F411715
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 334 | 170 | 334 | 119 |
Family's Representative Sequence
| Representative Sequence | 3300005981|Ga0081538_10045676|Ga0081538_100456765 |
| Length | 139 |
| Sequence | MPDVESARPGITFRHPRPGVAMAIKLSSRQQAQLAFLQTLPPKFQRIHAVIEEMATLRADDVVVRGLARLLDEIKGNAGSLSLTGLADTAGLMATMTRRGGGLQMKVRGLRELLGSLKINYEAAMRSATTPESPTPDEG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 6 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 25 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 27 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 28 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 30 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 31 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 32 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 33 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 34 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 35 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 36 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 37 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 38 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 39 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 40 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 41 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 42 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 44 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 77 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 79 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 80 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 81 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 82 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 83 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 84 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 85 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 86 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 87 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 88 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 89 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 90 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 91 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 92 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 93 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 94 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 95 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 96 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 97 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 98 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 99 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 100 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 101 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 102 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 103 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 104 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 105 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 106 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 107 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 108 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 109 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 110 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 111 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 112 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 113 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 114 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 115 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 116 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 117 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 118 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 119 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 120 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 121 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 122 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 123 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 124 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 125 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 126 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 127 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 128 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 129 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 130 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 131 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 132 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 133 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 134 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 135 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 136 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 137 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 138 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 140 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 141 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 142 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 143 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 146 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 152 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 158 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 159 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 160 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 161 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 163 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 164 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 165 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 167 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 168 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 169 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 13.17 |
| Rhizosphere | 86.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_680217 | 2162886012 | Unclassified | 1342 |
| 2 | rootL2_10207509 | 3300003322 | Bacteria | 1665 |
| 3 | Ga0065715_10191926 | 3300005293 | Unclassified | 1410 |
| 4 | Ga0065715_10616642 | 3300005293 | Unclassified | 686 |
| 5 | Ga0070683_100451413 | 3300005329 | Unclassified | 1227 |
| 6 | Ga0070683_100820481 | 3300005329 | Bacteria | 892 |
| 7 | Ga0070691_10290171 | 3300005341 | Bacteria | 890 |
| 8 | Ga0070661_100272046 | 3300005344 | Bacteria | 1312 |
| 9 | Ga0070675_102040833 | 3300005354 | Bacteria | 529 |
| 10 | Ga0070671_100007136 | 3300005355 | Bacteria | 8927 |
| 11 | Ga0070673_100126816 | 3300005364 | Bacteria | 2137 |
| 12 | Ga0070659_100074302 | 3300005366 | Bacteria | 2708 |
| 13 | Ga0070705_100053695 | 3300005440 | Bacteria | 2360 |
| 14 | Ga0070705_100584725 | 3300005440 | Bacteria | 861 |
| 15 | Ga0070708_100419458 | 3300005445 | Bacteria | 1262 |
| 16 | Ga0070708_100440723 | 3300005445 | Unclassified | 1229 |
| 17 | Ga0070708_100782067 | 3300005445 | Bacteria | 897 |
| 18 | Ga0070663_101274999 | 3300005455 | Bacteria | 648 |
| 19 | Ga0070681_10162163 | 3300005458 | Bacteria | 2160 |
| 20 | Ga0070706_100151634 | 3300005467 | Bacteria | 2164 |
| 21 | Ga0070706_100375776 | 3300005467 | Unclassified | 1324 |
| 22 | Ga0070707_100536945 | 3300005468 | Unclassified | 1131 |
| 23 | Ga0070699_100016409 | 3300005518 | Bacteria | 6361 |
| 24 | Ga0070699_100353430 | 3300005518 | Bacteria | 1324 |
| 25 | Ga0070699_100739231 | 3300005518 | Bacteria | 900 |
| 26 | Ga0070679_100837375 | 3300005530 | Bacteria | 863 |
| 27 | Ga0070684_100226874 | 3300005535 | Bacteria | 1705 |
| 28 | Ga0070684_100313296 | 3300005535 | Unclassified | 1441 |
| 29 | Ga0070697_100016734 | 3300005536 | Bacteria | 5768 |
| 30 | Ga0070697_101342881 | 3300005536 | Bacteria | 638 |
| 31 | Ga0070672_100041858 | 3300005543 | Bacteria | 3525 |
| 32 | Ga0070696_100007525 | 3300005546 | Bacteria | 7284 |
| 33 | Ga0070696_100249696 | 3300005546 | Unclassified | 1341 |
| 34 | Ga0070696_100684815 | 3300005546 | Unclassified | 834 |
| 35 | Ga0070704_100169387 | 3300005549 | Unclassified | 1735 |
| 36 | Ga0070704_100302447 | 3300005549 | Bacteria | 1333 |
| 37 | Ga0068855_100675549 | 3300005563 | Bacteria | 1107 |
| 38 | Ga0070664_100202076 | 3300005564 | Bacteria | 1773 |
| 39 | Ga0068857_102346311 | 3300005577 | Bacteria | 524 |
| 40 | Ga0068854_100529072 | 3300005578 | Bacteria | 997 |
| 41 | Ga0068854_100535489 | 3300005578 | Unclassified | 991 |
| 42 | Ga0070702_101861483 | 3300005615 | Unclassified | 504 |
| 43 | Ga0068859_100656324 | 3300005617 | Bacteria | 1141 |
| 44 | Ga0068864_100039643 | 3300005618 | Bacteria | 4025 |
| 45 | Ga0068864_100980369 | 3300005618 | Unclassified | 837 |
| 46 | Ga0068861_100642037 | 3300005719 | Bacteria | 980 |
| 47 | Ga0068863_100253991 | 3300005841 | Unclassified | 1698 |
| 48 | Ga0068860_101216401 | 3300005843 | Bacteria | 774 |
| 49 | Ga0068862_101362680 | 3300005844 | Bacteria | 712 |
| 50 | Ga0068862_102247488 | 3300005844 | Bacteria | 557 |
| 51 | Ga0081538_10045676 | 3300005981 | Bacteria | 2712 |
| 52 | Ga0075428_100261067 | 3300006844 | Bacteria | 1865 |
| 53 | Ga0075430_100328422 | 3300006846 | Bacteria | 1264 |
| 54 | Ga0075431_100005601 | 3300006847 | Bacteria | 12402 |
| 55 | Ga0075433_10033919 | 3300006852 | Bacteria | 4379 |
| 56 | Ga0075433_10049592 | 3300006852 | Bacteria | 3652 |
| 57 | Ga0075434_100215972 | 3300006871 | Bacteria | 1938 |
| 58 | Ga0075434_100672413 | 3300006871 | Unclassified | 1053 |
| 59 | Ga0075429_100742170 | 3300006880 | Unclassified | 860 |
| 60 | Ga0097620_100656387 | 3300006931 | Bacteria | 1141 |
| 61 | Ga0075435_100445628 | 3300007076 | Unclassified | 1116 |
| 62 | Ga0111539_10080664 | 3300009094 | Bacteria | 3827 |
| 63 | Ga0111539_10116443 | 3300009094 | Bacteria | 3134 |
| 64 | Ga0114129_10067770 | 3300009147 | Bacteria | 4976 |
| 65 | Ga0114129_10123818 | 3300009147 | Bacteria | 3556 |
| 66 | Ga0114129_10278929 | 3300009147 | Bacteria | 2233 |
| 67 | Ga0114129_11041168 | 3300009147 | Bacteria | 1028 |
| 68 | Ga0114129_13124610 | 3300009147 | Unclassified | 541 |
| 69 | Ga0105237_10760712 | 3300009545 | Unclassified | 975 |
| 70 | Ga0105246_10276652 | 3300011119 | Bacteria | 1345 |
| 71 | Ga0157378_11972088 | 3300013297 | Unclassified | 633 |
| 72 | Ga0163163_11782926 | 3300014325 | Bacteria | 676 |
| 73 | Ga0157376_12738001 | 3300014969 | Bacteria | 533 |
| 74 | Ga0207647_10331454 | 3300025904 | Bacteria | 863 |
| 75 | Ga0207684_10235895 | 3300025910 | Bacteria | 1578 |
| 76 | Ga0207707_10117873 | 3300025912 | Bacteria | 2321 |
| 77 | Ga0207649_10391371 | 3300025920 | Bacteria | 1038 |
| 78 | Ga0207652_10163612 | 3300025921 | Bacteria | 1995 |
| 79 | Ga0207646_10108876 | 3300025922 | Unclassified | 2486 |
| 80 | Ga0207659_11309809 | 3300025926 | Bacteria | 622 |
| 81 | Ga0207644_10001855 | 3300025931 | Bacteria | 13767 |
| 82 | Ga0207690_10052602 | 3300025932 | Bacteria | 2728 |
| 83 | Ga0207706_11085112 | 3300025933 | Unclassified | 669 |
| 84 | Ga0207669_10525454 | 3300025937 | Bacteria | 951 |
| 85 | Ga0207665_10400240 | 3300025939 | Unclassified | 1045 |
| 86 | Ga0207691_10160227 | 3300025940 | Bacteria | 1974 |
| 87 | Ga0207661_10285647 | 3300025944 | Bacteria | 1476 |
| 88 | Ga0207679_10056311 | 3300025945 | Bacteria | 2902 |
| 89 | Ga0207679_10181420 | 3300025945 | Bacteria | 1742 |
| 90 | Ga0207679_10449050 | 3300025945 | Unclassified | 1143 |
| 91 | Ga0207651_10047994 | 3300025960 | Bacteria | 2883 |
| 92 | Ga0207640_10386735 | 3300025981 | Bacteria | 1135 |
| 93 | Ga0207678_10066582 | 3300026067 | Bacteria | 3093 |
| 94 | Ga0207641_10126894 | 3300026088 | Bacteria | 2285 |
| 95 | Ga0207676_10028533 | 3300026095 | Bacteria | 4170 |
| 96 | Ga0207674_11417622 | 3300026116 | Bacteria | 664 |
| 97 | Ga0209967_1033063 | 3300027364 | Bacteria | 777 |
| 98 | Ga0209966_1018242 | 3300027695 | Bacteria | 1343 |
| 99 | Ga0209998_10042917 | 3300027717 | Bacteria | 1031 |
| 100 | Ga0209974_10017196 | 3300027876 | Bacteria | 2399 |
| 101 | Ga0209974_10269462 | 3300027876 | Bacteria | 645 |
| 102 | Ga0207428_11172797 | 3300027907 | Unclassified | 535 |
| 103 | Ga0268265_11349235 | 3300028380 | Bacteria | 714 |
| 104 | Ga0268265_12030147 | 3300028380 | Bacteria | 582 |
| 105 | Ga0307408_100014365 | 3300031548 | Bacteria | 5259 |
| 106 | Ga0307408_100077518 | 3300031548 | Bacteria | 2475 |
| 107 | Ga0307408_100202479 | 3300031548 | Bacteria | 1608 |
| 108 | Ga0307408_100298283 | 3300031548 | Bacteria | 1349 |
| 109 | Ga0307408_100602531 | 3300031548 | Unclassified | 976 |
| 110 | Ga0307408_101610758 | 3300031548 | Bacteria | 617 |
| 111 | Ga0307405_10019228 | 3300031731 | Bacteria | 3788 |
| 112 | Ga0307405_10214904 | 3300031731 | Bacteria | 1407 |
| 113 | Ga0307413_10023567 | 3300031824 | Unclassified | 3338 |
| 114 | Ga0307413_10043691 | 3300031824 | Bacteria | 2642 |
| 115 | Ga0307413_10115363 | 3300031824 | Bacteria | 1807 |
| 116 | Ga0307413_10694710 | 3300031824 | Unclassified | 844 |
| 117 | Ga0307413_11917478 | 3300031824 | Unclassified | 532 |
| 118 | Ga0307410_10068637 | 3300031852 | Unclassified | 2449 |
| 119 | Ga0307410_10129553 | 3300031852 | Bacteria | 1851 |
| 120 | Ga0307410_10162587 | 3300031852 | Bacteria | 1674 |
| 121 | Ga0307410_10393973 | 3300031852 | Bacteria | 1117 |
| 122 | Ga0307410_10592878 | 3300031852 | Unclassified | 923 |
| 123 | Ga0307406_10044099 | 3300031901 | Bacteria | 2794 |
| 124 | Ga0307406_10051026 | 3300031901 | Bacteria | 2625 |
| 125 | Ga0307406_10299673 | 3300031901 | Bacteria | 1234 |
| 126 | Ga0307406_10409410 | 3300031901 | Unclassified | 1077 |
| 127 | Ga0307407_10006395 | 3300031903 | Bacteria | 5229 |
| 128 | Ga0307407_10018317 | 3300031903 | Bacteria | 3539 |
| 129 | Ga0307407_10032607 | 3300031903 | Bacteria | 2834 |
| 130 | Ga0307407_10044936 | 3300031903 | Bacteria | 2493 |
| 131 | Ga0307407_10139546 | 3300031903 | Bacteria | 1562 |
| 132 | Ga0307412_10160019 | 3300031911 | Bacteria | 1671 |
| 133 | Ga0307412_10596297 | 3300031911 | Bacteria | 935 |
| 134 | Ga0307409_100009132 | 3300031995 | Bacteria | 6074 |
| 135 | Ga0307409_100030674 | 3300031995 | Bacteria | 3867 |
| 136 | Ga0307409_100045052 | 3300031995 | Bacteria | 3327 |
| 137 | Ga0307409_100078209 | 3300031995 | Bacteria | 2660 |
| 138 | Ga0307409_100081964 | 3300031995 | Bacteria | 2610 |
| 139 | Ga0307409_100397211 | 3300031995 | Bacteria | 1316 |
| 140 | Ga0307416_100014356 | 3300032002 | Bacteria | 5424 |
| 141 | Ga0307416_100144676 | 3300032002 | Unclassified | 2168 |
| 142 | Ga0307416_100145937 | 3300032002 | Bacteria | 2160 |
| 143 | Ga0307416_100206113 | 3300032002 | Unclassified | 1871 |
| 144 | Ga0307416_100586926 | 3300032002 | Unclassified | 1192 |
| 145 | Ga0307414_10010709 | 3300032004 | Bacteria | 5339 |
| 146 | Ga0307414_10044938 | 3300032004 | Bacteria | 3021 |
| 147 | Ga0307414_10167826 | 3300032004 | Bacteria | 1751 |
| 148 | Ga0307414_10177551 | 3300032004 | Unclassified | 1709 |
| 149 | Ga0307414_10372661 | 3300032004 | Bacteria | 1232 |
| 150 | Ga0307414_11371271 | 3300032004 | Bacteria | 657 |
| 151 | Ga0307411_10018119 | 3300032005 | Bacteria | 4032 |
| 152 | Ga0307411_10037821 | 3300032005 | Bacteria | 3038 |
| 153 | Ga0307411_10046722 | 3300032005 | Bacteria | 2793 |
| 154 | Ga0307411_10087250 | 3300032005 | Bacteria | 2166 |
| 155 | Ga0307411_10466249 | 3300032005 | Bacteria | 1060 |
| 156 | Ga0307415_100007402 | 3300032126 | Bacteria | 6001 |
| 157 | Ga0373930_0015738 | 3300034816 | Unclassified | 1423 |
| 158 | Ga0373930_0089769 | 3300034816 | Unclassified | 720 |
| 159 | Ga0373928_0192660 | 3300035084 | Bacteria | 584 |
| 160 | Ga0373940_0017549 | 3300035088 | Bacteria | 1786 |
| 161 | Ga0373949_0083095 | 3300035090 | Bacteria | 856 |
| 162 | Ga0373932_0162013 | 3300035112 | Bacteria | 774 |
| 163 | Ga0373939_0208015 | 3300035114 | Bacteria | 743 |
| 164 | Ga0373931_0040166 | 3300035691 | Bacteria | 2454 |
| 165 | Ga0373931_0400268 | 3300035691 | Bacteria | 869 |
| 166 | Ga0395900_0619879 | 3300037418 | Bacteria | 1021 |
| 167 | Ga0395898_1361340 | 3300037466 | Unclassified | 638 |
| 168 | Ga0395905_0226511 | 3300037471 | Unclassified | 1749 |
| 169 | Ga0395905_0593804 | 3300037471 | Bacteria | 1009 |
| 170 | Ga0395905_1183477 | 3300037471 | Bacteria | 668 |
| 171 | Ga0395905_1433738 | 3300037471 | Unclassified | 595 |
| 172 | Ga0395901_0250421 | 3300038443 | Bacteria | 1846 |
| 173 | Ga0395901_0582933 | 3300038443 | Bacteria | 1130 |
| 174 | Ga0439455_0010919 | 3300042012 | Bacteria | 2007 |
| 175 | Ga0439462_0019399 | 3300042015 | Bacteria | 1770 |
| 176 | Ga0450898_011633 | 3300042134 | Bacteria | 1444 |
| 177 | Ga0439446_0015307 | 3300042156 | Unclassified | 2127 |
| 178 | Ga0439446_0016992 | 3300042156 | Bacteria | 2031 |
| 179 | Ga0439434_0027787 | 3300042435 | Bacteria | 1712 |
| 180 | Ga0439434_0152018 | 3300042435 | Unclassified | 767 |
| 181 | Ga0439434_0257116 | 3300042435 | Bacteria | 598 |
| 182 | Ga0439435_0034515 | 3300042436 | Unclassified | 1391 |
| 183 | Ga0439444_0012637 | 3300042437 | Bacteria | 1387 |
| 184 | Ga0439459_0014354 | 3300042438 | Bacteria | 1439 |
| 185 | Ga0439459_0054195 | 3300042438 | Bacteria | 889 |
| 186 | Ga0439459_0083177 | 3300042438 | Unclassified | 759 |
| 187 | Ga0450916_046775 | 3300042530 | Bacteria | 672 |
| 188 | Ga0466967_0731438 | 3300045976 | Unclassified | 981 |
| 189 | Ga0496100_0391159 | 3300048903 | Bacteria | 1057 |
| 190 | Ga0496100_0957790 | 3300048903 | Unclassified | 673 |
| 191 | Ga0496100_1408890 | 3300048903 | Bacteria | 550 |
| 192 | Ga0496101_0089643 | 3300048904 | Bacteria | 2286 |
| 193 | Ga0496101_0392135 | 3300048904 | Bacteria | 1093 |
| 194 | Ga0496102_0048234 | 3300048905 | Bacteria | 3872 |
| 195 | Ga0496102_0144231 | 3300048905 | Bacteria | 2234 |
| 196 | Ga0496102_0244949 | 3300048905 | Bacteria | 1690 |
| 197 | Ga0496102_0382044 | 3300048905 | Bacteria | 1325 |
| 198 | Ga0496103_0124267 | 3300048906 | Unclassified | 1645 |
| 199 | Ga0496103_0161552 | 3300048906 | Bacteria | 1437 |
| 200 | Ga0496104_0005017 | 3300048907 | Bacteria | 11546 |
| 201 | Ga0496104_0306762 | 3300048907 | Bacteria | 1500 |
| 202 | Ga0496105_0039780 | 3300048908 | Bacteria | 3877 |
| 203 | Ga0496105_0783046 | 3300048908 | Bacteria | 726 |
| 204 | Ga0496106_0055770 | 3300048909 | Bacteria | 2987 |
| 205 | Ga0496106_0237921 | 3300048909 | Bacteria | 1455 |
| 206 | Ga0496106_0516174 | 3300048909 | Bacteria | 960 |
| 207 | Ga0496106_1450522 | 3300048909 | Bacteria | 529 |
| 208 | Ga0496106_1480621 | 3300048909 | Unclassified | 523 |
| 209 | Ga0496107_0115821 | 3300048910 | Bacteria | 1973 |
| 210 | Ga0496107_0144335 | 3300048910 | Bacteria | 1760 |
| 211 | Ga0496107_0385525 | 3300048910 | Bacteria | 1042 |
| 212 | Ga0496107_0738385 | 3300048910 | Bacteria | 723 |
| 213 | Ga0496108_0001473 | 3300048911 | Bacteria | 18583 |
| 214 | Ga0496108_0014830 | 3300048911 | Bacteria | 6358 |
| 215 | Ga0496108_0056398 | 3300048911 | Bacteria | 3301 |
| 216 | Ga0496108_0255907 | 3300048911 | Bacteria | 1523 |
| 217 | Ga0496109_0002946 | 3300048912 | Bacteria | 14249 |
| 218 | Ga0496109_0032521 | 3300048912 | Unclassified | 4689 |
| 219 | Ga0496109_0657721 | 3300048912 | Bacteria | 985 |
| 220 | Ga0496109_0859829 | 3300048912 | Unclassified | 845 |
| 221 | Ga0496110_0028865 | 3300048913 | Bacteria | 4768 |
| 222 | Ga0496110_0132077 | 3300048913 | Unclassified | 2255 |
| 223 | Ga0496110_0165410 | 3300048913 | Bacteria | 2006 |
| 224 | Ga0496110_0681457 | 3300048913 | Bacteria | 929 |
| 225 | Ga0496111_0048229 | 3300048914 | Bacteria | 3068 |
| 226 | Ga0496112_0000927 | 3300048915 | Bacteria | 21215 |
| 227 | Ga0496112_0004921 | 3300048915 | Bacteria | 11432 |
| 228 | Ga0496112_1404778 | 3300048915 | Bacteria | 613 |
| 229 | Ga0496113_0001367 | 3300048916 | Bacteria | 13524 |
| 230 | Ga0496113_0021469 | 3300048916 | Bacteria | 4555 |
| 231 | Ga0496114_0141341 | 3300048917 | Bacteria | 2084 |
| 232 | Ga0496115_0306535 | 3300048918 | Unclassified | 1301 |
| 233 | Ga0501031_0415050 | 3300049568 | Unclassified | 870 |
| 234 | Ga0501032_0410730 | 3300049569 | Unclassified | 869 |
| 235 | Ga0501032_1062517 | 3300049569 | Bacteria | 508 |
| 236 | Ga0501033_0032804 | 3300049570 | Bacteria | 3900 |
| 237 | Ga0501036_0153214 | 3300049572 | Unclassified | 1944 |
| 238 | Ga0501037_0824294 | 3300049573 | Bacteria | 612 |
| 239 | Ga0501038_0023616 | 3300049574 | Bacteria | 5494 |
| 240 | Ga0501039_0578314 | 3300049575 | Unclassified | 881 |
| 241 | Ga0501040_0046233 | 3300049576 | Bacteria | 2971 |
| 242 | Ga0501040_0210823 | 3300049576 | Bacteria | 1381 |
| 243 | Ga0501041_0116768 | 3300049577 | Bacteria | 1657 |
| 244 | Ga0501041_0138954 | 3300049577 | Unclassified | 1514 |
| 245 | Ga0501041_0173886 | 3300049577 | Bacteria | 1348 |
| 246 | Ga0501042_0095244 | 3300049578 | Unclassified | 2138 |
| 247 | Ga0501042_0133416 | 3300049578 | Bacteria | 1790 |
| 248 | Ga0501042_0989649 | 3300049578 | Unclassified | 613 |
| 249 | Ga0501043_0197230 | 3300049579 | Unclassified | 1564 |
| 250 | Ga0501043_0349741 | 3300049579 | Bacteria | 1123 |
| 251 | Ga0501046_0032073 | 3300049580 | Bacteria | 4256 |
| 252 | Ga0501046_0036159 | 3300049580 | Bacteria | 3977 |
| 253 | Ga0501046_0574672 | 3300049580 | Bacteria | 802 |
| 254 | Ga0501046_1255489 | 3300049580 | Unclassified | 507 |
| 255 | Ga0501048_0071575 | 3300049582 | Bacteria | 2448 |
| 256 | Ga0501048_0121063 | 3300049582 | Unclassified | 1849 |
| 257 | Ga0501048_0218647 | 3300049582 | Unclassified | 1351 |
| 258 | Ga0501067_0091208 | 3300049583 | Bacteria | 1692 |
| 259 | Ga0501068_0257888 | 3300049584 | Bacteria | 1112 |
| 260 | Ga0501068_0821702 | 3300049584 | Unclassified | 610 |
| 261 | Ga0501069_0045019 | 3300049585 | Bacteria | 2444 |
| 262 | Ga0501069_0435156 | 3300049585 | Unclassified | 779 |
| 263 | Ga0501070_0347141 | 3300049586 | Unclassified | 1205 |
| 264 | Ga0501071_0005775 | 3300049587 | Bacteria | 7992 |
| 265 | Ga0501071_0561299 | 3300049587 | Bacteria | 877 |
| 266 | Ga0501071_1321981 | 3300049587 | Unclassified | 557 |
| 267 | Ga0501072_0009687 | 3300049588 | Bacteria | 7327 |
| 268 | Ga0501072_0045307 | 3300049588 | Bacteria | 3458 |
| 269 | Ga0501073_0389566 | 3300049589 | Bacteria | 963 |
| 270 | Ga0501074_0192327 | 3300049590 | Unclassified | 1455 |
| 271 | Ga0501075_0008956 | 3300049591 | Bacteria | 6984 |
| 272 | Ga0501075_0457431 | 3300049591 | Unclassified | 973 |
| 273 | Ga0501075_0687860 | 3300049591 | Bacteria | 779 |
| 274 | Ga0501076_0009013 | 3300049592 | Bacteria | 7348 |
| 275 | Ga0501076_0034128 | 3300049592 | Bacteria | 3975 |
| 276 | Ga0501076_0177053 | 3300049592 | Unclassified | 1738 |
| 277 | Ga0501076_1640260 | 3300049592 | Unclassified | 528 |
| 278 | Ga0501077_0000422 | 3300049593 | Bacteria | 25622 |
| 279 | Ga0501077_0005064 | 3300049593 | Bacteria | 7996 |
| 280 | Ga0501077_0055992 | 3300049593 | Unclassified | 2503 |
| 281 | Ga0501235_066212 | 3300049669 | Bacteria | 851 |
| 282 | Ga0501235_210677 | 3300049669 | Unclassified | 530 |
| 283 | Ga0501079_0002680 | 3300049741 | Bacteria | 12948 |
| 284 | Ga0501079_0015402 | 3300049741 | Bacteria | 5833 |
| 285 | Ga0501079_0124703 | 3300049741 | Unclassified | 2003 |
| 286 | Ga0501079_0188976 | 3300049741 | Bacteria | 1607 |
| 287 | Ga0501079_1517740 | 3300049741 | Bacteria | 527 |
| 288 | Ga0501080_0091123 | 3300049742 | Bacteria | 2832 |
| 289 | Ga0501080_0097396 | 3300049742 | Unclassified | 2731 |
| 290 | Ga0501080_1626920 | 3300049742 | Bacteria | 546 |
| 291 | Ga0501081_0010836 | 3300049743 | Bacteria | 5955 |
| 292 | Ga0501081_0031683 | 3300049743 | Bacteria | 3583 |
| 293 | Ga0501081_0111791 | 3300049743 | Bacteria | 1939 |
| 294 | Ga0501081_0344033 | 3300049743 | Bacteria | 1098 |
| 295 | Ga0501083_0120448 | 3300049744 | Unclassified | 1721 |
| 296 | Ga0501083_0234753 | 3300049744 | Bacteria | 1194 |
| 297 | Ga0501035_0123545 | 3300049822 | Unclassified | 2261 |
| 298 | Ga0501035_0501427 | 3300049822 | Unclassified | 999 |
| 299 | Ga0501045_0002259 | 3300049824 | Bacteria | 13074 |
| 300 | Ga0501045_0039485 | 3300049824 | Unclassified | 3435 |
| 301 | Ga0501045_0525657 | 3300049824 | Bacteria | 878 |
| 302 | Ga0501045_1285036 | 3300049824 | Bacteria | 533 |
| 303 | nmdc:mga05p37_1358963_c1 | 3300050507 | Unclassified | 719 |
| 304 | nmdc:mga05p37_73009_c1 | 3300050507 | Bacteria | 4222 |
| 305 | nmdc:mga05p37_899752_c1 | 3300050507 | Bacteria | 954 |
| 306 | nmdc:mga05p37_938911_c1 | 3300050507 | Bacteria | 927 |
| 307 | nmdc:mga0qj67_16841_c1 | 3300050509 | Bacteria | 5550 |
| 308 | nmdc:mga06r32_1145785_c1 | 3300050510 | Unclassified | 725 |
| 309 | nmdc:mga06r32_31017_c1 | 3300050510 | Bacteria | 5018 |
| 310 | nmdc:mga08y16_359003_c1 | 3300050511 | Bacteria | 1496 |
| 311 | nmdc:mga0n895_1344364_c1 | 3300050512 | Unclassified | 684 |
| 312 | nmdc:mga0n895_1474126_c1 | 3300050512 | Unclassified | 647 |
| 313 | nmdc:mga0n895_613481_c1 | 3300050512 | Unclassified | 1089 |
| 314 | nmdc:mga0rr50_470910_c1 | 3300050513 | Unclassified | 1066 |
| 315 | nmdc:mga0a205_149333_c1 | 3300050515 | Bacteria | 2237 |
| 316 | nmdc:mga0a205_92889_c1 | 3300050515 | Bacteria | 2915 |
| 317 | Ga0501084_0005716 | 3300054114 | Bacteria | 10222 |
| 318 | Ga0501084_0097271 | 3300054114 | Bacteria | 2471 |
| 319 | Ga0501084_0124207 | 3300054114 | Bacteria | 2171 |
| 320 | Ga0501084_0445759 | 3300054114 | Bacteria | 1094 |
| 321 | Ga0590071_000497 | 3300059421 | Bacteria | 11481 |
| 322 | Ga0590071_003670 | 3300059421 | Bacteria | 3768 |
| 323 | Ga0590071_013726 | 3300059421 | Bacteria | 1898 |
| 324 | Ga0590071_015927 | 3300059421 | Bacteria | 1763 |
| 325 | Ga0590074_000876 | 3300059423 | Bacteria | 4684 |
| 326 | Ga0590077_007733 | 3300059426 | Bacteria | 2195 |
| 327 | Ga0501082_0008564 | 3300060353 | Bacteria | 8823 |
| 328 | Ga0501082_0014382 | 3300060353 | Bacteria | 6810 |
| 329 | Ga0501082_0021044 | 3300060353 | Bacteria | 5626 |
| 330 | Ga0501082_0677799 | 3300060353 | Unclassified | 902 |
| 331 | Ga0501082_1421363 | 3300060353 | Unclassified | 606 |
| 332 | Ga0530510_0049826 | 3300061734 | Unclassified | 3025 |
| 333 | Ga0530510_0115442 | 3300061734 | Bacteria | 1968 |
| 334 | Ga0530510_0307780 | 3300061734 | Unclassified | 1186 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005329 | Ga0070683_100451413 | Ga0070683_1004514132 | 112 |
| 2 | 3300005344 | Ga0070661_100272046 | Ga0070661_1002720463 | 112 |
| 3 | 3300005535 | Ga0070684_100313296 | Ga0070684_1003132962 | 112 |
| 4 | 3300005564 | Ga0070664_100202076 | Ga0070664_1002020763 | 112 |
| 5 | 3300025945 | Ga0207679_10449050 | Ga0207679_104490502 | 112 |
| 6 | 3300042530 | Ga0450916_046775 | Ga0450916_046775_62_403 | 112 |
| 7 | 3300025945 | Ga0207679_10056311 | Ga0207679_100563113 | 115 |
| 8 | 3300027876 | Ga0209974_10269462 | Ga0209974_102694621 | 115 |
| 9 | 3300031548 | Ga0307408_100298283 | Ga0307408_1002982832 | 115 |
| 10 | 3300031548 | Ga0307408_101610758 | Ga0307408_1016107582 | 115 |
| 11 | 3300031824 | Ga0307413_10694710 | Ga0307413_106947102 | 115 |
| 12 | 3300031901 | Ga0307406_10051026 | Ga0307406_100510263 | 115 |
| 13 | 3300031995 | Ga0307409_100030674 | Ga0307409_1000306742 | 115 |
| 14 | 3300032002 | Ga0307416_100586926 | Ga0307416_1005869262 | 115 |
| 15 | 3300032004 | Ga0307414_10372661 | Ga0307414_103726612 | 115 |
| 16 | 3300032005 | Ga0307411_10018119 | Ga0307411_100181193 | 115 |
| 17 | 3300049580 | Ga0501046_0574672 | Ga0501046_0574672_50_397 | 115 |
| 18 | 3300049592 | Ga0501076_1640260 | Ga0501076_1640260_72_419 | 115 |
| 19 | 3300049824 | Ga0501045_1285036 | Ga0501045_1285036_82_429 | 115 |
| 20 | 3300031824 | Ga0307413_10023567 | Ga0307413_100235675 | 116 |
| 21 | 3300031852 | Ga0307410_10068637 | Ga0307410_100686374 | 116 |
| 22 | 3300031903 | Ga0307407_10006395 | Ga0307407_100063956 | 116 |
| 23 | 3300031903 | Ga0307407_10139546 | Ga0307407_101395462 | 116 |
| 24 | 3300031995 | Ga0307409_100009132 | Ga0307409_1000091323 | 116 |
| 25 | 3300031995 | Ga0307409_100078209 | Ga0307409_1000782094 | 116 |
| 26 | 3300032004 | Ga0307414_10177551 | Ga0307414_101775512 | 116 |
| 27 | 3300042156 | Ga0439446_0016992 | Ga0439446_0016992_1326_1676 | 116 |
| 28 | 3300060353 | Ga0501082_0677799 | Ga0501082_0677799_93_443 | 116 |
| 29 | 3300009545 | Ga0105237_10760712 | Ga0105237_107607122 | 117 |
| 30 | 3300031901 | Ga0307406_10409410 | Ga0307406_104094101 | 117 |
| 31 | 3300032002 | Ga0307416_100144676 | Ga0307416_1001446761 | 117 |
| 32 | 3300037471 | Ga0395905_0593804 | Ga0395905_0593804_27_383 | 117 |
| 33 | 3300037471 | Ga0395905_1433738 | Ga0395905_1433738_191_547 | 117 |
| 34 | 3300049669 | Ga0501235_210677 | Ga0501235_210677_10_363 | 117 |
| 35 | 3300005329 | Ga0070683_100820481 | Ga0070683_1008204812 | 118 |
| 36 | 3300005341 | Ga0070691_10290171 | Ga0070691_102901712 | 118 |
| 37 | 3300005354 | Ga0070675_102040833 | Ga0070675_1020408331 | 118 |
| 38 | 3300005355 | Ga0070671_100007136 | Ga0070671_1000071365 | 118 |
| 39 | 3300005364 | Ga0070673_100126816 | Ga0070673_1001268162 | 118 |
| 40 | 3300005366 | Ga0070659_100074302 | Ga0070659_1000743023 | 118 |
| 41 | 3300005440 | Ga0070705_100584725 | Ga0070705_1005847251 | 118 |
| 42 | 3300005455 | Ga0070663_101274999 | Ga0070663_1012749991 | 118 |
| 43 | 3300005458 | Ga0070681_10162163 | Ga0070681_101621631 | 118 |
| 44 | 3300005530 | Ga0070679_100837375 | Ga0070679_1008373751 | 118 |
| 45 | 3300005535 | Ga0070684_100226874 | Ga0070684_1002268741 | 118 |
| 46 | 3300005543 | Ga0070672_100041858 | Ga0070672_1000418582 | 118 |
| 47 | 3300005546 | Ga0070696_100249696 | Ga0070696_1002496962 | 118 |
| 48 | 3300005549 | Ga0070704_100302447 | Ga0070704_1003024472 | 118 |
| 49 | 3300005563 | Ga0068855_100675549 | Ga0068855_1006755493 | 118 |
| 50 | 3300005577 | Ga0068857_102346311 | Ga0068857_1023463111 | 118 |
| 51 | 3300005578 | Ga0068854_100529072 | Ga0068854_1005290723 | 118 |
| 52 | 3300005615 | Ga0070702_101861483 | Ga0070702_1018614832 | 118 |
| 53 | 3300005719 | Ga0068861_100642037 | Ga0068861_1006420372 | 118 |
| 54 | 3300005844 | Ga0068862_101362680 | Ga0068862_1013626802 | 118 |
| 55 | 3300005981 | Ga0081538_10045676 | Ga0081538_100456765 | 118 |
| 56 | 3300006844 | Ga0075428_100261067 | Ga0075428_1002610673 | 118 |
| 57 | 3300006846 | Ga0075430_100328422 | Ga0075430_1003284222 | 118 |
| 58 | 3300006880 | Ga0075429_100742170 | Ga0075429_1007421701 | 118 |
| 59 | 3300009094 | Ga0111539_10080664 | Ga0111539_100806642 | 118 |
| 60 | 3300009094 | Ga0111539_10116443 | Ga0111539_101164432 | 118 |
| 61 | 3300009147 | Ga0114129_10067770 | Ga0114129_100677703 | 118 |
| 62 | 3300009147 | Ga0114129_10123818 | Ga0114129_101238182 | 118 |
| 63 | 3300009147 | Ga0114129_11041168 | Ga0114129_110411682 | 118 |
| 64 | 3300011119 | Ga0105246_10276652 | Ga0105246_102766522 | 118 |
| 65 | 3300014969 | Ga0157376_12738001 | Ga0157376_127380011 | 118 |
| 66 | 3300025904 | Ga0207647_10331454 | Ga0207647_103314542 | 118 |
| 67 | 3300025912 | Ga0207707_10117873 | Ga0207707_101178732 | 118 |
| 68 | 3300025920 | Ga0207649_10391371 | Ga0207649_103913711 | 118 |
| 69 | 3300025921 | Ga0207652_10163612 | Ga0207652_101636123 | 118 |
| 70 | 3300025926 | Ga0207659_11309809 | Ga0207659_113098092 | 118 |
| 71 | 3300025931 | Ga0207644_10001855 | Ga0207644_100018559 | 118 |
| 72 | 3300025932 | Ga0207690_10052602 | Ga0207690_100526023 | 118 |
| 73 | 3300025933 | Ga0207706_11085112 | Ga0207706_110851121 | 118 |
| 74 | 3300025937 | Ga0207669_10525454 | Ga0207669_105254542 | 118 |
| 75 | 3300025940 | Ga0207691_10160227 | Ga0207691_101602273 | 118 |
| 76 | 3300025944 | Ga0207661_10285647 | Ga0207661_102856472 | 118 |
| 77 | 3300025960 | Ga0207651_10047994 | Ga0207651_100479943 | 118 |
| 78 | 3300025981 | Ga0207640_10386735 | Ga0207640_103867353 | 118 |
| 79 | 3300026067 | Ga0207678_10066582 | Ga0207678_100665823 | 118 |
| 80 | 3300026116 | Ga0207674_11417622 | Ga0207674_114176221 | 118 |
| 81 | 3300027364 | Ga0209967_1033063 | Ga0209967_10330632 | 118 |
| 82 | 3300027695 | Ga0209966_1018242 | Ga0209966_10182422 | 118 |
| 83 | 3300027717 | Ga0209998_10042917 | Ga0209998_100429173 | 118 |
| 84 | 3300027876 | Ga0209974_10017196 | Ga0209974_100171962 | 118 |
| 85 | 3300027907 | Ga0207428_11172797 | Ga0207428_111727971 | 118 |
| 86 | 3300028380 | Ga0268265_11349235 | Ga0268265_113492351 | 118 |
| 87 | 3300031548 | Ga0307408_100077518 | Ga0307408_1000775182 | 118 |
| 88 | 3300031548 | Ga0307408_100202479 | Ga0307408_1002024793 | 118 |
| 89 | 3300031731 | Ga0307405_10214904 | Ga0307405_102149043 | 118 |
| 90 | 3300031824 | Ga0307413_11917478 | Ga0307413_119174782 | 118 |
| 91 | 3300031852 | Ga0307410_10162587 | Ga0307410_101625873 | 118 |
| 92 | 3300031901 | Ga0307406_10044099 | Ga0307406_100440992 | 118 |
| 93 | 3300031903 | Ga0307407_10032607 | Ga0307407_100326072 | 118 |
| 94 | 3300032002 | Ga0307416_100206113 | Ga0307416_1002061132 | 118 |
| 95 | 3300032004 | Ga0307414_11371271 | Ga0307414_113712712 | 118 |
| 96 | 3300032005 | Ga0307411_10037821 | Ga0307411_100378212 | 118 |
| 97 | 3300035691 | Ga0373931_0400268 | Ga0373931_0400268_81_473 | 118 |
| 98 | 3300037471 | Ga0395905_0226511 | Ga0395905_0226511_435_791 | 118 |
| 99 | 3300042435 | Ga0439434_0257116 | Ga0439434_0257116_51_407 | 118 |
| 100 | 3300042436 | Ga0439435_0034515 | Ga0439435_0034515_739_1095 | 118 |
| 101 | 3300042437 | Ga0439444_0012637 | Ga0439444_0012637_68_424 | 118 |
| 102 | 3300048903 | Ga0496100_1408890 | Ga0496100_1408890_114_506 | 118 |
| 103 | 3300048906 | Ga0496103_0124267 | Ga0496103_0124267_861_1217 | 118 |
| 104 | 3300048907 | Ga0496104_0306762 | Ga0496104_0306762_113_505 | 118 |
| 105 | 3300048908 | Ga0496105_0783046 | Ga0496105_0783046_23_415 | 118 |
| 106 | 3300048909 | Ga0496106_0516174 | Ga0496106_0516174_255_611 | 118 |
| 107 | 3300048910 | Ga0496107_0738385 | Ga0496107_0738385_224_580 | 118 |
| 108 | 3300048911 | Ga0496108_0056398 | Ga0496108_0056398_242_598 | 118 |
| 109 | 3300048911 | Ga0496108_0255907 | Ga0496108_0255907_570_962 | 118 |
| 110 | 3300048912 | Ga0496109_0657721 | Ga0496109_0657721_493_849 | 118 |
| 111 | 3300048913 | Ga0496110_0165410 | Ga0496110_0165410_1572_1964 | 118 |
| 112 | 3300048913 | Ga0496110_0681457 | Ga0496110_0681457_293_649 | 118 |
| 113 | 3300048915 | Ga0496112_1404778 | Ga0496112_1404778_225_581 | 118 |
| 114 | 3300049568 | Ga0501031_0415050 | Ga0501031_0415050_59_415 | 118 |
| 115 | 3300049569 | Ga0501032_0410730 | Ga0501032_0410730_139_495 | 118 |
| 116 | 3300049569 | Ga0501032_1062517 | Ga0501032_1062517_141_497 | 118 |
| 117 | 3300049570 | Ga0501033_0032804 | Ga0501033_0032804_2674_3030 | 118 |
| 118 | 3300049572 | Ga0501036_0153214 | Ga0501036_0153214_420_776 | 118 |
| 119 | 3300049573 | Ga0501037_0824294 | Ga0501037_0824294_81_437 | 118 |
| 120 | 3300049574 | Ga0501038_0023616 | Ga0501038_0023616_2203_2559 | 118 |
| 121 | 3300049575 | Ga0501039_0578314 | Ga0501039_0578314_239_595 | 118 |
| 122 | 3300049576 | Ga0501040_0046233 | Ga0501040_0046233_1960_2316 | 118 |
| 123 | 3300049576 | Ga0501040_0210823 | Ga0501040_0210823_730_1086 | 118 |
| 124 | 3300049577 | Ga0501041_0116768 | Ga0501041_0116768_252_608 | 118 |
| 125 | 3300049577 | Ga0501041_0138954 | Ga0501041_0138954_214_570 | 118 |
| 126 | 3300049577 | Ga0501041_0173886 | Ga0501041_0173886_914_1270 | 118 |
| 127 | 3300049578 | Ga0501042_0095244 | Ga0501042_0095244_769_1125 | 118 |
| 128 | 3300049578 | Ga0501042_0133416 | Ga0501042_0133416_863_1219 | 118 |
| 129 | 3300049578 | Ga0501042_0989649 | Ga0501042_0989649_238_594 | 118 |
| 130 | 3300049579 | Ga0501043_0197230 | Ga0501043_0197230_965_1321 | 118 |
| 131 | 3300049579 | Ga0501043_0349741 | Ga0501043_0349741_670_1026 | 118 |
| 132 | 3300049580 | Ga0501046_0032073 | Ga0501046_0032073_2254_2610 | 118 |
| 133 | 3300049580 | Ga0501046_0036159 | Ga0501046_0036159_1758_2114 | 118 |
| 134 | 3300049580 | Ga0501046_1255489 | Ga0501046_1255489_32_388 | 118 |
| 135 | 3300049582 | Ga0501048_0071575 | Ga0501048_0071575_1754_2110 | 118 |
| 136 | 3300049582 | Ga0501048_0121063 | Ga0501048_0121063_1218_1574 | 118 |
| 137 | 3300049582 | Ga0501048_0218647 | Ga0501048_0218647_907_1263 | 118 |
| 138 | 3300049584 | Ga0501068_0257888 | Ga0501068_0257888_540_896 | 118 |
| 139 | 3300049584 | Ga0501068_0821702 | Ga0501068_0821702_60_434 | 118 |
| 140 | 3300049585 | Ga0501069_0435156 | Ga0501069_0435156_347_703 | 118 |
| 141 | 3300049586 | Ga0501070_0347141 | Ga0501070_0347141_73_429 | 118 |
| 142 | 3300049587 | Ga0501071_0005775 | Ga0501071_0005775_2565_2921 | 118 |
| 143 | 3300049587 | Ga0501071_0561299 | Ga0501071_0561299_20_376 | 118 |
| 144 | 3300049587 | Ga0501071_1321981 | Ga0501071_1321981_12_368 | 118 |
| 145 | 3300049588 | Ga0501072_0009687 | Ga0501072_0009687_5055_5411 | 118 |
| 146 | 3300049588 | Ga0501072_0045307 | Ga0501072_0045307_2905_3261 | 118 |
| 147 | 3300049589 | Ga0501073_0389566 | Ga0501073_0389566_319_675 | 118 |
| 148 | 3300049590 | Ga0501074_0192327 | Ga0501074_0192327_273_629 | 118 |
| 149 | 3300049591 | Ga0501075_0008956 | Ga0501075_0008956_2596_2952 | 118 |
| 150 | 3300049591 | Ga0501075_0457431 | Ga0501075_0457431_383_739 | 118 |
| 151 | 3300049591 | Ga0501075_0687860 | Ga0501075_0687860_184_540 | 118 |
| 152 | 3300049592 | Ga0501076_0009013 | Ga0501076_0009013_3802_4158 | 118 |
| 153 | 3300049592 | Ga0501076_0034128 | Ga0501076_0034128_2478_2834 | 118 |
| 154 | 3300049592 | Ga0501076_0177053 | Ga0501076_0177053_1156_1512 | 118 |
| 155 | 3300049593 | Ga0501077_0000422 | Ga0501077_0000422_1001_1357 | 118 |
| 156 | 3300049593 | Ga0501077_0005064 | Ga0501077_0005064_5145_5501 | 118 |
| 157 | 3300049593 | Ga0501077_0055992 | Ga0501077_0055992_744_1100 | 118 |
| 158 | 3300049741 | Ga0501079_0002680 | Ga0501079_0002680_4798_5154 | 118 |
| 159 | 3300049741 | Ga0501079_0015402 | Ga0501079_0015402_2702_3058 | 118 |
| 160 | 3300049741 | Ga0501079_0124703 | Ga0501079_0124703_1153_1509 | 118 |
| 161 | 3300049741 | Ga0501079_0188976 | Ga0501079_0188976_1046_1408 | 118 |
| 162 | 3300049741 | Ga0501079_1517740 | Ga0501079_1517740_121_495 | 118 |
| 163 | 3300049742 | Ga0501080_0091123 | Ga0501080_0091123_244_600 | 118 |
| 164 | 3300049742 | Ga0501080_0097396 | Ga0501080_0097396_1008_1364 | 118 |
| 165 | 3300049743 | Ga0501081_0010836 | Ga0501081_0010836_2952_3308 | 118 |
| 166 | 3300049743 | Ga0501081_0031683 | Ga0501081_0031683_953_1309 | 118 |
| 167 | 3300049743 | Ga0501081_0111791 | Ga0501081_0111791_551_907 | 118 |
| 168 | 3300049743 | Ga0501081_0344033 | Ga0501081_0344033_556_912 | 118 |
| 169 | 3300049744 | Ga0501083_0120448 | Ga0501083_0120448_202_558 | 118 |
| 170 | 3300049744 | Ga0501083_0234753 | Ga0501083_0234753_29_385 | 118 |
| 171 | 3300049822 | Ga0501035_0123545 | Ga0501035_0123545_964_1320 | 118 |
| 172 | 3300049822 | Ga0501035_0501427 | Ga0501035_0501427_542_898 | 118 |
| 173 | 3300049824 | Ga0501045_0002259 | Ga0501045_0002259_3160_3516 | 118 |
| 174 | 3300049824 | Ga0501045_0039485 | Ga0501045_0039485_836_1192 | 118 |
| 175 | 3300049824 | Ga0501045_0525657 | Ga0501045_0525657_190_546 | 118 |
| 176 | 3300050507 | nmdc:mga05p37_73009_c1 | nmdc:mga05p37_73009_c1_725_1081 | 118 |
| 177 | 3300050507 | nmdc:mga05p37_899752_c1 | nmdc:mga05p37_899752_c1_432_788 | 118 |
| 178 | 3300050507 | nmdc:mga05p37_938911_c1 | nmdc:mga05p37_938911_c1_34_390 | 118 |
| 179 | 3300050510 | nmdc:mga06r32_1145785_c1 | nmdc:mga06r32_1145785_c1_110_466 | 118 |
| 180 | 3300050511 | nmdc:mga08y16_359003_c1 | nmdc:mga08y16_359003_c1_1023_1379 | 118 |
| 181 | 3300050512 | nmdc:mga0n895_1344364_c1 | nmdc:mga0n895_1344364_c1_199_591 | 118 |
| 182 | 3300054114 | Ga0501084_0005716 | Ga0501084_0005716_8438_8794 | 118 |
| 183 | 3300054114 | Ga0501084_0097271 | Ga0501084_0097271_1432_1788 | 118 |
| 184 | 3300054114 | Ga0501084_0124207 | Ga0501084_0124207_837_1193 | 118 |
| 185 | 3300054114 | Ga0501084_0445759 | Ga0501084_0445759_506_862 | 118 |
| 186 | 3300059421 | Ga0590071_000497 | Ga0590071_000497_9920_10330 | 118 |
| 187 | 3300059421 | Ga0590071_003670 | Ga0590071_003670_2974_3330 | 118 |
| 188 | 3300059421 | Ga0590071_015927 | Ga0590071_015927_795_1151 | 118 |
| 189 | 3300059423 | Ga0590074_000876 | Ga0590074_000876_2400_2756 | 118 |
| 190 | 3300059426 | Ga0590077_007733 | Ga0590077_007733_1480_1836 | 118 |
| 191 | 3300060353 | Ga0501082_0008564 | Ga0501082_0008564_1877_2233 | 118 |
| 192 | 3300060353 | Ga0501082_0014382 | Ga0501082_0014382_3898_4254 | 118 |
| 193 | 3300060353 | Ga0501082_0021044 | Ga0501082_0021044_3241_3597 | 118 |
| 194 | 3300061734 | Ga0530510_0049826 | Ga0530510_0049826_2022_2378 | 118 |
| 195 | 3300061734 | Ga0530510_0115442 | Ga0530510_0115442_1378_1734 | 118 |
| 196 | 3300005293 | Ga0065715_10616642 | Ga0065715_106166421 | 119 |
| 197 | 3300005445 | Ga0070708_100419458 | Ga0070708_1004194583 | 119 |
| 198 | 3300005445 | Ga0070708_100782067 | Ga0070708_1007820672 | 119 |
| 199 | 3300005467 | Ga0070706_100151634 | Ga0070706_1001516342 | 119 |
| 200 | 3300005468 | Ga0070707_100536945 | Ga0070707_1005369452 | 119 |
| 201 | 3300005518 | Ga0070699_100353430 | Ga0070699_1003534301 | 119 |
| 202 | 3300005536 | Ga0070697_101342881 | Ga0070697_1013428812 | 119 |
| 203 | 3300005546 | Ga0070696_100684815 | Ga0070696_1006848152 | 119 |
| 204 | 3300005578 | Ga0068854_100535489 | Ga0068854_1005354892 | 119 |
| 205 | 3300005617 | Ga0068859_100656324 | Ga0068859_1006563242 | 119 |
| 206 | 3300005618 | Ga0068864_100039643 | Ga0068864_1000396434 | 119 |
| 207 | 3300005618 | Ga0068864_100980369 | Ga0068864_1009803691 | 119 |
| 208 | 3300005841 | Ga0068863_100253991 | Ga0068863_1002539913 | 119 |
| 209 | 3300005843 | Ga0068860_101216401 | Ga0068860_1012164012 | 119 |
| 210 | 3300005844 | Ga0068862_102247488 | Ga0068862_1022474881 | 119 |
| 211 | 3300006852 | Ga0075433_10033919 | Ga0075433_100339192 | 119 |
| 212 | 3300006871 | Ga0075434_100672413 | Ga0075434_1006724132 | 119 |
| 213 | 3300006931 | Ga0097620_100656387 | Ga0097620_1006563872 | 119 |
| 214 | 3300009147 | Ga0114129_13124610 | Ga0114129_131246101 | 119 |
| 215 | 3300013297 | Ga0157378_11972088 | Ga0157378_119720881 | 119 |
| 216 | 3300014325 | Ga0163163_11782926 | Ga0163163_117829261 | 119 |
| 217 | 3300025910 | Ga0207684_10235895 | Ga0207684_102358953 | 119 |
| 218 | 3300025945 | Ga0207679_10181420 | Ga0207679_101814202 | 119 |
| 219 | 3300026088 | Ga0207641_10126894 | Ga0207641_101268942 | 119 |
| 220 | 3300026095 | Ga0207676_10028533 | Ga0207676_100285332 | 119 |
| 221 | 3300028380 | Ga0268265_12030147 | Ga0268265_120301472 | 119 |
| 222 | 3300031548 | Ga0307408_100602531 | Ga0307408_1006025313 | 119 |
| 223 | 3300031852 | Ga0307410_10393973 | Ga0307410_103939732 | 119 |
| 224 | 3300031903 | Ga0307407_10044936 | Ga0307407_100449362 | 119 |
| 225 | 3300031911 | Ga0307412_10596297 | Ga0307412_105962972 | 119 |
| 226 | 3300031995 | Ga0307409_100081964 | Ga0307409_1000819642 | 119 |
| 227 | 3300031995 | Ga0307409_100397211 | Ga0307409_1003972111 | 119 |
| 228 | 3300032002 | Ga0307416_100145937 | Ga0307416_1001459372 | 119 |
| 229 | 3300032004 | Ga0307414_10167826 | Ga0307414_101678262 | 119 |
| 230 | 3300032005 | Ga0307411_10046722 | Ga0307411_100467222 | 119 |
| 231 | 3300032005 | Ga0307411_10466249 | Ga0307411_104662491 | 119 |
| 232 | 3300034816 | Ga0373930_0015738 | Ga0373930_0015738_699_1058 | 119 |
| 233 | 3300034816 | Ga0373930_0089769 | Ga0373930_0089769_91_450 | 119 |
| 234 | 3300035084 | Ga0373928_0192660 | Ga0373928_0192660_24_383 | 119 |
| 235 | 3300035088 | Ga0373940_0017549 | Ga0373940_0017549_522_899 | 119 |
| 236 | 3300035090 | Ga0373949_0083095 | Ga0373949_0083095_83_442 | 119 |
| 237 | 3300035112 | Ga0373932_0162013 | Ga0373932_0162013_105_464 | 119 |
| 238 | 3300035114 | Ga0373939_0208015 | Ga0373939_0208015_118_477 | 119 |
| 239 | 3300035691 | Ga0373931_0040166 | Ga0373931_0040166_944_1321 | 119 |
| 240 | 3300037418 | Ga0395900_0619879 | Ga0395900_0619879_453_812 | 119 |
| 241 | 3300037466 | Ga0395898_1361340 | Ga0395898_1361340_117_497 | 119 |
| 242 | 3300037471 | Ga0395905_1183477 | Ga0395905_1183477_236_595 | 119 |
| 243 | 3300038443 | Ga0395901_0250421 | Ga0395901_0250421_1155_1514 | 119 |
| 244 | 3300038443 | Ga0395901_0582933 | Ga0395901_0582933_450_830 | 119 |
| 245 | 3300042012 | Ga0439455_0010919 | Ga0439455_0010919_755_1114 | 119 |
| 246 | 3300042438 | Ga0439459_0014354 | Ga0439459_0014354_34_393 | 119 |
| 247 | 3300042438 | Ga0439459_0054195 | Ga0439459_0054195_457_816 | 119 |
| 248 | 3300042438 | Ga0439459_0083177 | Ga0439459_0083177_120_479 | 119 |
| 249 | 3300048903 | Ga0496100_0391159 | Ga0496100_0391159_655_1014 | 119 |
| 250 | 3300048903 | Ga0496100_0957790 | Ga0496100_0957790_149_508 | 119 |
| 251 | 3300048904 | Ga0496101_0089643 | Ga0496101_0089643_399_758 | 119 |
| 252 | 3300048904 | Ga0496101_0392135 | Ga0496101_0392135_325_684 | 119 |
| 253 | 3300048905 | Ga0496102_0048234 | Ga0496102_0048234_3184_3543 | 119 |
| 254 | 3300048905 | Ga0496102_0144231 | Ga0496102_0144231_1251_1610 | 119 |
| 255 | 3300048905 | Ga0496102_0382044 | Ga0496102_0382044_451_810 | 119 |
| 256 | 3300048906 | Ga0496103_0161552 | Ga0496103_0161552_159_518 | 119 |
| 257 | 3300048907 | Ga0496104_0005017 | Ga0496104_0005017_7078_7437 | 119 |
| 258 | 3300048908 | Ga0496105_0039780 | Ga0496105_0039780_1393_1752 | 119 |
| 259 | 3300048909 | Ga0496106_0055770 | Ga0496106_0055770_2574_2933 | 119 |
| 260 | 3300048909 | Ga0496106_0237921 | Ga0496106_0237921_529_888 | 119 |
| 261 | 3300048909 | Ga0496106_1450522 | Ga0496106_1450522_11_370 | 119 |
| 262 | 3300048909 | Ga0496106_1480621 | Ga0496106_1480621_23_382 | 119 |
| 263 | 3300048910 | Ga0496107_0115821 | Ga0496107_0115821_315_674 | 119 |
| 264 | 3300048910 | Ga0496107_0144335 | Ga0496107_0144335_835_1194 | 119 |
| 265 | 3300048910 | Ga0496107_0385525 | Ga0496107_0385525_389_748 | 119 |
| 266 | 3300048911 | Ga0496108_0001473 | Ga0496108_0001473_14605_14964 | 119 |
| 267 | 3300048911 | Ga0496108_0014830 | Ga0496108_0014830_2622_2981 | 119 |
| 268 | 3300048912 | Ga0496109_0002946 | Ga0496109_0002946_3459_3818 | 119 |
| 269 | 3300048912 | Ga0496109_0032521 | Ga0496109_0032521_4061_4420 | 119 |
| 270 | 3300048912 | Ga0496109_0859829 | Ga0496109_0859829_182_541 | 119 |
| 271 | 3300048913 | Ga0496110_0028865 | Ga0496110_0028865_643_1002 | 119 |
| 272 | 3300048913 | Ga0496110_0132077 | Ga0496110_0132077_76_435 | 119 |
| 273 | 3300048914 | Ga0496111_0048229 | Ga0496111_0048229_2098_2457 | 119 |
| 274 | 3300048915 | Ga0496112_0000927 | Ga0496112_0000927_10746_11105 | 119 |
| 275 | 3300048915 | Ga0496112_0004921 | Ga0496112_0004921_3398_3757 | 119 |
| 276 | 3300048916 | Ga0496113_0001367 | Ga0496113_0001367_3620_3979 | 119 |
| 277 | 3300048916 | Ga0496113_0021469 | Ga0496113_0021469_3264_3623 | 119 |
| 278 | 3300048917 | Ga0496114_0141341 | Ga0496114_0141341_527_886 | 119 |
| 279 | 3300048918 | Ga0496115_0306535 | Ga0496115_0306535_280_639 | 119 |
| 280 | 3300049583 | Ga0501067_0091208 | Ga0501067_0091208_276_635 | 119 |
| 281 | 3300049585 | Ga0501069_0045019 | Ga0501069_0045019_1379_1738 | 119 |
| 282 | 3300050512 | nmdc:mga0n895_613481_c1 | nmdc:mga0n895_613481_c1_349_708 | 119 |
| 283 | 3300050515 | nmdc:mga0a205_92889_c1 | nmdc:mga0a205_92889_c1_1664_2023 | 119 |
| 284 | 3300061734 | Ga0530510_0307780 | Ga0530510_0307780_514_873 | 119 |
| 285 | 3300003322 | rootL2_10207509 | rootL2_102075093 | 120 |
| 286 | 3300005445 | Ga0070708_100440723 | Ga0070708_1004407232 | 120 |
| 287 | 3300005467 | Ga0070706_100375776 | Ga0070706_1003757762 | 120 |
| 288 | 3300005518 | Ga0070699_100739231 | Ga0070699_1007392311 | 120 |
| 289 | 3300007076 | Ga0075435_100445628 | Ga0075435_1004456282 | 120 |
| 290 | 3300025922 | Ga0207646_10108876 | Ga0207646_101088764 | 120 |
| 291 | 3300025939 | Ga0207665_10400240 | Ga0207665_104002402 | 120 |
| 292 | 3300045976 | Ga0466967_0731438 | Ga0466967_0731438_224_586 | 120 |
| 293 | 3300050513 | nmdc:mga0rr50_470910_c1 | nmdc:mga0rr50_470910_c1_515_877 | 120 |
| 294 | 3300059421 | Ga0590071_013726 | Ga0590071_013726_1242_1604 | 120 |
| 295 | 3300006847 | Ga0075431_100005601 | Ga0075431_1000056019 | 121 |
| 296 | 3300050509 | nmdc:mga0qj67_16841_c1 | nmdc:mga0qj67_16841_c1_3648_4013 | 121 |
| 297 | 3300050510 | nmdc:mga06r32_31017_c1 | nmdc:mga06r32_31017_c1_3634_3999 | 121 |
| 298 | 3300042156 | Ga0439446_0015307 | Ga0439446_0015307_988_1359 | 122 |
| 299 | 3300042435 | Ga0439434_0152018 | Ga0439434_0152018_176_547 | 122 |
| 300 | 3300031824 | Ga0307413_10115363 | Ga0307413_101153632 | 123 |
| 301 | 3300031852 | Ga0307410_10592878 | Ga0307410_105928783 | 123 |
| 302 | 3300031903 | Ga0307407_10018317 | Ga0307407_100183173 | 123 |
| 303 | 3300032004 | Ga0307414_10010709 | Ga0307414_100107093 | 123 |
| 304 | 3300042134 | Ga0450898_011633 | Ga0450898_011633_235_609 | 123 |
| 305 | 3300031548 | Ga0307408_100014365 | Ga0307408_1000143655 | 124 |
| 306 | 3300031731 | Ga0307405_10019228 | Ga0307405_100192284 | 124 |
| 307 | 3300031824 | Ga0307413_10043691 | Ga0307413_100436912 | 124 |
| 308 | 3300031852 | Ga0307410_10129553 | Ga0307410_101295534 | 124 |
| 309 | 3300031901 | Ga0307406_10299673 | Ga0307406_102996733 | 124 |
| 310 | 3300031911 | Ga0307412_10160019 | Ga0307412_101600193 | 124 |
| 311 | 3300031995 | Ga0307409_100045052 | Ga0307409_1000450522 | 124 |
| 312 | 3300032002 | Ga0307416_100014356 | Ga0307416_1000143566 | 124 |
| 313 | 3300032004 | Ga0307414_10044938 | Ga0307414_100449382 | 124 |
| 314 | 3300032005 | Ga0307411_10087250 | Ga0307411_100872502 | 124 |
| 315 | 3300032126 | Ga0307415_100007402 | Ga0307415_1000074024 | 124 |
| 316 | 3300042015 | Ga0439462_0019399 | Ga0439462_0019399_144_521 | 124 |
| 317 | 3300042435 | Ga0439434_0027787 | Ga0439434_0027787_1085_1462 | 124 |
| 318 | 3300049669 | Ga0501235_066212 | Ga0501235_066212_37_414 | 124 |
| 319 | 3300049742 | Ga0501080_1626920 | Ga0501080_1626920_14_391 | 124 |
| 320 | 3300060353 | Ga0501082_1421363 | Ga0501082_1421363_13_390 | 124 |
| 321 | 2162886012 | MBSR1b_contig_680217 | MBSR1b_0646.00006080 | 126 |
| 322 | 3300005293 | Ga0065715_10191926 | Ga0065715_101919263 | 126 |
| 323 | 3300005440 | Ga0070705_100053695 | Ga0070705_1000536954 | 126 |
| 324 | 3300005518 | Ga0070699_100016409 | Ga0070699_1000164095 | 126 |
| 325 | 3300005536 | Ga0070697_100016734 | Ga0070697_1000167343 | 126 |
| 326 | 3300005546 | Ga0070696_100007525 | Ga0070696_1000075256 | 126 |
| 327 | 3300005549 | Ga0070704_100169387 | Ga0070704_1001693872 | 126 |
| 328 | 3300006852 | Ga0075433_10049592 | Ga0075433_100495921 | 126 |
| 329 | 3300006871 | Ga0075434_100215972 | Ga0075434_1002159722 | 126 |
| 330 | 3300009147 | Ga0114129_10278929 | Ga0114129_102789294 | 126 |
| 331 | 3300048905 | Ga0496102_0244949 | Ga0496102_0244949_33_413 | 126 |
| 332 | 3300050507 | nmdc:mga05p37_1358963_c1 | nmdc:mga05p37_1358963_c1_59_439 | 126 |
| 333 | 3300050512 | nmdc:mga0n895_1474126_c1 | nmdc:mga0n895_1474126_c1_128_508 | 126 |
| 334 | 3300050515 | nmdc:mga0a205_149333_c1 | nmdc:mga0a205_149333_c1_271_651 | 126 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3myf-assembly1.cif.gz_A | the crystal structure of the hpt domain from the hpt sensor hybrid histidine kinase from shewanella to 1.80a | 0.7656 | 9 | 106 |
| 6ff6-assembly1.cif.gz_A-2 | crystal structure of novel repeat protein bric1 | 0.7604 | 9 | 101 |
| 5w93-assembly3.cif.gz_C | p130cas complex with paxillin ld1 | 0.6809 | 10 | 101 |
| 3kyi-assembly1.cif.gz_A | crystal structure of the phosphorylated p1 domain of chea3 in complex with chey6 from r. sphaeroides | 0.6742 | 9 | 116 |
| 1c03-assembly4.cif.gz_D | crystal structure of ypd1p (triclinic form) | 0.674 | 8 | 117 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P39838_803_889_1.20.120.160 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain | 0.8447 | 14 | 102 | 1.20.120.160 |
| af_P39838_803_889_1.20.120.160 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain | 0.7392 | 14 | 102 | 1.20.120.160 |
| af_I1MCF1_5_152_1.20.120.160 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain | 0.7342 | 8 | 125 | 1.20.120.160 |
| af_A0A2R8QLY2_647_783_1.20.120.230 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like | 0.7024 | 4 | 109 | 1.20.120.230 |
| 3kyiA00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain | 0.6742 | 9 | 116 | 1.20.120.160 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V4KPD6-F1-model_v4 | Transcriptional regulator | 0.9887 | 4 | 110 |
|
| AF-A0A7V9FFV1-F1-model_v4 | HPt domain-containing protein | 0.981 | 1 | 113 |
|
| AF-A0A7V9FFV1-F1-model_v4 | HPt domain-containing protein | 0.9559 | 1 | 113 |
|
| AF-A0A1F4E3I2-F1-model_v4 | HPt domain-containing protein | 0.9242 | 8 | 100 |
GO:0000160
GO:0004672 |
| AF-A0A2W7AKU8-F1-model_v4 | Transcriptional regulator | 0.9141 | 14 | 99 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar