteria 13244
76 Ga0068863_100005862 3300005841 Bacteria 12035
77 Ga0068863_100013905 3300005841 Bacteria 7760
78 Ga0068863_100047391 3300005841 Bacteria 4076
79 Ga0068863_100245376 3300005841 Bacteria 1729
80 Ga0068858_100001758 3300005842 Bacteria 22091
81 Ga0081539_10022686 3300005985 Bacteria 4140
82 Ga0070712_100006801 3300006175 Bacteria 7117
83 Ga0075366_10108397 3300006195 Bacteria 1670
84 Ga0075428_100003424 3300006844 Bacteria 17356
85 Ga0075430_100032946 3300006846 Bacteria 4398
86 Ga0075431_100000006 3300006847 Bacteria 102881
87 Ga0075429_100001331 3300006880 Bacteria 20169
88 Ga0097620_100139484 3300006931 Bacteria 2498
89 Ga0111539_10014184 3300009094 Bacteria 9950
90 Ga0114129_10020757 3300009147 Bacteria 9335
91 Ga0105248_10009385 3300009177 Bacteria 10771
92 Ga0105248_10011744 3300009177 Bacteria 9660
93 Ga0105248_10015284 3300009177 Bacteria 8464
94 Ga0105248_10087745 3300009177 Bacteria 3501
95 Ga0105248_10198170 3300009177 Bacteria 2262
96 Ga0105248_10461136 3300009177 Bacteria 1432
97 Ga0157371_10061797 3300013102 Bacteria 2656
98 Ga0157371_10084980 3300013102 Bacteria 2242
99 Ga0157370_10065544 3300013104 Bacteria 3436
100 Ga0157369_10315273 3300013105 Bacteria 1626
101 Ga0157374_10078090 3300013296 Bacteria 3135
102 Ga0163162_10049228 3300013306 Bacteria 4224
103 Ga0163162_10064037 3300013306 Bacteria 3721
104 Ga0163162_10118719 3300013306 Bacteria 2747
105 Ga0163162_10127069 3300013306 Bacteria 2656
106 Ga0157375_10000296 3300013308 Bacteria 45207
107 Ga0157375_10015362 3300013308 Bacteria 6851
108 Ga0163163_10380881 3300014325 Bacteria 1468
109 Ga0157380_10008156 3300014326 Bacteria 7460
110 Ga0157379_10205951 3300014968 Bacteria 1779
111 Ga0183363_1001 3300015690 Bacteria 611534
112 Ga0207682_10020987 3300025893 Bacteria 2568
113 Ga0207647_10095470 3300025904 Bacteria 1770
114 Ga0207705_10000205 3300025909 Bacteria 59773
115 Ga0207705_10001949 3300025909 Bacteria 16132
116 Ga0207705_10083088 3300025909 Bacteria 2336
117 Ga0207660_10041286 3300025917 Bacteria 3232
118 Ga0207657_10001024 3300025919 Bacteria 29655
119 Ga0207657_10008345 3300025919 Bacteria 10525
120 Ga0207657_10060151 3300025919 Bacteria 3261
121 Ga0207657_10074144 3300025919 Bacteria 2874
122 Ga0207649_10005079 3300025920 Bacteria 7114
123 Ga0207649_10029802 3300025920 Bacteria 3226
124 Ga0207649_10163902 3300025920 Bacteria 1542
125 Ga0207652_10000270 3300025921 Bacteria 54010
126 Ga0207652_10100910 3300025921 Bacteria 2548
127 Ga0207652_10260174 3300025921 Bacteria 1565
128 Ga0207681_10034317 3300025923 Bacteria 3335
129 Ga0207650_10001305 3300025925 Bacteria 18070
130 Ga0207659_10003386 3300025926 Bacteria 9558
131 Ga0207644_10000571 3300025931 Bacteria 23623
132 Ga0207644_10001415 3300025931 Bacteria 15455
133 Ga0207644_10001719 3300025931 Bacteria 14149
134 Ga0207644_10049541 3300025931 Bacteria 3008
135 Ga0207644_10090928 3300025931 Bacteria 2275
136 Ga0207690_10008892 3300025932 Bacteria 5962
137 Ga0207690_10021909 3300025932 Bacteria 3969
138 Ga0207690_10024367 3300025932 Bacteria 3790
139 Ga0207690_10033987 3300025932 Bacteria 3282
140 Ga0207706_10000143 3300025933 Bacteria 77680
141 Ga0207706_10005084 3300025933 Bacteria 12283
142 Ga0207706_10011200 3300025933 Bacteria 8176
143 Ga0207706_10040466 3300025933 Bacteria 4130
144 Ga0207706_10073336 3300025933 Bacteria 3010
145 Ga0207706_10104969 3300025933 Bacteria 2486
146 Ga0207706_10165810 3300025933 Bacteria 1941
147 Ga0207706_10180095 3300025933 Bacteria 1856
148 Ga0207706_10219686 3300025933 Bacteria 1664
149 Ga0207669_10005594 3300025937 Bacteria 5658
150 Ga0207669_10029753 3300025937 Bacteria 3025
151 Ga0207691_10039344 3300025940 Bacteria 4375
152 Ga0207691_10095899 3300025940 Bacteria 2652
153 Ga0207691_10232301 3300025940 Bacteria 1597
154 Ga0207711_10010120 3300025941 Bacteria 7835
155 Ga0207711_10016125 3300025941 Bacteria 6202
156 Ga0207711_10129005 3300025941 Bacteria 2265
157 Ga0207689_10146205 3300025942 Bacteria 1948
158 Ga0207661_10095964 3300025944 Bacteria 2480
159 Ga0207661_10140201 3300025944 Bacteria 2080
160 Ga0207679_10019959 3300025945 Bacteria 4514
161 Ga0207679_10052617 3300025945 Bacteria 2987
162 Ga0207679_10111793 3300025945 Bacteria 2157
163 Ga0207651_10014899 3300025960 Bacteria 4502
164 Ga0207651_10015442 3300025960 Bacteria 4437
165 Ga0207651_10022301 3300025960 Bacteria 3868
166 Ga0207640_10047571 3300025981 Bacteria 2768
167 Ga0207658_10023339 3300025986 Bacteria 4317
168 Ga0207658_10066608 3300025986 Bacteria 2709
169 Ga0207658_10164577 3300025986 Bacteria 1821
170 Ga0207677_10056583 3300026023 Bacteria 2688
171 Ga0207639_10123085 3300026041 Bacteria 2134
172 Ga0207678_10000745 3300026067 Bacteria 29748
173 Ga0207678_10001279 3300026067 Bacteria 23238
174 Ga0207678_10011495 3300026067 Bacteria 7775
175 Ga0207678_10022970 3300026067 Bacteria 5458
176 Ga0207678_10027277 3300026067 Bacteria 4980
177 Ga0207678_10059000 3300026067 Bacteria 3302
178 Ga0207702_10041807 3300026078 Bacteria 3843
179 Ga0207641_10017110 3300026088 Bacteria 5932
180 Ga0207648_10023347 3300026089 Bacteria 5543
181 Ga0207676_10007390 3300026095 Bacteria 7793
182 Ga0207676_10031753 3300026095 Bacteria 3973
183 Ga0207674_10000347 3300026116 Bacteria 59568
184 Ga0207683_10004977 3300026121 Bacteria 11426
185 Ga0207683_10010924 3300026121 Bacteria 7746
186 Ga0207683_10099040 3300026121 Bacteria 2601
187 Ga0207683_10213402 3300026121 Bacteria 1757
188 Ga0207698_10102956 3300026142 Bacteria 2371
189 Ga0207428_10000684 3300027907 Bacteria 39601
190 Ga0268266_10069898 3300028379 Bacteria 3043
191 Ga0268264_10052618 3300028381 Bacteria 3395
192 Ga0316182_1246356 3300030745 Bacteria 3188
193 Ga0307408_100032303 3300031548 Bacteria 3648
194 Ga0307408_100040389 3300031548 Bacteria 3303
195 Ga0307408_100073905 3300031548 Bacteria 2528
196 Ga0307408_100113010 3300031548 Bacteria 2090
197 Ga0307405_10012707 3300031731 Bacteria 4469
198 Ga0307405_10042991 3300031731 Bacteria 2753
199 Ga0307405_10073157 3300031731 Bacteria 2211
200 Ga0307413_10060423 3300031824 Bacteria 2333
201 Ga0307413_10064950 3300031824 Bacteria 2270
202 Ga0307410_10007392 3300031852 Bacteria 6011
203 Ga0307410_10009464 3300031852 Bacteria 5463
204 Ga0307410_10031360 3300031852 Bacteria 3410
205 Ga0307406_10001980 3300031901 Bacteria 11194
206 Ga0307406_10026941 3300031901 Bacteria 3457
207 Ga0307407_10006432 3300031903 Bacteria 5220
208 Ga0307407_10013420 3300031903 Bacteria 3976
209 Ga0307407_10017875 3300031903 Bacteria 3571
210 Ga0307407_10023077 3300031903 Bacteria 3241
211 Ga0307407_10041795 3300031903 Bacteria 2566
212 Ga0307412_10028407 3300031911 Bacteria 3498
213 Ga0307412_10029441 3300031911 Bacteria 3446
214 Ga0307412_10041218 3300031911 Bacteria 2991
215 Ga0307412_10042143 3300031911 Bacteria 2963
216 Ga0307412_10093070 3300031911 Bacteria 2114
217 Ga0307412_10159250 3300031911 Bacteria 1675
218 Ga0307409_100044986 3300031995 Bacteria 3329
219 Ga0307409_100065050 3300031995 Bacteria 2867
220 Ga0307409_100085769 3300031995 Bacteria 2560
221 Ga0307409_100100716 3300031995 Bacteria 2395
222 Ga0307409_100130637 3300031995 Bacteria 2145
223 Ga0307416_100025827 3300032002 Bacteria 4315
224 Ga0307416_100063306 3300032002 Bacteria 3028
225 Ga0307414_10034404 3300032004 Bacteria 3359
226 Ga0307414_10042359 3300032004 Bacteria 3092
227 Ga0307414_10062055 3300032004 Bacteria 2650
228 Ga0307414_10131395 3300032004 Bacteria 1944
229 Ga0307414_10183969 3300032004 Bacteria 1683
230 Ga0307414_10200214 3300032004 Bacteria 1623
231 Ga0307414_10262680 3300032004 Bacteria 1441
232 Ga0307411_10005695 3300032005 Bacteria 6153
233 Ga0307411_10013345 3300032005 Bacteria 4530
234 Ga0307411_10025524 3300032005 Bacteria 3542
235 Ga0307411_10222464 3300032005 Bacteria 1465
236 Ga0307415_100011843 3300032126 Bacteria 5014
237 Ga0307415_100031870 3300032126 Bacteria 3402
238 Ga0307415_100035162 3300032126 Bacteria 3271
239 Ga0307415_100055730 3300032126 Bacteria 2706
240 Ga0307415_100117244 3300032126 Bacteria 1988
241 Ga0395899_0055272 3300037312 Bacteria 2936
242 Ga0395899_0268966 3300037312 Bacteria 1163
243 Ga0395900_0005503 3300037418 Bacteria 13257
244 Ga0395900_0017027 3300037418 Bacteria 7419
245 Ga0395900_0050714 3300037418 Bacteria 4274
246 Ga0395900_0055796 3300037418 Bacteria 4067
247 Ga0395900_0170856 3300037418 Bacteria 2213
248 Ga0395900_0171001 3300037418 Bacteria 2212
249 Ga0395900_0210536 3300037418 Bacteria 1963
250 Ga0395900_0299546 3300037418 Bacteria 1595
251 Ga0395900_0344007 3300037418 Bacteria 1466
252 Ga0395900_0440128 3300037418 Unclassified 1261
253 Ga0395898_0004303 3300037466 Bacteria 15595
254 Ga0395898_0008652 3300037466 Bacteria 10737
255 Ga0395898_0160917 3300037466 Bacteria 2147
256 Ga0395905_0002188 3300037471 Bacteria 22082
257 Ga0395905_0003075 3300037471 Bacteria 18051
258 Ga0395905_0004506 3300037471 Bacteria 14438
259 Ga0395905_0009106 3300037471 Bacteria 9727
260 Ga0395905_0012104 3300037471 Bacteria 8311
261 Ga0395905_0013290 3300037471 Bacteria 7895
262 Ga0395905_0020950 3300037471 Bacteria 6191
263 Ga0395905_0024216 3300037471 Bacteria 5729
264 Ga0395905_0028583 3300037471 Bacteria 5256
265 Ga0395905_0032754 3300037471 Bacteria 4886
266 Ga0395905_0097841 3300037471 Bacteria 2755
267 Ga0395905_0148867 3300037471 Bacteria 2202
268 Ga0395901_0003488 3300038443 Bacteria 15846
269 Ga0395901_0010965 3300038443 Bacteria 9181
270 Ga0395901_0012700 3300038443 Bacteria 8543
271 Ga0395901_0021721 3300038443 Bacteria 6576
272 Ga0395901_0031077 3300038443 Bacteria 5505
273 Ga0395901_0073234 3300038443 Bacteria 3572
274 Ga0395901_0102418 3300038443 Bacteria 3005
275 Ga0395901_0129393 3300038443 Bacteria 2653
276 Ga0395901_0200325 3300038443 Bacteria 2093
277 Ga0436365_1435754 3300039437 Bacteria 20552
278 Ga0439432_011899 3300042006 Bacteria 2990
279 Ga0439458_0003653 3300042157 Bacteria 3578
280 Ga0466963_0060451 3300044694 Bacteria 2530
281 Ga0466971_0007432 3300044719 Bacteria 4773
282 Ga0466970_0017665 3300044765 Bacteria 3687
283 Ga0466957_0034038 3300044842 Bacteria 3056
284 Ga0466958_0011957 3300045836 Bacteria 4904
285 Ga0466958_0031846 3300045836 Bacteria 3134
286 Ga0466967_0015589 3300045976 Bacteria 5960
287 Ga0466967_0051945 3300045976 Bacteria 3595
288 Ga0466967_0056079 3300045976 Bacteria 3473
289 Ga0466967_0076954 3300045976 Bacteria 3002
290 Ga0495585_0025327 3300046492 Bacteria 3400
291 Ga0495663_0001043 3300046525 Bacteria 9120
292 Ga0495621_0001464 3300046539 Bacteria 6119
293 Ga0495621_0002910 3300046539 Bacteria 4663
294 Ga0495621_0024445 3300046539 Bacteria 2018
295 Ga0495633_0007069 3300046558 Bacteria 6529
296 Ga0495668_0004840 3300046616 Bacteria 9368
297 Ga0495668_0031763 3300046616 Bacteria 2975
298 Ga0495669_0000293 3300046684 Bacteria 28317
299 Ga0495669_0004263 3300046684 Bacteria 5896
300 Ga0495669_0008723 3300046684 Bacteria 4269
301 Ga0495669_0076858 3300046684 Bacteria 1528
302 Ga0495670_0002800 3300046691 Bacteria 8627
303 Ga0496100_0139259 3300048903 Bacteria 1718
304 Ga0496100_0181719 3300048903 Bacteria 1521
305 Ga0496101_0054434 3300048904 Bacteria 2889
306 Ga0496107_0025712 3300048910 Bacteria 4169
307 Ga0496107_0126070 3300048910 Bacteria 1888
308 Ga0496108_0037388 3300048911 Bacteria 4043
309 Ga0496108_0092281 3300048911 Bacteria 2574
310 Ga0496109_0013334 3300048912 Bacteria 7124
311 Ga0496109_0121352 3300048912 Bacteria 2435
312 Ga0496110_0002276 3300048913 Bacteria 14346
313 Ga0496111_0002996 3300048914 Bacteria 10342
314 Ga0496112_0004501 3300048915 Bacteria 11828
315 Ga0496112_0034547 3300048915 Bacteria 4921
316 Ga0496112_0268783 3300048915 Bacteria 1653
317 Ga0496113_0074540 3300048916 Bacteria 2587
318 Ga0501034_0086607 3300049571 Bacteria 3133
319 Ga0501043_0018840 3300049579 Bacteria 5417
320 Ga0501046_0184715 3300049580 Bacteria 1557
321 Ga0501047_0000490 3300049581 Bacteria 43118
322 Ga0501048_0035673 3300049582 Bacteria 3579
323 Ga0501249_000049 3300049679 Bacteria 50472
324 Ga0501035_0081553 3300049822 Bacteria 2855
325 Ga0501044_0083257 3300049823 Bacteria 3236
326 nmdc:mga05p37_2203_c1 3300050507 Bacteria 22686
327 nmdc:mga09592_308_c1 3300050508 Bacteria 35779
328 nmdc:mga06r32_6941_c1 3300050510 Bacteria 10183
329 nmdc:mga08y16_69_c1 3300050511 Bacteria 85136
330 Ga0500658_0000195 3300053134 Bacteria 28880
331 Ga0466962_0004098 3300061719 Bacteria 6982
332 2643728379 2643221541 Bacteria 5498788
333 2644042672 2643221606 Bacteria 5588032
334 2644395897 2643221671 Bacteria 5496681
335 Ga0395899_0032760
336 JGI24737J22298_10000494
337 JGI24735J21928_10024643
338 Ga0070658_10015176
339 Ga0070658_10051828
340 Ga0070658_10221589
341 Ga0070683_100218281
342 Ga0070670_100002831
343 Ga0070670_100014116
344 Ga0070670_100037442
345 Ga0070670_100145477
346 Ga0070677_10018742
347 Ga0070666_10002901
348 Ga0070666_10033256
349 Ga0070680_100002421
350 Ga0070682_100119422
351 Ga0070660_100000891
352 Ga0070660_100030800
353 Ga0070660_100032210
354 Ga0070660_100069291
355 Ga0070660_100084409
356 Ga0070661_100007804
357 Ga0070661_100021299
358 Ga0070661_100056739
359 Ga0070661_100079551
360 Ga0070661_100178231
361 Ga0070692_10123000
362 Ga0070668_100187920
363 Ga0070669_100015016
364 Ga0070675_100003699
365 Ga0070675_100016552
366 Ga0070675_100020995
367 Ga0070671_100000229
368 Ga0070671_100000446
369 Ga0070671_100074188
370 Ga0070674_100087557
371 Ga0070673_100002722
372 Ga0070673_100009513
373 Ga0070673_100198738
374 Ga0070659_100025441
375 Ga0070659_100042316
376 Ga0070659_100055599
377 Ga0070659_100080597
378 Ga0070659_100143074
379 Ga0070659_100168913
380 Ga0070659_100269121
381 Ga0070667_100007606
382 Ga0070663_100000577
383 Ga0070678_100035190
384 Ga0070678_100035984
385 Ga0070678_100090082
386 Ga0070678_100137443
387 Ga0070662_100010153
388 Ga0070662_100014746
389 Ga0070662_100052559
390 Ga0070662_100105047
391 Ga0070681_10076740
392 Ga0070681_10144286
393 Ga0070684_100202107
394 Ga0068853_100323729
395 Ga0070672_100051905
396 Ga0070672_100167333
397 Ga0070665_100108268
398 Ga0068855_100080244
399 Ga0070664_100007048
400 Ga0070664_100022382
401 Ga0070664_100057884
402 Ga0068854_100025097
403 Ga0068856_100104165
404 Ga0068852_100047125
405 Ga0068852_100135861
406 Ga0068859_100139477
407 Ga0068864_100146419
408 Ga0068851_10002008
409 Ga0068863_100004857
410 Ga0068863_100005862
411 Ga0068863_100013905
412 Ga0068863_100047391
413 Ga0068863_100245376
414 Ga0068858_100001758
415 Ga0081539_10022686
416 Ga0070712_100006801
417 Ga0075366_10108397
418 Ga0075428_100003424
419 Ga0075430_100032946
420 Ga0075431_100000006
421 Ga0075429_100001331
422 Ga0097620_100139484
423 Ga0111539_10014184
424 Ga0114129_10020757
425 Ga0105248_10009385
426 Ga0105248_10011744
427 Ga0105248_10015284
428 Ga0105248_10087745
429 Ga0105248_10198170
430 Ga0105248_10461136
431 Ga0157371_10061797
432 Ga0157371_10084980
433 Ga0157370_10065544
434 Ga0157369_10315273
435 Ga0157374_10078090
436 Ga0163162_10049228
437 Ga0163162_10064037
438 Ga0163162_10118719
439 Ga0163162_10127069
440 Ga0157375_10000296
441 Ga0157375_10015362
442 Ga0163163_10380881
443 Ga0157380_10008156
444 Ga0157379_10205951
445 Ga0183363_1001
446 Ga0207682_10020987
447 Ga0207647_10095470
448 Ga0207705_10000205
449 Ga0207705_10001949
450 Ga0207705_10083088
451 Ga0207660_10041286
452 Ga0207657_10001024
453 Ga0207657_10008345
454 Ga0207657_10060151
455 Ga0207657_10074144
456 Ga0207649_10005079
457 Ga0207649_10029802
458 Ga0207649_10163902
459 Ga0207652_10000270
460 Ga0207652_10100910
461 Ga0207652_10260174
462 Ga0207681_10034317
463 Ga0207650_10001305
464 Ga0207659_10003386
465 Ga0207644_10000571
466 Ga0207644_10001415
467 Ga0207644_10001719
468 Ga0207644_10049541
469 Ga0207644_10090928
470 Ga0207690_10008892
471 Ga0207690_10021909
472 Ga0207690_10024367
473 Ga0207690_10033987
474 Ga0207706_10000143
475 Ga0207706_10005084
476 Ga0207706_10011200
477 Ga0207706_10040466
478 Ga0207706_10073336
479 Ga0207706_10104969
480 Ga0207706_10165810
481 Ga0207706_10180095
482 Ga0207706_10219686
483 Ga0207669_10005594
484 Ga0207669_10029753
485 Ga0207691_10039344
486 Ga0207691_10095899
487 Ga0207691_10232301
488 Ga0207711_10010120
489 Ga0207711_10016125
490 Ga0207711_10129005
491 Ga0207689_10146205
492 Ga0207661_10095964
493 Ga0207661_10140201
494 Ga0207679_10019959
495 Ga0207679_10052617
496 Ga0207679_10111793
497 Ga0207651_10014899
498 Ga0207651_10015442
499 Ga0207651_10022301
500 Ga0207640_10047571
501 Ga0207658_10023339
502 Ga0207658_10066608
503 Ga0207658_10164577
504 Ga0207677_10056583
505 Ga0207639_10123085
506 Ga0207678_10000745
507 Ga0207678_10001279
508 Ga0207678_10011495
509 Ga0207678_10022970
510 Ga0207678_10027277
511 Ga0207678_10059000
512 Ga0207702_10041807
513 Ga0207641_10017110
514 Ga0207648_10023347
515 Ga0207676_10007390
516 Ga0207676_10031753
517 Ga0207674_10000347
518 Ga0207683_10004977
519 Ga0207683_10010924
520 Ga0207683_10099040
521 Ga0207683_10213402
522 Ga0207698_10102956
523 Ga0207428_10000684
524 Ga0268266_10069898
525 Ga0268264_10052618
526 Ga0316182_1246356
527 Ga0307408_100032303
528 Ga0307408_100040389
529 Ga0307408_100073905
530 Ga0307408_100113010
531 Ga0307405_10012707
532 Ga0307405_10042991
533 Ga0307405_10073157
534 Ga0307413_10060423
535 Ga0307413_10064950
536 Ga0307410_10007392
537 Ga0307410_10009464
538 Ga0307410_10031360
539 Ga0307406_10001980
540 Ga0307406_10026941
541 Ga0307407_10006432
542 Ga0307407_10013420
543 Ga0307407_10017875
544 Ga0307407_10023077
545 Ga0307407_10041795
546 Ga0307412_10028407
547 Ga0307412_10029441
548 Ga0307412_10041218
549 Ga0307412_10042143
550 Ga0307412_10093070
551 Ga0307412_10159250
552 Ga0307409_100044986
553 Ga0307409_100065050
554 Ga0307409_100085769
555 Ga0307409_100100716
556 Ga0307409_100130637
557 Ga0307416_100025827
558 Ga0307416_100063306
559 Ga0307414_10034404
560 Ga0307414_10042359
561 Ga0307414_10062055
562 Ga0307414_10131395
563 Ga0307414_10183969
564 Ga0307414_10200214
565 Ga0307414_10262680
566 Ga0307411_10005695
567 Ga0307411_10013345
568 Ga0307411_10025524
569 Ga0307411_10222464
570 Ga0307415_100011843
571 Ga0307415_100031870
572 Ga0307415_100035162
573 Ga0307415_100055730
574 Ga0307415_100117244
575 Ga0395899_0055272
576 Ga0395899_0268966
577 Ga0395900_0005503
578 Ga0395900_0017027
579 Ga0395900_0050714
580 Ga0395900_0055796
581 Ga0395900_0170856
582 Ga0395900_0171001
583 Ga0395900_0210536
584 Ga0395900_0299546
585 Ga0395900_0344007
586 Ga0395900_0440128
587 Ga0395898_0004303
588 Ga0395898_0008652
589 Ga0395898_0160917
590 Ga0395905_0002188
591 Ga0395905_0003075
592 Ga0395905_0004506
593 Ga0395905_0009106
594 Ga0395905_0012104
595 Ga0395905_0013290
596 Ga0395905_0020950
597 Ga0395905_0024216
598 Ga0395905_0028583
599 Ga0395905_0032754
600 Ga0395905_0097841
601 Ga0395905_0148867
602 Ga0395901_0003488
603 Ga0395901_0010965
604 Ga0395901_0012700
605 Ga0395901_0021721
606 Ga0395901_0031077
607 Ga0395901_0073234
608 Ga0395901_0102418
609 Ga0395901_0129393
610 Ga0395901_0200325
611 Ga0436365_1435754
612 Ga0439432_011899
613 Ga0439458_0003653
614 Ga0466963_0060451
615 Ga0466971_0007432
616 Ga0466970_0017665
617 Ga0466957_0034038
618 Ga0466958_0011957
619 Ga0466958_0031846
620 Ga0466967_0015589
621 Ga0466967_0051945
622 Ga0466967_0056079
623 Ga0466967_0076954
624 Ga0495585_0025327
625 Ga0495663_0001043
626 Ga0495621_0001464
627 Ga0495621_0002910
628 Ga0495621_0024445
629 Ga0495633_0007069
630 Ga0495668_0004840
631 Ga0495668_0031763
632 Ga0495669_0000293
633 Ga0495669_0004263
634 Ga0495669_0008723
635 Ga0495669_0076858
636 Ga0495670_0002800
637 Ga0496100_0139259
638 Ga0496100_0181719
639 Ga0496101_0054434
640 Ga0496107_0025712
641 Ga0496107_0126070
642 Ga0496108_0037388
643 Ga0496108_0092281
644 Ga0496109_0013334
645 Ga0496109_0121352
646 Ga0496110_0002276
647 Ga0496111_0002996
648 Ga0496112_0004501
649 Ga0496112_0034547
650 Ga0496112_0268783
651 Ga0496113_0074540
652 Ga0501034_0086607
653 Ga0501043_0018840
654 Ga0501046_0184715
655 Ga0501047_0000490
656 Ga0501048_0035673
657 Ga0501249_000049
658 Ga0501035_0081553
659 Ga0501044_0083257
660 nmdc:mga05p37_2203_c1
661 nmdc:mga09592_308_c1
662 nmdc:mga06r32_6941_c1
663 nmdc:mga08y16_69_c1
664 Ga0500658_0000195
665 Ga0466962_0004098
666 2643728379
667 2644042672
668 2644395897

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01321

Creatinase_N

Creatinase/Prolidase N-terminal domain

82

216

0.97

PF00557

Peptidase_M24

Metallopeptidase family M24

223

430

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cde-assembly1.cif.gz_B r372a mutant of xaa-pro dipeptidase from xanthomonas campestris 0.9543 31 416
5fcf-assembly1.cif.gz_B crystal structure of xaa-pro dipeptidase from xanthomonas campestris, phosphate and mn bound 0.9376 26 416
5fch-assembly1.cif.gz_B crystal structure of xaa-pro dipeptidase from xanthomonas campestris, phosphate and zn bound 0.9344 26 416
5fcf-assembly1.cif.gz_A crystal structure of xaa-pro dipeptidase from xanthomonas campestris, phosphate and mn bound 0.9307 26 416
5cde-assembly1.cif.gz_B r372a mutant of xaa-pro dipeptidase from xanthomonas campestris 0.9263 31 416
ID Description Score Start End Superfamily
4r60B01 Alpha Beta;3-Layer(aba) Sandwich;Creatine Amidinohydrolase; Chain A, domain 1;Creatinase/prolidase N-terminal domain 0.9426 31 186 3.40.350.10
5fchB02 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9333 187 416 3.90.230.10
af_Q9UUD8_220_447_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9249 188 405 3.90.230.10
5fchB02 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9216 187 416 3.90.230.10
af_P9WHS7_144_374_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9207 186 406 3.90.230.10
ID Description Score Start End GO Terms
AF-A0A3D3CTI2-F1-model_v4 Peptidase M24 domain-containing protein 0.9787 187 416
AF-A0A2D8YIE0-F1-model_v4 Peptidase 0.9652 267 416 GO:0004177
GO:0008235
GO:0046872
AF-A0A560HGF3-F1-model_v4 Xaa-Pro dipeptidase 0.9585 30 417 GO:0006508
GO:0008233
GO:0046872
AF-A0A3D3CTI2-F1-model_v4 Peptidase M24 domain-containing protein 0.9582 187 416
AF-A0A4R6QPY8-F1-model_v4 Xaa-Pro dipeptidase 0.9576 30 415

Map