F411715

General Info

Members Datasets Scaffolds Average Seq Length
334 170 334 119

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10045676|Ga0081538_100456765
Length 139
Sequence MPDVESARPGITFRHPRPGVAMAIKLSSRQQAQLAFLQTLPPKFQRIHAVIEEMATLRADDVVVRGLARLLDEIKGNAGSLSLTGLADTAGLMATMTRRGGGLQMKVRGLRELLGSLKINYEAAMRSATTPESPTPDEG

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
77 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
83 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
84 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
88 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
89 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
90 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
91 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
92 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
93 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
94 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
95 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
96 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
97 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
98 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
99 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
102 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
103 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
104 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
105 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
106 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
107 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
108 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
109 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
112 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
113 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
114 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
115 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
116 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
117 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
118 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
123 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
124 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
125 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
126 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
127 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
141 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
142 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
143 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
144 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
145 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
146 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
147 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
148 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
149 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
150 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
151 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
152 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
160 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
165 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
166 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
167 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
168 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
170 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 13.17
Rhizosphere 86.53
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_680217 2162886012 Unclassified 1342
2 rootL2_10207509 3300003322 Bacteria 1665
3 Ga0065715_10191926 3300005293 Unclassified 1410
4 Ga0065715_10616642 3300005293 Unclassified 686
5 Ga0070683_100451413 3300005329 Unclassified 1227
6 Ga0070683_100820481 3300005329 Bacteria 892
7 Ga0070691_10290171 3300005341 Bacteria 890
8 Ga0070661_100272046 3300005344 Bacteria 1312
9 Ga0070675_102040833 3300005354 Bacteria 529
10 Ga0070671_100007136 3300005355 Bacteria 8927
11 Ga0070673_100126816 3300005364 Bacteria 2137
12 Ga0070659_100074302 3300005366 Bacteria 2708
13 Ga0070705_100053695 3300005440 Bacteria 2360
14 Ga0070705_100584725 3300005440 Bacteria 861
15 Ga0070708_100419458 3300005445 Bacteria 1262
16 Ga0070708_100440723 3300005445 Unclassified 1229
17 Ga0070708_100782067 3300005445 Bacteria 897
18 Ga0070663_101274999 3300005455 Bacteria 648
19 Ga0070681_10162163 3300005458 Bacteria 2160
20 Ga0070706_100151634 3300005467 Bacteria 2164
21 Ga0070706_100375776 3300005467 Unclassified 1324
22 Ga0070707_100536945 3300005468 Unclassified 1131
23 Ga0070699_100016409 3300005518 Bacteria 6361
24 Ga0070699_100353430 3300005518 Bacteria 1324
25 Ga0070699_100739231 3300005518 Bacteria 900
26 Ga0070679_100837375 3300005530 Bacteria 863
27 Ga0070684_100226874 3300005535 Bacteria 1705
28 Ga0070684_100313296 3300005535 Unclassified 1441
29 Ga0070697_100016734 3300005536 Bacteria 5768
30 Ga0070697_101342881 3300005536 Bacteria 638
31 Ga0070672_100041858 3300005543 Bacteria 3525
32 Ga0070696_100007525 3300005546 Bacteria 7284
33 Ga0070696_100249696 3300005546 Unclassified 1341
34 Ga0070696_100684815 3300005546 Unclassified 834
35 Ga0070704_100169387 3300005549 Unclassified 1735
36 Ga0070704_100302447 3300005549 Bacteria 1333
37 Ga0068855_100675549 3300005563 Bacteria 1107
38 Ga0070664_100202076 3300005564 Bacteria 1773
39 Ga0068857_102346311 3300005577 Bacteria 524
40 Ga0068854_100529072 3300005578 Bacteria 997
41 Ga0068854_100535489 3300005578 Unclassified 991
42 Ga0070702_101861483 3300005615 Unclassified 504
43 Ga0068859_100656324 3300005617 Bacteria 1141
44 Ga0068864_100039643 3300005618 Bacteria 4025
45 Ga0068864_100980369 3300005618 Unclassified 837
46 Ga0068861_100642037 3300005719 Bacteria 980
47 Ga0068863_100253991 3300005841 Unclassified 1698
48 Ga0068860_101216401 3300005843 Bacteria 774
49 Ga0068862_101362680 3300005844 Bacteria 712
50 Ga0068862_102247488 3300005844 Bacteria 557
51 Ga0081538_10045676 3300005981 Bacteria 2712
52 Ga0075428_100261067 3300006844 Bacteria 1865
53 Ga0075430_100328422 3300006846 Bacteria 1264
54 Ga0075431_100005601 3300006847 Bacteria 12402
55 Ga0075433_10033919 3300006852 Bacteria 4379
56 Ga0075433_10049592 3300006852 Bacteria 3652
57 Ga0075434_100215972 3300006871 Bacteria 1938
58 Ga0075434_100672413 3300006871 Unclassified 1053
59 Ga0075429_100742170 3300006880 Unclassified 860
60 Ga0097620_100656387 3300006931 Bacteria 1141
61 Ga0075435_100445628 3300007076 Unclassified 1116
62 Ga0111539_10080664 3300009094 Bacteria 3827
63 Ga0111539_10116443 3300009094 Bacteria 3134
64 Ga0114129_10067770 3300009147 Bacteria 4976
65 Ga0114129_10123818 3300009147 Bacteria 3556
66 Ga0114129_10278929 3300009147 Bacteria 2233
67 Ga0114129_11041168 3300009147 Bacteria 1028
68 Ga0114129_13124610 3300009147 Unclassified 541
69 Ga0105237_10760712 3300009545 Unclassified 975
70 Ga0105246_10276652 3300011119 Bacteria 1345
71 Ga0157378_11972088 3300013297 Unclassified 633
72 Ga0163163_11782926 3300014325 Bacteria 676
73 Ga0157376_12738001 3300014969 Bacteria 533
74 Ga0207647_10331454 3300025904 Bacteria 863
75 Ga0207684_10235895 3300025910 Bacteria 1578
76 Ga0207707_10117873 3300025912 Bacteria 2321
77 Ga0207649_10391371 3300025920 Bacteria 1038
78 Ga0207652_10163612 3300025921 Bacteria 1995
79 Ga0207646_10108876 3300025922 Unclassified 2486
80 Ga0207659_11309809 3300025926 Bacteria 622
81 Ga0207644_10001855 3300025931 Bacteria 13767
82 Ga0207690_10052602 3300025932 Bacteria 2728
83 Ga0207706_11085112 3300025933 Unclassified 669
84 Ga0207669_10525454 3300025937 Bacteria 951
85 Ga0207665_10400240 3300025939 Unclassified 1045
86 Ga0207691_10160227 3300025940 Bacteria 1974
87 Ga0207661_10285647 3300025944 Bacteria 1476
88 Ga0207679_10056311 3300025945 Bacteria 2902
89 Ga0207679_10181420 3300025945 Bacteria 1742
90 Ga0207679_10449050 3300025945 Unclassified 1143
91 Ga0207651_10047994 3300025960 Bacteria 2883
92 Ga0207640_10386735 3300025981 Bacteria 1135
93 Ga0207678_10066582 3300026067 Bacteria 3093
94 Ga0207641_10126894 3300026088 Bacteria 2285
95 Ga0207676_10028533 3300026095 Bacteria 4170
96 Ga0207674_11417622 3300026116 Bacteria 664
97 Ga0209967_1033063 3300027364 Bacteria 777
98 Ga0209966_1018242 3300027695 Bacteria 1343
99 Ga0209998_10042917 3300027717 Bacteria 1031
100 Ga0209974_10017196 3300027876 Bacteria 2399
101 Ga0209974_10269462 3300027876 Bacteria 645
102 Ga0207428_11172797 3300027907 Unclassified 535
103 Ga0268265_11349235 3300028380 Bacteria 714
104 Ga0268265_12030147 3300028380 Bacteria 582
105 Ga0307408_100014365 3300031548 Bacteria 5259
106 Ga0307408_100077518 3300031548 Bacteria 2475
107 Ga0307408_100202479 3300031548 Bacteria 1608
108 Ga0307408_100298283 3300031548 Bacteria 1349
109 Ga0307408_100602531 3300031548 Unclassified 976
110 Ga0307408_101610758 3300031548 Bacteria 617
111 Ga0307405_10019228 3300031731 Bacteria 3788
112 Ga0307405_10214904 3300031731 Bacteria 1407
113 Ga0307413_10023567 3300031824 Unclassified 3338
114 Ga0307413_10043691 3300031824 Bacteria 2642
115 Ga0307413_10115363 3300031824 Bacteria 1807
116 Ga0307413_10694710 3300031824 Unclassified 844
117 Ga0307413_11917478 3300031824 Unclassified 532
118 Ga0307410_10068637 3300031852 Unclassified 2449
119 Ga0307410_10129553 3300031852 Bacteria 1851
120 Ga0307410_10162587 3300031852 Bacteria 1674
121 Ga0307410_10393973 3300031852 Bacteria 1117
122 Ga0307410_10592878 3300031852 Unclassified 923
123 Ga0307406_10044099 3300031901 Bacteria 2794
124 Ga0307406_10051026 3300031901 Bacteria 2625
125 Ga0307406_10299673 3300031901 Bacteria 1234
126 Ga0307406_10409410 3300031901 Unclassified 1077
127 Ga0307407_10006395 3300031903 Bacteria 5229
128 Ga0307407_10018317 3300031903 Bacteria 3539
129 Ga0307407_10032607 3300031903 Bacteria 2834
130 Ga0307407_10044936 3300031903 Bacteria 2493
131 Ga0307407_10139546 3300031903 Bacteria 1562
132 Ga0307412_10160019 3300031911 Bacteria 1671
133 Ga0307412_10596297 3300031911 Bacteria 935
134 Ga0307409_100009132 3300031995 Bacteria 6074
135 Ga0307409_100030674 3300031995 Bacteria 3867
136 Ga0307409_100045052 3300031995 Bacteria 3327
137 Ga0307409_100078209 3300031995 Bacteria 2660
138 Ga0307409_100081964 3300031995 Bacteria 2610
139 Ga0307409_100397211 3300031995 Bacteria 1316
140 Ga0307416_100014356 3300032002 Bacteria 5424
141 Ga0307416_100144676 3300032002 Unclassified 2168
142 Ga0307416_100145937 3300032002 Bacteria 2160
143 Ga0307416_100206113 3300032002 Unclassified 1871
144 Ga0307416_100586926 3300032002 Unclassified 1192
145 Ga0307414_10010709 3300032004 Bacteria 5339
146 Ga0307414_10044938 3300032004 Bacteria 3021
147 Ga0307414_10167826 3300032004 Bacteria 1751
148 Ga0307414_10177551 3300032004 Unclassified 1709
149 Ga0307414_10372661 3300032004 Bacteria 1232
150 Ga0307414_11371271 3300032004 Bacteria 657
151 Ga0307411_10018119 3300032005 Bacteria 4032
152 Ga0307411_10037821 3300032005 Bacteria 3038
153 Ga0307411_10046722 3300032005 Bacteria 2793
154 Ga0307411_10087250 3300032005 Bacteria 2166
155 Ga0307411_10466249 3300032005 Bacteria 1060
156 Ga0307415_100007402 3300032126 Bacteria 6001
157 Ga0373930_0015738 3300034816 Unclassified 1423
158 Ga0373930_0089769 3300034816 Unclassified 720
159 Ga0373928_0192660 3300035084 Bacteria 584
160 Ga0373940_0017549 3300035088 Bacteria 1786
161 Ga0373949_0083095 3300035090 Bacteria 856
162 Ga0373932_0162013 3300035112 Bacteria 774
163 Ga0373939_0208015 3300035114 Bacteria 743
164 Ga0373931_0040166 3300035691 Bacteria 2454
165 Ga0373931_0400268 3300035691 Bacteria 869
166 Ga0395900_0619879 3300037418 Bacteria 1021
167 Ga0395898_1361340 3300037466 Unclassified 638
168 Ga0395905_0226511 3300037471 Unclassified 1749
169 Ga0395905_0593804 3300037471 Bacteria 1009
170 Ga0395905_1183477 3300037471 Bacteria 668
171 Ga0395905_1433738 3300037471 Unclassified 595
172 Ga0395901_0250421 3300038443 Bacteria 1846
173 Ga0395901_0582933 3300038443 Bacteria 1130
174 Ga0439455_0010919 3300042012 Bacteria 2007
175 Ga0439462_0019399 3300042015 Bacteria 1770
176 Ga0450898_011633 3300042134 Bacteria 1444
177 Ga0439446_0015307 3300042156 Unclassified 2127
178 Ga0439446_0016992 3300042156 Bacteria 2031
179 Ga0439434_0027787 3300042435 Bacteria 1712
180 Ga0439434_0152018 3300042435 Unclassified 767
181 Ga0439434_0257116 3300042435 Bacteria 598
182 Ga0439435_0034515 3300042436 Unclassified 1391
183 Ga0439444_0012637 3300042437 Bacteria 1387
184 Ga0439459_0014354 3300042438 Bacteria 1439
185 Ga0439459_0054195 3300042438 Bacteria 889
186 Ga0439459_0083177 3300042438 Unclassified 759
187 Ga0450916_046775 3300042530 Bacteria 672
188 Ga0466967_0731438 3300045976 Unclassified 981
189 Ga0496100_0391159 3300048903 Bacteria 1057
190 Ga0496100_0957790 3300048903 Unclassified 673
191 Ga0496100_1408890 3300048903 Bacteria 550
192 Ga0496101_0089643 3300048904 Bacteria 2286
193 Ga0496101_0392135 3300048904 Bacteria 1093
194 Ga0496102_0048234 3300048905 Bacteria 3872
195 Ga0496102_0144231 3300048905 Bacteria 2234
196 Ga0496102_0244949 3300048905 Bacteria 1690
197 Ga0496102_0382044 3300048905 Bacteria 1325
198 Ga0496103_0124267 3300048906 Unclassified 1645
199 Ga0496103_0161552 3300048906 Bacteria 1437
200 Ga0496104_0005017 3300048907 Bacteria 11546
201 Ga0496104_0306762 3300048907 Bacteria 1500
202 Ga0496105_0039780 3300048908 Bacteria 3877
203 Ga0496105_0783046 3300048908 Bacteria 726
204 Ga0496106_0055770 3300048909 Bacteria 2987
205 Ga0496106_0237921 3300048909 Bacteria 1455
206 Ga0496106_0516174 3300048909 Bacteria 960
207 Ga0496106_1450522 3300048909 Bacteria 529
208 Ga0496106_1480621 3300048909 Unclassified 523
209 Ga0496107_0115821 3300048910 Bacteria 1973
210 Ga0496107_0144335 3300048910 Bacteria 1760
211 Ga0496107_0385525 3300048910 Bacteria 1042
212 Ga0496107_0738385 3300048910 Bacteria 723
213 Ga0496108_0001473 3300048911 Bacteria 18583
214 Ga0496108_0014830 3300048911 Bacteria 6358
215 Ga0496108_0056398 3300048911 Bacteria 3301
216 Ga0496108_0255907 3300048911 Bacteria 1523
217 Ga0496109_0002946 3300048912 Bacteria 14249
218 Ga0496109_0032521 3300048912 Unclassified 4689
219 Ga0496109_0657721 3300048912 Bacteria 985
220 Ga0496109_0859829 3300048912 Unclassified 845
221 Ga0496110_0028865 3300048913 Bacteria 4768
222 Ga0496110_0132077 3300048913 Unclassified 2255
223 Ga0496110_0165410 3300048913 Bacteria 2006
224 Ga0496110_0681457 3300048913 Bacteria 929
225 Ga0496111_0048229 3300048914 Bacteria 3068
226 Ga0496112_0000927 3300048915 Bacteria 21215
227 Ga0496112_0004921 3300048915 Bacteria 11432
228 Ga0496112_1404778 3300048915 Bacteria 613
229 Ga0496113_0001367 3300048916 Bacteria 13524
230 Ga0496113_0021469 3300048916 Bacteria 4555
231 Ga0496114_0141341 3300048917 Bacteria 2084
232 Ga0496115_0306535 3300048918 Unclassified 1301
233 Ga0501031_0415050 3300049568 Unclassified 870
234 Ga0501032_0410730 3300049569 Unclassified 869
235 Ga0501032_1062517 3300049569 Bacteria 508
236 Ga0501033_0032804 3300049570 Bacteria 3900
237 Ga0501036_0153214 3300049572 Unclassified 1944
238 Ga0501037_0824294 3300049573 Bacteria 612
239 Ga0501038_0023616 3300049574 Bacteria 5494
240 Ga0501039_0578314 3300049575 Unclassified 881
241 Ga0501040_0046233 3300049576 Bacteria 2971
242 Ga0501040_0210823 3300049576 Bacteria 1381
243 Ga0501041_0116768 3300049577 Bacteria 1657
244 Ga0501041_0138954 3300049577 Unclassified 1514
245 Ga0501041_0173886 3300049577 Bacteria 1348
246 Ga0501042_0095244 3300049578 Unclassified 2138
247 Ga0501042_0133416 3300049578 Bacteria 1790
248 Ga0501042_0989649 3300049578 Unclassified 613
249 Ga0501043_0197230 3300049579 Unclassified 1564
250 Ga0501043_0349741 3300049579 Bacteria 1123
251 Ga0501046_0032073 3300049580 Bacteria 4256
252 Ga0501046_0036159 3300049580 Bacteria 3977
253 Ga0501046_0574672 3300049580 Bacteria 802
254 Ga0501046_1255489 3300049580 Unclassified 507
255 Ga0501048_0071575 3300049582 Bacteria 2448
256 Ga0501048_0121063 3300049582 Unclassified 1849
257 Ga0501048_0218647 3300049582 Unclassified 1351
258 Ga0501067_0091208 3300049583 Bacteria 1692
259 Ga0501068_0257888 3300049584 Bacteria 1112
260 Ga0501068_0821702 3300049584 Unclassified 610
261 Ga0501069_0045019 3300049585 Bacteria 2444
262 Ga0501069_0435156 3300049585 Unclassified 779
263 Ga0501070_0347141 3300049586 Unclassified 1205
264 Ga0501071_0005775 3300049587 Bacteria 7992
265 Ga0501071_0561299 3300049587 Bacteria 877
266 Ga0501071_1321981 3300049587 Unclassified 557
267 Ga0501072_0009687 3300049588 Bacteria 7327
268 Ga0501072_0045307 3300049588 Bacteria 3458
269 Ga0501073_0389566 3300049589 Bacteria 963
270 Ga0501074_0192327 3300049590 Unclassified 1455
271 Ga0501075_0008956 3300049591 Bacteria 6984
272 Ga0501075_0457431 3300049591 Unclassified 973
273 Ga0501075_0687860 3300049591 Bacteria 779
274 Ga0501076_0009013 3300049592 Bacteria 7348
275 Ga0501076_0034128 3300049592 Bacteria 3975
276 Ga0501076_0177053 3300049592 Unclassified 1738
277 Ga0501076_1640260 3300049592 Unclassified 528
278 Ga0501077_0000422 3300049593 Bacteria 25622
279 Ga0501077_0005064 3300049593 Bacteria 7996
280 Ga0501077_0055992 3300049593 Unclassified 2503
281 Ga0501235_066212 3300049669 Bacteria 851
282 Ga0501235_210677 3300049669 Unclassified 530
283 Ga0501079_0002680 3300049741 Bacteria 12948
284 Ga0501079_0015402 3300049741 Bacteria 5833
285 Ga0501079_0124703 3300049741 Unclassified 2003
286 Ga0501079_0188976 3300049741 Bacteria 1607
287 Ga0501079_1517740 3300049741 Bacteria 527
288 Ga0501080_0091123 3300049742 Bacteria 2832
289 Ga0501080_0097396 3300049742 Unclassified 2731
290 Ga0501080_1626920 3300049742 Bacteria 546
291 Ga0501081_0010836 3300049743 Bacteria 5955
292 Ga0501081_0031683 3300049743 Bacteria 3583
293 Ga0501081_0111791 3300049743 Bacteria 1939
294 Ga0501081_0344033 3300049743 Bacteria 1098
295 Ga0501083_0120448 3300049744 Unclassified 1721
296 Ga0501083_0234753 3300049744 Bacteria 1194
297 Ga0501035_0123545 3300049822 Unclassified 2261
298 Ga0501035_0501427 3300049822 Unclassified 999
299 Ga0501045_0002259 3300049824 Bacteria 13074
300 Ga0501045_0039485 3300049824 Unclassified 3435
301 Ga0501045_0525657 3300049824 Bacteria 878
302 Ga0501045_1285036 3300049824 Bacteria 533
303 nmdc:mga05p37_1358963_c1 3300050507 Unclassified 719
304 nmdc:mga05p37_73009_c1 3300050507 Bacteria 4222
305 nmdc:mga05p37_899752_c1 3300050507 Bacteria 954
306 nmdc:mga05p37_938911_c1 3300050507 Bacteria 927
307 nmdc:mga0qj67_16841_c1 3300050509 Bacteria 5550
308 nmdc:mga06r32_1145785_c1 3300050510 Unclassified 725
309 nmdc:mga06r32_31017_c1 3300050510 Bacteria 5018
310 nmdc:mga08y16_359003_c1 3300050511 Bacteria 1496
311 nmdc:mga0n895_1344364_c1 3300050512 Unclassified 684
312 nmdc:mga0n895_1474126_c1 3300050512 Unclassified 647
313 nmdc:mga0n895_613481_c1 3300050512 Unclassified 1089
314 nmdc:mga0rr50_470910_c1 3300050513 Unclassified 1066
315 nmdc:mga0a205_149333_c1 3300050515 Bacteria 2237
316 nmdc:mga0a205_92889_c1 3300050515 Bacteria 2915
317 Ga0501084_0005716 3300054114 Bacteria 10222
318 Ga0501084_0097271 3300054114 Bacteria 2471
319 Ga0501084_0124207 3300054114 Bacteria 2171
320 Ga0501084_0445759 3300054114 Bacteria 1094
321 Ga0590071_000497 3300059421 Bacteria 11481
322 Ga0590071_003670 3300059421 Bacteria 3768
323 Ga0590071_013726 3300059421 Bacteria 1898
324 Ga0590071_015927 3300059421 Bacteria 1763
325 Ga0590074_000876 3300059423 Bacteria 4684
326 Ga0590077_007733 3300059426 Bacteria 2195
327 Ga0501082_0008564 3300060353 Bacteria 8823
328 Ga0501082_0014382 3300060353 Bacteria 6810
329 Ga0501082_0021044 3300060353 Bacteria 5626
330 Ga0501082_0677799 3300060353 Unclassified 902
331 Ga0501082_1421363 3300060353 Unclassified 606
332 Ga0530510_0049826 3300061734 Unclassified 3025
333 Ga0530510_0115442 3300061734 Bacteria 1968
334 Ga0530510_0307780 3300061734 Unclassified 1186

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005329 Ga0070683_100451413 Ga0070683_1004514132 112
2 3300005344 Ga0070661_100272046 Ga0070661_1002720463 112
3 3300005535 Ga0070684_100313296 Ga0070684_1003132962 112
4 3300005564 Ga0070664_100202076 Ga0070664_1002020763 112
5 3300025945 Ga0207679_10449050 Ga0207679_104490502 112
6 3300042530 Ga0450916_046775 Ga0450916_046775_62_403 112
7 3300025945 Ga0207679_10056311 Ga0207679_100563113 115
8 3300027876 Ga0209974_10269462 Ga0209974_102694621 115
9 3300031548 Ga0307408_100298283 Ga0307408_1002982832 115
10 3300031548 Ga0307408_101610758 Ga0307408_1016107582 115
11 3300031824 Ga0307413_10694710 Ga0307413_106947102 115
12 3300031901 Ga0307406_10051026 Ga0307406_100510263 115
13 3300031995 Ga0307409_100030674 Ga0307409_1000306742 115
14 3300032002 Ga0307416_100586926 Ga0307416_1005869262 115
15 3300032004 Ga0307414_10372661 Ga0307414_103726612 115
16 3300032005 Ga0307411_10018119 Ga0307411_100181193 115
17 3300049580 Ga0501046_0574672 Ga0501046_0574672_50_397 115
18 3300049592 Ga0501076_1640260 Ga0501076_1640260_72_419 115
19 3300049824 Ga0501045_1285036 Ga0501045_1285036_82_429 115
20 3300031824 Ga0307413_10023567 Ga0307413_100235675 116
21 3300031852 Ga0307410_10068637 Ga0307410_100686374 116
22 3300031903 Ga0307407_10006395 Ga0307407_100063956 116
23 3300031903 Ga0307407_10139546 Ga0307407_101395462 116
24 3300031995 Ga0307409_100009132 Ga0307409_1000091323 116
25 3300031995 Ga0307409_100078209 Ga0307409_1000782094 116
26 3300032004 Ga0307414_10177551 Ga0307414_101775512 116
27 3300042156 Ga0439446_0016992 Ga0439446_0016992_1326_1676 116
28 3300060353 Ga0501082_0677799 Ga0501082_0677799_93_443 116
29 3300009545 Ga0105237_10760712 Ga0105237_107607122 117
30 3300031901 Ga0307406_10409410 Ga0307406_104094101 117
31 3300032002 Ga0307416_100144676 Ga0307416_1001446761 117
32 3300037471 Ga0395905_0593804 Ga0395905_0593804_27_383 117
33 3300037471 Ga0395905_1433738 Ga0395905_1433738_191_547 117
34 3300049669 Ga0501235_210677 Ga0501235_210677_10_363 117
35 3300005329 Ga0070683_100820481 Ga0070683_1008204812 118
36 3300005341 Ga0070691_10290171 Ga0070691_102901712 118
37 3300005354 Ga0070675_102040833 Ga0070675_1020408331 118
38 3300005355 Ga0070671_100007136 Ga0070671_1000071365 118
39 3300005364 Ga0070673_100126816 Ga0070673_1001268162 118
40 3300005366 Ga0070659_100074302 Ga0070659_1000743023 118
41 3300005440 Ga0070705_100584725 Ga0070705_1005847251 118
42 3300005455 Ga0070663_101274999 Ga0070663_1012749991 118
43 3300005458 Ga0070681_10162163 Ga0070681_101621631 118
44 3300005530 Ga0070679_100837375 Ga0070679_1008373751 118
45 3300005535 Ga0070684_100226874 Ga0070684_1002268741 118
46 3300005543 Ga0070672_100041858 Ga0070672_1000418582 118
47 3300005546 Ga0070696_100249696 Ga0070696_1002496962 118
48 3300005549 Ga0070704_100302447 Ga0070704_1003024472 118
49 3300005563 Ga0068855_100675549 Ga0068855_1006755493 118
50 3300005577 Ga0068857_102346311 Ga0068857_1023463111 118
51 3300005578 Ga0068854_100529072 Ga0068854_1005290723 118
52 3300005615 Ga0070702_101861483 Ga0070702_1018614832 118
53 3300005719 Ga0068861_100642037 Ga0068861_1006420372 118
54 3300005844 Ga0068862_101362680 Ga0068862_1013626802 118
55 3300005981 Ga0081538_10045676 Ga0081538_100456765 118
56 3300006844 Ga0075428_100261067 Ga0075428_1002610673 118
57 3300006846 Ga0075430_100328422 Ga0075430_1003284222 118
58 3300006880 Ga0075429_100742170 Ga0075429_1007421701 118
59 3300009094 Ga0111539_10080664 Ga0111539_100806642 118
60 3300009094 Ga0111539_10116443 Ga0111539_101164432 118
61 3300009147 Ga0114129_10067770 Ga0114129_100677703 118
62 3300009147 Ga0114129_10123818 Ga0114129_101238182 118
63 3300009147 Ga0114129_11041168 Ga0114129_110411682 118
64 3300011119 Ga0105246_10276652 Ga0105246_102766522 118
65 3300014969 Ga0157376_12738001 Ga0157376_127380011 118
66 3300025904 Ga0207647_10331454 Ga0207647_103314542 118
67 3300025912 Ga0207707_10117873 Ga0207707_101178732 118
68 3300025920 Ga0207649_10391371 Ga0207649_103913711 118
69 3300025921 Ga0207652_10163612 Ga0207652_101636123 118
70 3300025926 Ga0207659_11309809 Ga0207659_113098092 118
71 3300025931 Ga0207644_10001855 Ga0207644_100018559 118
72 3300025932 Ga0207690_10052602 Ga0207690_100526023 118
73 3300025933 Ga0207706_11085112 Ga0207706_110851121 118
74 3300025937 Ga0207669_10525454 Ga0207669_105254542 118
75 3300025940 Ga0207691_10160227 Ga0207691_101602273 118
76 3300025944 Ga0207661_10285647 Ga0207661_102856472 118
77 3300025960 Ga0207651_10047994 Ga0207651_100479943 118
78 3300025981 Ga0207640_10386735 Ga0207640_103867353 118
79 3300026067 Ga0207678_10066582 Ga0207678_100665823 118
80 3300026116 Ga0207674_11417622 Ga0207674_114176221 118
81 3300027364 Ga0209967_1033063 Ga0209967_10330632 118
82 3300027695 Ga0209966_1018242 Ga0209966_10182422 118
83 3300027717 Ga0209998_10042917 Ga0209998_100429173 118
84 3300027876 Ga0209974_10017196 Ga0209974_100171962 118
85 3300027907 Ga0207428_11172797 Ga0207428_111727971 118
86 3300028380 Ga0268265_11349235 Ga0268265_113492351 118
87 3300031548 Ga0307408_100077518 Ga0307408_1000775182 118
88 3300031548 Ga0307408_100202479 Ga0307408_1002024793 118
89 3300031731 Ga0307405_10214904 Ga0307405_102149043 118
90 3300031824 Ga0307413_11917478 Ga0307413_119174782 118
91 3300031852 Ga0307410_10162587 Ga0307410_101625873 118
92 3300031901 Ga0307406_10044099 Ga0307406_100440992 118
93 3300031903 Ga0307407_10032607 Ga0307407_100326072 118
94 3300032002 Ga0307416_100206113 Ga0307416_1002061132 118
95 3300032004 Ga0307414_11371271 Ga0307414_113712712 118
96 3300032005 Ga0307411_10037821 Ga0307411_100378212 118
97 3300035691 Ga0373931_0400268 Ga0373931_0400268_81_473 118
98 3300037471 Ga0395905_0226511 Ga0395905_0226511_435_791 118
99 3300042435 Ga0439434_0257116 Ga0439434_0257116_51_407 118
100 3300042436 Ga0439435_0034515 Ga0439435_0034515_739_1095 118
101 3300042437 Ga0439444_0012637 Ga0439444_0012637_68_424 118
102 3300048903 Ga0496100_1408890 Ga0496100_1408890_114_506 118
103 3300048906 Ga0496103_0124267 Ga0496103_0124267_861_1217 118
104 3300048907 Ga0496104_0306762 Ga0496104_0306762_113_505 118
105 3300048908 Ga0496105_0783046 Ga0496105_0783046_23_415 118
106 3300048909 Ga0496106_0516174 Ga0496106_0516174_255_611 118
107 3300048910 Ga0496107_0738385 Ga0496107_0738385_224_580 118
108 3300048911 Ga0496108_0056398 Ga0496108_0056398_242_598 118
109 3300048911 Ga0496108_0255907 Ga0496108_0255907_570_962 118
110 3300048912 Ga0496109_0657721 Ga0496109_0657721_493_849 118
111 3300048913 Ga0496110_0165410 Ga0496110_0165410_1572_1964 118
112 3300048913 Ga0496110_0681457 Ga0496110_0681457_293_649 118
113 3300048915 Ga0496112_1404778 Ga0496112_1404778_225_581 118
114 3300049568 Ga0501031_0415050 Ga0501031_0415050_59_415 118
115 3300049569 Ga0501032_0410730 Ga0501032_0410730_139_495 118
116 3300049569 Ga0501032_1062517 Ga0501032_1062517_141_497 118
117 3300049570 Ga0501033_0032804 Ga0501033_0032804_2674_3030 118
118 3300049572 Ga0501036_0153214 Ga0501036_0153214_420_776 118
119 3300049573 Ga0501037_0824294 Ga0501037_0824294_81_437 118
120 3300049574 Ga0501038_0023616 Ga0501038_0023616_2203_2559 118
121 3300049575 Ga0501039_0578314 Ga0501039_0578314_239_595 118
122 3300049576 Ga0501040_0046233 Ga0501040_0046233_1960_2316 118
123 3300049576 Ga0501040_0210823 Ga0501040_0210823_730_1086 118
124 3300049577 Ga0501041_0116768 Ga0501041_0116768_252_608 118
125 3300049577 Ga0501041_0138954 Ga0501041_0138954_214_570 118
126 3300049577 Ga0501041_0173886 Ga0501041_0173886_914_1270 118
127 3300049578 Ga0501042_0095244 Ga0501042_0095244_769_1125 118
128 3300049578 Ga0501042_0133416 Ga0501042_0133416_863_1219 118
129 3300049578 Ga0501042_0989649 Ga0501042_0989649_238_594 118
130 3300049579 Ga0501043_0197230 Ga0501043_0197230_965_1321 118
131 3300049579 Ga0501043_0349741 Ga0501043_0349741_670_1026 118
132 3300049580 Ga0501046_0032073 Ga0501046_0032073_2254_2610 118
133 3300049580 Ga0501046_0036159 Ga0501046_0036159_1758_2114 118
134 3300049580 Ga0501046_1255489 Ga0501046_1255489_32_388 118
135 3300049582 Ga0501048_0071575 Ga0501048_0071575_1754_2110 118
136 3300049582 Ga0501048_0121063 Ga0501048_0121063_1218_1574 118
137 3300049582 Ga0501048_0218647 Ga0501048_0218647_907_1263 118
138 3300049584 Ga0501068_0257888 Ga0501068_0257888_540_896 118
139 3300049584 Ga0501068_0821702 Ga0501068_0821702_60_434 118
140 3300049585 Ga0501069_0435156 Ga0501069_0435156_347_703 118
141 3300049586 Ga0501070_0347141 Ga0501070_0347141_73_429 118
142 3300049587 Ga0501071_0005775 Ga0501071_0005775_2565_2921 118
143 3300049587 Ga0501071_0561299 Ga0501071_0561299_20_376 118
144 3300049587 Ga0501071_1321981 Ga0501071_1321981_12_368 118
145 3300049588 Ga0501072_0009687 Ga0501072_0009687_5055_5411 118
146 3300049588 Ga0501072_0045307 Ga0501072_0045307_2905_3261 118
147 3300049589 Ga0501073_0389566 Ga0501073_0389566_319_675 118
148 3300049590 Ga0501074_0192327 Ga0501074_0192327_273_629 118
149 3300049591 Ga0501075_0008956 Ga0501075_0008956_2596_2952 118
150 3300049591 Ga0501075_0457431 Ga0501075_0457431_383_739 118
151 3300049591 Ga0501075_0687860 Ga0501075_0687860_184_540 118
152 3300049592 Ga0501076_0009013 Ga0501076_0009013_3802_4158 118
153 3300049592 Ga0501076_0034128 Ga0501076_0034128_2478_2834 118
154 3300049592 Ga0501076_0177053 Ga0501076_0177053_1156_1512 118
155 3300049593 Ga0501077_0000422 Ga0501077_0000422_1001_1357 118
156 3300049593 Ga0501077_0005064 Ga0501077_0005064_5145_5501 118
157 3300049593 Ga0501077_0055992 Ga0501077_0055992_744_1100 118
158 3300049741 Ga0501079_0002680 Ga0501079_0002680_4798_5154 118
159 3300049741 Ga0501079_0015402 Ga0501079_0015402_2702_3058 118
160 3300049741 Ga0501079_0124703 Ga0501079_0124703_1153_1509 118
161 3300049741 Ga0501079_0188976 Ga0501079_0188976_1046_1408 118
162 3300049741 Ga0501079_1517740 Ga0501079_1517740_121_495 118
163 3300049742 Ga0501080_0091123 Ga0501080_0091123_244_600 118
164 3300049742 Ga0501080_0097396 Ga0501080_0097396_1008_1364 118
165 3300049743 Ga0501081_0010836 Ga0501081_0010836_2952_3308 118
166 3300049743 Ga0501081_0031683 Ga0501081_0031683_953_1309 118
167 3300049743 Ga0501081_0111791 Ga0501081_0111791_551_907 118
168 3300049743 Ga0501081_0344033 Ga0501081_0344033_556_912 118
169 3300049744 Ga0501083_0120448 Ga0501083_0120448_202_558 118
170 3300049744 Ga0501083_0234753 Ga0501083_0234753_29_385 118
171 3300049822 Ga0501035_0123545 Ga0501035_0123545_964_1320 118
172 3300049822 Ga0501035_0501427 Ga0501035_0501427_542_898 118
173 3300049824 Ga0501045_0002259 Ga0501045_0002259_3160_3516 118
174 3300049824 Ga0501045_0039485 Ga0501045_0039485_836_1192 118
175 3300049824 Ga0501045_0525657 Ga0501045_0525657_190_546 118
176 3300050507 nmdc:mga05p37_73009_c1 nmdc:mga05p37_73009_c1_725_1081 118
177 3300050507 nmdc:mga05p37_899752_c1 nmdc:mga05p37_899752_c1_432_788 118
178 3300050507 nmdc:mga05p37_938911_c1 nmdc:mga05p37_938911_c1_34_390 118
179 3300050510 nmdc:mga06r32_1145785_c1 nmdc:mga06r32_1145785_c1_110_466 118
180 3300050511 nmdc:mga08y16_359003_c1 nmdc:mga08y16_359003_c1_1023_1379 118
181 3300050512 nmdc:mga0n895_1344364_c1 nmdc:mga0n895_1344364_c1_199_591 118
182 3300054114 Ga0501084_0005716 Ga0501084_0005716_8438_8794 118
183 3300054114 Ga0501084_0097271 Ga0501084_0097271_1432_1788 118
184 3300054114 Ga0501084_0124207 Ga0501084_0124207_837_1193 118
185 3300054114 Ga0501084_0445759 Ga0501084_0445759_506_862 118
186 3300059421 Ga0590071_000497 Ga0590071_000497_9920_10330 118
187 3300059421 Ga0590071_003670 Ga0590071_003670_2974_3330 118
188 3300059421 Ga0590071_015927 Ga0590071_015927_795_1151 118
189 3300059423 Ga0590074_000876 Ga0590074_000876_2400_2756 118
190 3300059426 Ga0590077_007733 Ga0590077_007733_1480_1836 118
191 3300060353 Ga0501082_0008564 Ga0501082_0008564_1877_2233 118
192 3300060353 Ga0501082_0014382 Ga0501082_0014382_3898_4254 118
193 3300060353 Ga0501082_0021044 Ga0501082_0021044_3241_3597 118
194 3300061734 Ga0530510_0049826 Ga0530510_0049826_2022_2378 118
195 3300061734 Ga0530510_0115442 Ga0530510_0115442_1378_1734 118
196 3300005293 Ga0065715_10616642 Ga0065715_106166421 119
197 3300005445 Ga0070708_100419458 Ga0070708_1004194583 119
198 3300005445 Ga0070708_100782067 Ga0070708_1007820672 119
199 3300005467 Ga0070706_100151634 Ga0070706_1001516342 119
200 3300005468 Ga0070707_100536945 Ga0070707_1005369452 119
201 3300005518 Ga0070699_100353430 Ga0070699_1003534301 119
202 3300005536 Ga0070697_101342881 Ga0070697_1013428812 119
203 3300005546 Ga0070696_100684815 Ga0070696_1006848152 119
204 3300005578 Ga0068854_100535489 Ga0068854_1005354892 119
205 3300005617 Ga0068859_100656324 Ga0068859_1006563242 119
206 3300005618 Ga0068864_100039643 Ga0068864_1000396434 119
207 3300005618 Ga0068864_100980369 Ga0068864_1009803691 119
208 3300005841 Ga0068863_100253991 Ga0068863_1002539913 119
209 3300005843 Ga0068860_101216401 Ga0068860_1012164012 119
210 3300005844 Ga0068862_102247488 Ga0068862_1022474881 119
211 3300006852 Ga0075433_10033919 Ga0075433_100339192 119
212 3300006871 Ga0075434_100672413 Ga0075434_1006724132 119
213 3300006931 Ga0097620_100656387 Ga0097620_1006563872 119
214 3300009147 Ga0114129_13124610 Ga0114129_131246101 119
215 3300013297 Ga0157378_11972088 Ga0157378_119720881 119
216 3300014325 Ga0163163_11782926 Ga0163163_117829261 119
217 3300025910 Ga0207684_10235895 Ga0207684_102358953 119
218 3300025945 Ga0207679_10181420 Ga0207679_101814202 119
219 3300026088 Ga0207641_10126894 Ga0207641_101268942 119
220 3300026095 Ga0207676_10028533 Ga0207676_100285332 119
221 3300028380 Ga0268265_12030147 Ga0268265_120301472 119
222 3300031548 Ga0307408_100602531 Ga0307408_1006025313 119
223 3300031852 Ga0307410_10393973 Ga0307410_103939732 119
224 3300031903 Ga0307407_10044936 Ga0307407_100449362 119
225 3300031911 Ga0307412_10596297 Ga0307412_105962972 119
226 3300031995 Ga0307409_100081964 Ga0307409_1000819642 119
227 3300031995 Ga0307409_100397211 Ga0307409_1003972111 119
228 3300032002 Ga0307416_100145937 Ga0307416_1001459372 119
229 3300032004 Ga0307414_10167826 Ga0307414_101678262 119
230 3300032005 Ga0307411_10046722 Ga0307411_100467222 119
231 3300032005 Ga0307411_10466249 Ga0307411_104662491 119
232 3300034816 Ga0373930_0015738 Ga0373930_0015738_699_1058 119
233 3300034816 Ga0373930_0089769 Ga0373930_0089769_91_450 119
234 3300035084 Ga0373928_0192660 Ga0373928_0192660_24_383 119
235 3300035088 Ga0373940_0017549 Ga0373940_0017549_522_899 119
236 3300035090 Ga0373949_0083095 Ga0373949_0083095_83_442 119
237 3300035112 Ga0373932_0162013 Ga0373932_0162013_105_464 119
238 3300035114 Ga0373939_0208015 Ga0373939_0208015_118_477 119
239 3300035691 Ga0373931_0040166 Ga0373931_0040166_944_1321 119
240 3300037418 Ga0395900_0619879 Ga0395900_0619879_453_812 119
241 3300037466 Ga0395898_1361340 Ga0395898_1361340_117_497 119
242 3300037471 Ga0395905_1183477 Ga0395905_1183477_236_595 119
243 3300038443 Ga0395901_0250421 Ga0395901_0250421_1155_1514 119
244 3300038443 Ga0395901_0582933 Ga0395901_0582933_450_830 119
245 3300042012 Ga0439455_0010919 Ga0439455_0010919_755_1114 119
246 3300042438 Ga0439459_0014354 Ga0439459_0014354_34_393 119
247 3300042438 Ga0439459_0054195 Ga0439459_0054195_457_816 119
248 3300042438 Ga0439459_0083177 Ga0439459_0083177_120_479 119
249 3300048903 Ga0496100_0391159 Ga0496100_0391159_655_1014 119
250 3300048903 Ga0496100_0957790 Ga0496100_0957790_149_508 119
251 3300048904 Ga0496101_0089643 Ga0496101_0089643_399_758 119
252 3300048904 Ga0496101_0392135 Ga0496101_0392135_325_684 119
253 3300048905 Ga0496102_0048234 Ga0496102_0048234_3184_3543 119
254 3300048905 Ga0496102_0144231 Ga0496102_0144231_1251_1610 119
255 3300048905 Ga0496102_0382044 Ga0496102_0382044_451_810 119
256 3300048906 Ga0496103_0161552 Ga0496103_0161552_159_518 119
257 3300048907 Ga0496104_0005017 Ga0496104_0005017_7078_7437 119
258 3300048908 Ga0496105_0039780 Ga0496105_0039780_1393_1752 119
259 3300048909 Ga0496106_0055770 Ga0496106_0055770_2574_2933 119
260 3300048909 Ga0496106_0237921 Ga0496106_0237921_529_888 119
261 3300048909 Ga0496106_1450522 Ga0496106_1450522_11_370 119
262 3300048909 Ga0496106_1480621 Ga0496106_1480621_23_382 119
263 3300048910 Ga0496107_0115821 Ga0496107_0115821_315_674 119
264 3300048910 Ga0496107_0144335 Ga0496107_0144335_835_1194 119
265 3300048910 Ga0496107_0385525 Ga0496107_0385525_389_748 119
266 3300048911 Ga0496108_0001473 Ga0496108_0001473_14605_14964 119
267 3300048911 Ga0496108_0014830 Ga0496108_0014830_2622_2981 119
268 3300048912 Ga0496109_0002946 Ga0496109_0002946_3459_3818 119
269 3300048912 Ga0496109_0032521 Ga0496109_0032521_4061_4420 119
270 3300048912 Ga0496109_0859829 Ga0496109_0859829_182_541 119
271 3300048913 Ga0496110_0028865 Ga0496110_0028865_643_1002 119
272 3300048913 Ga0496110_0132077 Ga0496110_0132077_76_435 119
273 3300048914 Ga0496111_0048229 Ga0496111_0048229_2098_2457 119
274 3300048915 Ga0496112_0000927 Ga0496112_0000927_10746_11105 119
275 3300048915 Ga0496112_0004921 Ga0496112_0004921_3398_3757 119
276 3300048916 Ga0496113_0001367 Ga0496113_0001367_3620_3979 119
277 3300048916 Ga0496113_0021469 Ga0496113_0021469_3264_3623 119
278 3300048917 Ga0496114_0141341 Ga0496114_0141341_527_886 119
279 3300048918 Ga0496115_0306535 Ga0496115_0306535_280_639 119
280 3300049583 Ga0501067_0091208 Ga0501067_0091208_276_635 119
281 3300049585 Ga0501069_0045019 Ga0501069_0045019_1379_1738 119
282 3300050512 nmdc:mga0n895_613481_c1 nmdc:mga0n895_613481_c1_349_708 119
283 3300050515 nmdc:mga0a205_92889_c1 nmdc:mga0a205_92889_c1_1664_2023 119
284 3300061734 Ga0530510_0307780 Ga0530510_0307780_514_873 119
285 3300003322 rootL2_10207509 rootL2_102075093 120
286 3300005445 Ga0070708_100440723 Ga0070708_1004407232 120
287 3300005467 Ga0070706_100375776 Ga0070706_1003757762 120
288 3300005518 Ga0070699_100739231 Ga0070699_1007392311 120
289 3300007076 Ga0075435_100445628 Ga0075435_1004456282 120
290 3300025922 Ga0207646_10108876 Ga0207646_101088764 120
291 3300025939 Ga0207665_10400240 Ga0207665_104002402 120
292 3300045976 Ga0466967_0731438 Ga0466967_0731438_224_586 120
293 3300050513 nmdc:mga0rr50_470910_c1 nmdc:mga0rr50_470910_c1_515_877 120
294 3300059421 Ga0590071_013726 Ga0590071_013726_1242_1604 120
295 3300006847 Ga0075431_100005601 Ga0075431_1000056019 121
296 3300050509 nmdc:mga0qj67_16841_c1 nmdc:mga0qj67_16841_c1_3648_4013 121
297 3300050510 nmdc:mga06r32_31017_c1 nmdc:mga06r32_31017_c1_3634_3999 121
298 3300042156 Ga0439446_0015307 Ga0439446_0015307_988_1359 122
299 3300042435 Ga0439434_0152018 Ga0439434_0152018_176_547 122
300 3300031824 Ga0307413_10115363 Ga0307413_101153632 123
301 3300031852 Ga0307410_10592878 Ga0307410_105928783 123
302 3300031903 Ga0307407_10018317 Ga0307407_100183173 123
303 3300032004 Ga0307414_10010709 Ga0307414_100107093 123
304 3300042134 Ga0450898_011633 Ga0450898_011633_235_609 123
305 3300031548 Ga0307408_100014365 Ga0307408_1000143655 124
306 3300031731 Ga0307405_10019228 Ga0307405_100192284 124
307 3300031824 Ga0307413_10043691 Ga0307413_100436912 124
308 3300031852 Ga0307410_10129553 Ga0307410_101295534 124
309 3300031901 Ga0307406_10299673 Ga0307406_102996733 124
310 3300031911 Ga0307412_10160019 Ga0307412_101600193 124
311 3300031995 Ga0307409_100045052 Ga0307409_1000450522 124
312 3300032002 Ga0307416_100014356 Ga0307416_1000143566 124
313 3300032004 Ga0307414_10044938 Ga0307414_100449382 124
314 3300032005 Ga0307411_10087250 Ga0307411_100872502 124
315 3300032126 Ga0307415_100007402 Ga0307415_1000074024 124
316 3300042015 Ga0439462_0019399 Ga0439462_0019399_144_521 124
317 3300042435 Ga0439434_0027787 Ga0439434_0027787_1085_1462 124
318 3300049669 Ga0501235_066212 Ga0501235_066212_37_414 124
319 3300049742 Ga0501080_1626920 Ga0501080_1626920_14_391 124
320 3300060353 Ga0501082_1421363 Ga0501082_1421363_13_390 124
321 2162886012 MBSR1b_contig_680217 MBSR1b_0646.00006080 126
322 3300005293 Ga0065715_10191926 Ga0065715_101919263 126
323 3300005440 Ga0070705_100053695 Ga0070705_1000536954 126
324 3300005518 Ga0070699_100016409 Ga0070699_1000164095 126
325 3300005536 Ga0070697_100016734 Ga0070697_1000167343 126
326 3300005546 Ga0070696_100007525 Ga0070696_1000075256 126
327 3300005549 Ga0070704_100169387 Ga0070704_1001693872 126
328 3300006852 Ga0075433_10049592 Ga0075433_100495921 126
329 3300006871 Ga0075434_100215972 Ga0075434_1002159722 126
330 3300009147 Ga0114129_10278929 Ga0114129_102789294 126
331 3300048905 Ga0496102_0244949 Ga0496102_0244949_33_413 126
332 3300050507 nmdc:mga05p37_1358963_c1 nmdc:mga05p37_1358963_c1_59_439 126
333 3300050512 nmdc:mga0n895_1474126_c1 nmdc:mga0n895_1474126_c1_128_508 126
334 3300050515 nmdc:mga0a205_149333_c1 nmdc:mga0a205_149333_c1_271_651 126

Structural Annotation

Top 5 Hits

ID Description Score Start End
3myf-assembly1.cif.gz_A the crystal structure of the hpt domain from the hpt sensor hybrid histidine kinase from shewanella to 1.80a 0.7656 9 106
6ff6-assembly1.cif.gz_A-2 crystal structure of novel repeat protein bric1 0.7604 9 101
5w93-assembly3.cif.gz_C p130cas complex with paxillin ld1 0.6809 10 101
3kyi-assembly1.cif.gz_A crystal structure of the phosphorylated p1 domain of chea3 in complex with chey6 from r. sphaeroides 0.6742 9 116
1c03-assembly4.cif.gz_D crystal structure of ypd1p (triclinic form) 0.674 8 117
ID Description Score Start End Superfamily
af_P39838_803_889_1.20.120.160 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain 0.8447 14 102 1.20.120.160
af_P39838_803_889_1.20.120.160 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain 0.7392 14 102 1.20.120.160
af_I1MCF1_5_152_1.20.120.160 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain 0.7342 8 125 1.20.120.160
af_A0A2R8QLY2_647_783_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.7024 4 109 1.20.120.230
3kyiA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain 0.6742 9 116 1.20.120.160
ID Description Score Start End GO Terms
AF-A0A7V4KPD6-F1-model_v4 Transcriptional regulator 0.9887 4 110
AF-A0A7V9FFV1-F1-model_v4 HPt domain-containing protein 0.981 1 113
AF-A0A7V9FFV1-F1-model_v4 HPt domain-containing protein 0.9559 1 113
AF-A0A1F4E3I2-F1-model_v4 HPt domain-containing protein 0.9242 8 100 GO:0000160
GO:0004672
AF-A0A2W7AKU8-F1-model_v4 Transcriptional regulator 0.9141 14 99 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Feature Viewer

pLDDT pTM Quality
89.97 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map