F411706

General Info

Members Datasets Scaffolds Average Seq Length
334 185 334 278

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100091855|Ga0068864_1000918553
Length 328
Sequence MITSKRPAAQCPGLYCISFLLNQIYFYRFIKTKEYLCVDCCTVFVDGILNLNDFPIFDRMREEKTMGLLAEDLTVPSIILDRTVTISCFLPKNIVVAEPLDLLLINDGQNMEELGLTAILDDLISRGEIEPLVCVAIHTGKERKIEYGTAKCADYLGRGAKAGLYTRFIFEELLPFIHSTYNIPSFKEKSFAGFSLGGLSALDIVWNYPDEFSKAGVFSGSLWWRTRGLDDGYNEATDRIMHSQVREGEFHSRLRFFFETGTLDETMDRNNNGIIDSIDDTLGLIDELAAKGYDRQKDIYYLELQDGRHDIATWARAMPVFLKWGWGQ

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
112 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
113 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
114 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
124 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
125 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
126 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
129 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
130 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
131 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
132 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
133 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
134 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
135 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
136 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
137 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
138 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
139 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
140 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
143 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
144 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
154 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
155 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
156 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
157 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
158 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
159 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
160 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
161 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
162 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
163 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
164 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
165 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
166 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
167 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
168 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
169 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
170 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
171 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
172 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
173 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
174 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
175 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
176 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
180 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
181 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
182 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
183 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
184 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
185 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.69
Nodule 0
Rhizoplane 0.3
Rhizosphere 96.11
Stem 0
Stem Tuber 0
Unclassified 0.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000644 3300003203 Bacteria 16307
2 rootL2_10034048 3300003322 Bacteria 1745
3 JGI25160J50197_1001194 3300003354 Bacteria 13206
4 Ga0065704_10119187 3300005289 Bacteria 1804
5 Ga0065712_10069689 3300005290 Bacteria 6873
6 Ga0065707_10100650 3300005295 Unclassified 2915
7 Ga0070676_10044606 3300005328 Unclassified 2581
8 Ga0070683_100002537 3300005329 Bacteria 14576
9 Ga0070690_100047497 3300005330 Bacteria 2731
10 Ga0070690_100169433 3300005330 Bacteria 1502
11 Ga0070670_100021174 3300005331 Bacteria 5593
12 Ga0070670_100040434 3300005331 Bacteria 4009
13 Ga0070670_100090298 3300005331 Bacteria 2633
14 Ga0070670_100392560 3300005331 Bacteria 1224
15 Ga0070670_100422931 3300005331 Bacteria 1178
16 Ga0068869_100229783 3300005334 Bacteria 1473
17 Ga0070666_10000043 3300005335 Bacteria 111402
18 Ga0070666_10008965 3300005335 Bacteria 6227
19 Ga0070666_10010785 3300005335 Bacteria 5719
20 Ga0070666_10064934 3300005335 Bacteria 2476
21 Ga0070689_100040332 3300005340 Bacteria 3579
22 Ga0070689_100195849 3300005340 Bacteria 1647
23 Ga0070689_100327983 3300005340 Unclassified 1280
24 Ga0070661_100003722 3300005344 Bacteria 10511
25 Ga0070668_100381372 3300005347 Bacteria 1200
26 Ga0070669_100197316 3300005353 Bacteria 1582
27 Ga0070675_100083249 3300005354 Bacteria 2670
28 Ga0070671_100007431 3300005355 Bacteria 8759
29 Ga0070671_100099251 3300005355 Bacteria 2442
30 Ga0070671_100100649 3300005355 Bacteria 2425
31 Ga0070671_100119679 3300005355 Bacteria 2216
32 Ga0070673_100066174 3300005364 Bacteria 2886
33 Ga0070673_100129810 3300005364 Unclassified 2113
34 Ga0070673_100190640 3300005364 Bacteria 1761
35 Ga0070688_100002313 3300005365 Bacteria 9629
36 Ga0070688_100041662 3300005365 Bacteria 2820
37 Ga0070688_100183930 3300005365 Bacteria 1451
38 Ga0070659_100026117 3300005366 Bacteria 4492
39 Ga0070659_100447021 3300005366 Bacteria 1096
40 Ga0070667_100008582 3300005367 Bacteria 8469
41 Ga0070667_100027328 3300005367 Bacteria 4746
42 Ga0070667_100062669 3300005367 Bacteria 3150
43 Ga0070667_100161274 3300005367 Bacteria 1975
44 Ga0070667_100248603 3300005367 Bacteria 1589
45 Ga0070663_100191264 3300005455 Bacteria 1593
46 Ga0070678_100004136 3300005456 Bacteria 8175
47 Ga0070678_100067417 3300005456 Bacteria 2663
48 Ga0070662_100004745 3300005457 Bacteria 8615
49 Ga0070662_100123967 3300005457 Bacteria 1983
50 Ga0068867_100078110 3300005459 Bacteria 2489
51 Ga0068867_100511337 3300005459 Bacteria 1034
52 Ga0070685_10009007 3300005466 Bacteria 5148
53 Ga0070684_100010258 3300005535 Bacteria 7416
54 Ga0070684_100014857 3300005535 Bacteria 6318
55 Ga0068853_100000097 3300005539 Bacteria 59626
56 Ga0070672_100165880 3300005543 Unclassified 1835
57 Ga0070693_100106464 3300005547 Bacteria 1717
58 Ga0070693_100200928 3300005547 Unclassified 1295
59 Ga0070693_100300360 3300005547 Bacteria 1082
60 Ga0070665_100397309 3300005548 Bacteria 1386
61 Ga0070665_100572473 3300005548 Bacteria 1142
62 Ga0070665_100684140 3300005548 Bacteria 1039
63 Ga0070664_100047886 3300005564 Bacteria 3613
64 Ga0070664_100072775 3300005564 Bacteria 2948
65 Ga0070664_100096928 3300005564 Bacteria 2560
66 Ga0070664_100367418 3300005564 Bacteria 1311
67 Ga0068854_100059917 3300005578 Bacteria 2752
68 Ga0070702_100025113 3300005615 Bacteria 3189
69 Ga0068852_100023529 3300005616 Bacteria 4960
70 Ga0068852_100166303 3300005616 Bacteria 2064
71 Ga0068852_100262839 3300005616 Bacteria 1658
72 Ga0068859_100000012 3300005617 Bacteria 300376
73 Ga0068859_100015958 3300005617 Bacteria 7549
74 Ga0068859_100056360 3300005617 Bacteria 3955
75 Ga0068859_100064054 3300005617 Bacteria 3708
76 Ga0068864_100005117 3300005618 Bacteria 10746
77 Ga0068864_100008486 3300005618 Bacteria 8477
78 Ga0068864_100054233 3300005618 Bacteria 3460
79 Ga0068864_100091855 3300005618 Bacteria 2679
80 Ga0068866_10094871 3300005718 Bacteria 1633
81 Ga0068866_10102953 3300005718 Bacteria 1578
82 Ga0068861_100018453 3300005719 Bacteria 4971
83 Ga0068861_100155413 3300005719 Bacteria 1881
84 Ga0068851_10080771 3300005834 Unclassified 1697
85 Ga0068851_10102102 3300005834 Bacteria 1523
86 Ga0068870_10040588 3300005840 Bacteria 2414
87 Ga0068870_10102344 3300005840 Bacteria 1621
88 Ga0068863_100006838 3300005841 Bacteria 11182
89 Ga0068863_100075201 3300005841 Bacteria 3196
90 Ga0068863_100325277 3300005841 Unclassified 1494
91 Ga0068858_100005154 3300005842 Bacteria 12803
92 Ga0068858_100015472 3300005842 Bacteria 7175
93 Ga0068858_100253957 3300005842 Bacteria 1670
94 Ga0068858_100447128 3300005842 Bacteria 1245
95 Ga0068860_100004050 3300005843 Bacteria 15046
96 Ga0068860_100009954 3300005843 Bacteria 9423
97 Ga0068860_100010746 3300005843 Bacteria 9037
98 Ga0068860_100237979 3300005843 Bacteria 1770
99 Ga0081539_10000641 3300005985 Bacteria 70679
100 Ga0075366_10020504 3300006195 Unclassified 3836
101 Ga0075366_10035365 3300006195 Bacteria 2945
102 Ga0097621_100002405 3300006237 Bacteria 12826
103 Ga0097621_100013920 3300006237 Bacteria 6008
104 Ga0097621_100066249 3300006237 Bacteria 2974
105 Ga0068871_100002763 3300006358 Bacteria 11988
106 Ga0068871_100041002 3300006358 Bacteria 3710
107 Ga0068871_100043066 3300006358 Bacteria 3626
108 Ga0068871_100098114 3300006358 Bacteria 2451
109 Ga0068865_100045343 3300006881 Bacteria 3014
110 Ga0068865_100190662 3300006881 Bacteria 1585
111 Ga0068865_100452706 3300006881 Bacteria 1062
112 Ga0097620_100000012 3300006931 Bacteria 300376
113 Ga0097620_100015958 3300006931 Bacteria 7549
114 Ga0097620_100056360 3300006931 Bacteria 3955
115 Ga0097620_100064052 3300006931 Bacteria 3708
116 Ga0105251_10083217 3300009011 Bacteria 1477
117 Ga0105247_10003609 3300009101 Bacteria 10044
118 Ga0105247_10006231 3300009101 Bacteria 7400
119 Ga0105243_10145741 3300009148 Unclassified 2026
120 Ga0105241_10001105 3300009174 Bacteria 20534
121 Ga0105242_10034140 3300009176 Bacteria 4078
122 Ga0105242_10138177 3300009176 Bacteria 2111
123 Ga0105248_10688165 3300009177 Bacteria 1154
124 Ga0105237_10000725 3300009545 Bacteria 45577
125 Ga0105238_10452790 3300009551 Bacteria 1280
126 Ga0105249_10020187 3300009553 Bacteria 5954
127 Ga0105249_10032005 3300009553 Bacteria 4757
128 Ga0105249_10036505 3300009553 Bacteria 4458
129 Ga0105249_10055458 3300009553 Bacteria 3626
130 Ga0105239_10001348 3300010375 Bacteria 33093
131 Ga0105239_10028798 3300010375 Bacteria 6107
132 Ga0105239_10059214 3300010375 Bacteria 4204
133 Ga0157373_10069976 3300013100 Bacteria 2480
134 Ga0157373_10118196 3300013100 Unclassified 1863
135 Ga0157371_10311806 3300013102 Bacteria 1140
136 Ga0157374_10007325 3300013296 Bacteria 9407
137 Ga0157374_10061533 3300013296 Bacteria 3516
138 Ga0157374_10120903 3300013296 Bacteria 2527
139 Ga0157374_10134118 3300013296 Unclassified 2399
140 Ga0157378_10010349 3300013297 Bacteria 8143
141 Ga0157378_10021011 3300013297 Bacteria 5743
142 Ga0157378_10073400 3300013297 Bacteria 3076
143 Ga0157378_10088147 3300013297 Unclassified 2816
144 Ga0157378_10117790 3300013297 Bacteria 2444
145 Ga0163162_10004470 3300013306 Bacteria 13467
146 Ga0163162_10005357 3300013306 Bacteria 12383
147 Ga0163162_10017901 3300013306 Bacteria 6931
148 Ga0163162_10038221 3300013306 Bacteria 4790
149 Ga0163162_10040262 3300013306 Bacteria 4672
150 Ga0163162_10184219 3300013306 Bacteria 2214
151 Ga0157372_10110899 3300013307 Bacteria 3142
152 Ga0157375_10001805 3300013308 Bacteria 18354
153 Ga0157375_10107075 3300013308 Bacteria 2889
154 Ga0157375_10160330 3300013308 Bacteria 2391
155 Ga0157375_10219075 3300013308 Bacteria 2061
156 Ga0157375_10474752 3300013308 Unclassified 1416
157 Ga0163163_10000407 3300014325 Bacteria 40536
158 Ga0163163_10000652 3300014325 Bacteria 29704
159 Ga0163163_10115435 3300014325 Bacteria 2716
160 Ga0163163_10225849 3300014325 Bacteria 1921
161 Ga0157380_10033793 3300014326 Bacteria 3940
162 Ga0157380_10460201 3300014326 Bacteria 1224
163 Ga0157377_10017442 3300014745 Bacteria 3713
164 Ga0157379_10024256 3300014968 Bacteria 5385
165 Ga0157379_10083745 3300014968 Bacteria 2858
166 Ga0157376_10002100 3300014969 Bacteria 13399
167 Ga0157376_10007323 3300014969 Bacteria 7864
168 Ga0157376_10315644 3300014969 Bacteria 1484
169 Ga0157376_10687624 3300014969 Bacteria 1027
170 Ga0163161_10000823 3300017792 Bacteria 24283
171 Ga0163161_10130065 3300017792 Bacteria 1898
172 Ga0163161_10167088 3300017792 Bacteria 1680
173 Ga0163161_10563891 3300017792 Bacteria 935
174 Ga0207426_1000258 3300025302 Bacteria 114759
175 Ga0207642_10081969 3300025899 Bacteria 1569
176 Ga0207710_10003944 3300025900 Bacteria 6544
177 Ga0207710_10004413 3300025900 Bacteria 6143
178 Ga0207680_10000108 3300025903 Bacteria 38066
179 Ga0207680_10029990 3300025903 Bacteria 3062
180 Ga0207645_10018557 3300025907 Bacteria 4573
181 Ga0207643_10177252 3300025908 Bacteria 1289
182 Ga0207671_10141919 3300025914 Bacteria 1851
183 Ga0207649_10003147 3300025920 Bacteria 9054
184 Ga0207649_10078676 3300025920 Bacteria 2128
185 Ga0207649_10220109 3300025920 Bacteria 1352
186 Ga0207681_10280116 3300025923 Bacteria 1313
187 Ga0207650_10063261 3300025925 Bacteria 2766
188 Ga0207650_10067504 3300025925 Bacteria 2684
189 Ga0207650_10098844 3300025925 Bacteria 2243
190 Ga0207650_10326262 3300025925 Bacteria 1258
191 Ga0207659_10018772 3300025926 Bacteria 4539
192 Ga0207644_10112662 3300025931 Bacteria 2059
193 Ga0207690_10008634 3300025932 Bacteria 6041
194 Ga0207706_10002124 3300025933 Bacteria 19411
195 Ga0207706_10057700 3300025933 Bacteria 3420
196 Ga0207706_10094248 3300025933 Bacteria 2633
197 Ga0207704_10049210 3300025938 Bacteria 2534
198 Ga0207704_10285133 3300025938 Bacteria 1257
199 Ga0207691_10133808 3300025940 Unclassified 2188
200 Ga0207689_10001398 3300025942 Bacteria 23013
201 Ga0207689_10008442 3300025942 Bacteria 8971
202 Ga0207689_10223100 3300025942 Bacteria 1557
203 Ga0207661_10003834 3300025944 Bacteria 10483
204 Ga0207661_10368460 3300025944 Bacteria 1298
205 Ga0207679_10000408 3300025945 Bacteria 30790
206 Ga0207679_10007934 3300025945 Bacteria 6749
207 Ga0207679_10146232 3300025945 Bacteria 1917
208 Ga0207679_10267460 3300025945 Bacteria 1461
209 Ga0207679_10453888 3300025945 Bacteria 1137
210 Ga0207651_10026288 3300025960 Bacteria 3633
211 Ga0207651_10031683 3300025960 Bacteria 3384
212 Ga0207651_10087409 3300025960 Bacteria 2269
213 Ga0207712_10013631 3300025961 Bacteria 5212
214 Ga0207712_10018237 3300025961 Bacteria 4569
215 Ga0207712_10098520 3300025961 Unclassified 2168
216 Ga0207658_10014585 3300025986 Bacteria 5381
217 Ga0207658_10021496 3300025986 Bacteria 4481
218 Ga0207658_10052877 3300025986 Bacteria 2998
219 Ga0207658_10053933 3300025986 Bacteria 2973
220 Ga0207677_10002319 3300026023 Bacteria 9990
221 Ga0207677_10071602 3300026023 Bacteria 2447
222 Ga0207677_10608208 3300026023 Bacteria 960
223 Ga0207703_10001495 3300026035 Bacteria 21327
224 Ga0207703_10024850 3300026035 Bacteria 4713
225 Ga0207703_10044403 3300026035 Unclassified 3572
226 Ga0207639_10232685 3300026041 Unclassified 1598
227 Ga0207678_10060450 3300026067 Bacteria 3259
228 Ga0207678_10086187 3300026067 Bacteria 2684
229 Ga0207641_10000048 3300026088 Bacteria 178206
230 Ga0207641_10053575 3300026088 Bacteria 3420
231 Ga0207641_10132141 3300026088 Bacteria 2243
232 Ga0207641_10245483 3300026088 Bacteria 1670
233 Ga0207648_10012771 3300026089 Bacteria 7848
234 Ga0207648_10077795 3300026089 Bacteria 2893
235 Ga0207648_10097823 3300026089 Bacteria 2569
236 Ga0207676_10136945 3300026095 Bacteria 2090
237 Ga0207676_10518735 3300026095 Unclassified 1134
238 Ga0207674_10006350 3300026116 Bacteria 13916
239 Ga0207674_10009137 3300026116 Bacteria 11367
240 Ga0207674_10047591 3300026116 Bacteria 4394
241 Ga0207675_100004172 3300026118 Bacteria 13985
242 Ga0207675_100217973 3300026118 Bacteria 1838
243 Ga0207675_100884787 3300026118 Bacteria 909
244 Ga0207683_10009230 3300026121 Bacteria 8404
245 Ga0207683_10095922 3300026121 Bacteria 2644
246 Ga0207698_10057907 3300026142 Bacteria 3000
247 Ga0207698_10143490 3300026142 Bacteria 2061
248 Ga0209974_10032891 3300027876 Bacteria 1719
249 Ga0268266_10353804 3300028379 Bacteria 1381
250 Ga0268264_10001955 3300028381 Bacteria 18514
251 Ga0268264_10004303 3300028381 Bacteria 12148
252 Ga0268264_10326056 3300028381 Bacteria 1454
253 Ga0268264_10422430 3300028381 Bacteria 1286
254 Ga0307515_10000039 3300028794 Bacteria 323229
255 Ga0265327_10000368 3300031251 Bacteria 85604
256 Ga0307509_10073631 3300031507 Bacteria 3556
257 Ga0307410_10179040 3300031852 Bacteria 1604
258 Ga0307406_10048222 3300031901 Bacteria 2689
259 Ga0307416_100078164 3300032002 Bacteria 2783
260 Ga0307414_10100044 3300032004 Bacteria 2180
261 Ga0307411_10061717 3300032005 Bacteria 2497
262 Ga0307415_100125849 3300032126 Bacteria 1931
263 Ga0373935_0202010 3300035692 Bacteria 1374
264 Ga0373937_0056226 3300036401 Bacteria 3613
265 Ga0373925_0202013 3300037068 Bacteria 1581
266 Ga0451577_0004954 3300042876 Bacteria 13843
267 Ga0466972_0000003 3300044658 Bacteria 391452
268 Ga0453684_0040507 3300044712 Bacteria 6324
269 Ga0453684_0061544 3300044712 Bacteria 4818
270 Ga0466970_0002117 3300044765 Bacteria 9583
271 Ga0451576_0302996 3300045051 Unclassified 1672
272 Ga0495592_0052624 3300046454 Bacteria 3023
273 Ga0495608_0117439 3300046511 Bacteria 1707
274 Ga0495618_0064406 3300046514 Bacteria 2329
275 Ga0495643_0015358 3300046522 Bacteria 4526
276 Ga0495640_0093447 3300046533 Bacteria 1982
277 Ga0495587_0034069 3300046536 Bacteria 3072
278 Ga0495634_0037889 3300046642 Bacteria 3292
279 Ga0495611_0035457 3300046648 Bacteria 2210
280 Ga0495600_0045579 3300046809 Bacteria 2861
281 Ga0495672_0015649 3300047320 Bacteria 5141
282 Ga0495676_0191940 3300047321 Bacteria 1424
283 Ga0495680_0197385 3300047322 Bacteria 1445
284 Ga0495686_0026138 3300047472 Bacteria 3821
285 Ga0495686_0146481 3300047472 Bacteria 1389
286 Ga0496108_0402833 3300048911 Bacteria 1195
287 Ga0501292_003538 3300049515 Bacteria 2094
288 Ga0501292_020089 3300049515 Unclassified 1074
289 Ga0501298_025331 3300049521 Bacteria 1135
290 Ga0501032_0006084 3300049569 Bacteria 8894
291 Ga0501034_0001952 3300049571 Bacteria 26110
292 Ga0501034_0132693 3300049571 Bacteria 2473
293 Ga0501036_0295643 3300049572 Bacteria 1355
294 Ga0501037_0024528 3300049573 Bacteria 4460
295 Ga0501037_0027096 3300049573 Bacteria 4234
296 Ga0501038_0035667 3300049574 Bacteria 4366
297 Ga0501039_0149210 3300049575 Bacteria 1837
298 Ga0501043_0030462 3300049579 Bacteria 4240
299 Ga0501043_0148157 3300049579 Bacteria 1837
300 Ga0501047_0118805 3300049581 Bacteria 2526
301 Ga0501048_0006726 3300049582 Bacteria 8733
302 Ga0501070_0013911 3300049586 Bacteria 6775
303 Ga0501074_0008264 3300049590 Bacteria 7545
304 Ga0501077_0402472 3300049593 Bacteria 875
305 Ga0501198_043909 3300049649 Unclassified 781
306 Ga0501201_000273 3300049651 Bacteria 4671
307 Ga0501202_000479 3300049652 Bacteria 5704
308 Ga0501223_000506 3300049663 Bacteria 9452
309 Ga0501224_000674 3300049664 Bacteria 4254
310 Ga0501233_000572 3300049668 Bacteria 5983
311 Ga0501235_006597 3300049669 Bacteria 2525
312 Ga0501243_012607 3300049675 Bacteria 1336
313 Ga0501250_012416 3300049680 Bacteria 1007
314 Ga0501259_008340 3300049688 Bacteria 1666
315 Ga0501221_001361 3300049704 Bacteria 4026
316 Ga0501225_0013790 3300049705 Bacteria 2259
317 Ga0501234_000503 3300049707 Bacteria 6004
318 Ga0501245_000412 3300049708 Bacteria 5157
319 Ga0501079_0047494 3300049741 Bacteria 3312
320 Ga0501083_0350112 3300049744 Bacteria 960
321 Ga0501241_036775 3300049758 Bacteria 939
322 Ga0501264_003932 3300049761 Bacteria 1349
323 Ga0501266_015366 3300049763 Unclassified 1011
324 Ga0501280_014244 3300049776 Unclassified 1130
325 Ga0501283_010529 3300049779 Bacteria 1361
326 Ga0501035_0026724 3300049822 Bacteria 5279
327 Ga0501044_0018651 3300049823 Bacteria 7432
328 Ga0501212_002878 3300049851 Bacteria 2113
329 nmdc:mga0k408_20567_c1 3300050493 Bacteria 3699
330 Ga0500641_0026717 3300053096 Bacteria 2243
331 Ga0500553_088339 3300053101 Bacteria 1371
332 Ga0500568_0004113 3300053139 Bacteria 7877
333 Ga0500611_000031 3300053727 Bacteria 85821
334 Ga0501082_0306512 3300060353 Bacteria 1383

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049649 Ga0501198_043909 Ga0501198_043909_61_708 214
2 3300049851 Ga0501212_002878 Ga0501212_002878_47_694 214
3 3300049515 Ga0501292_020089 Ga0501292_020089_43_720 217
4 3300049763 Ga0501266_015366 Ga0501266_015366_29_706 217
5 3300049569 Ga0501032_0006084 Ga0501032_0006084_1945_2817 243
6 3300049571 Ga0501034_0001952 Ga0501034_0001952_20737_21609 243
7 3300049573 Ga0501037_0024528 Ga0501037_0024528_966_1838 243
8 3300049574 Ga0501038_0035667 Ga0501038_0035667_842_1714 243
9 3300049575 Ga0501039_0149210 Ga0501039_0149210_357_1229 243
10 3300049579 Ga0501043_0030462 Ga0501043_0030462_2582_3454 243
11 3300049582 Ga0501048_0006726 Ga0501048_0006726_820_1692 243
12 3300049586 Ga0501070_0013911 Ga0501070_0013911_1004_1876 243
13 3300049590 Ga0501074_0008264 Ga0501074_0008264_1768_2640 243
14 3300049593 Ga0501077_0402472 Ga0501077_0402472_20_832 243
15 3300049741 Ga0501079_0047494 Ga0501079_0047494_186_1058 243
16 3300049744 Ga0501083_0350112 Ga0501083_0350112_56_928 243
17 3300049822 Ga0501035_0026724 Ga0501035_0026724_4236_5108 243
18 3300049823 Ga0501044_0018651 Ga0501044_0018651_2237_3109 243
19 3300060353 Ga0501082_0306512 Ga0501082_0306512_181_1053 243
20 3300047321 Ga0495676_0191940 Ga0495676_0191940_642_1385 245
21 3300044712 Ga0453684_0061544 Ga0453684_0061544_1255_2079 257
22 3300005328 Ga0070676_10044606 Ga0070676_100446062 259
23 3300005330 Ga0070690_100047497 Ga0070690_1000474972 259
24 3300005331 Ga0070670_100422931 Ga0070670_1004229311 259
25 3300005335 Ga0070666_10010785 Ga0070666_100107851 259
26 3300005355 Ga0070671_100099251 Ga0070671_1000992512 259
27 3300005364 Ga0070673_100129810 Ga0070673_1001298102 259
28 3300005364 Ga0070673_100190640 Ga0070673_1001906402 259
29 3300005366 Ga0070659_100447021 Ga0070659_1004470212 259
30 3300005456 Ga0070678_100004136 Ga0070678_1000041365 259
31 3300005457 Ga0070662_100004745 Ga0070662_1000047452 259
32 3300005547 Ga0070693_100106464 Ga0070693_1001064642 259
33 3300005548 Ga0070665_100572473 Ga0070665_1005724731 259
34 3300005564 Ga0070664_100096928 Ga0070664_1000969281 259
35 3300005578 Ga0068854_100059917 Ga0068854_1000599172 259
36 3300005615 Ga0070702_100025113 Ga0070702_1000251134 259
37 3300005616 Ga0068852_100166303 Ga0068852_1001663032 259
38 3300005617 Ga0068859_100056360 Ga0068859_1000563602 259
39 3300005718 Ga0068866_10102953 Ga0068866_101029531 259
40 3300005840 Ga0068870_10040588 Ga0068870_100405882 259
41 3300005842 Ga0068858_100447128 Ga0068858_1004471282 259
42 3300006237 Ga0097621_100066249 Ga0097621_1000662492 259
43 3300006358 Ga0068871_100043066 Ga0068871_1000430662 259
44 3300006931 Ga0097620_100056360 Ga0097620_1000563602 259
45 3300009176 Ga0105242_10034140 Ga0105242_100341402 259
46 3300013296 Ga0157374_10007325 Ga0157374_100073255 259
47 3300013296 Ga0157374_10134118 Ga0157374_101341182 259
48 3300014969 Ga0157376_10315644 Ga0157376_103156442 259
49 3300017792 Ga0163161_10167088 Ga0163161_101670882 259
50 3300025899 Ga0207642_10081969 Ga0207642_100819692 259
51 3300025903 Ga0207680_10029990 Ga0207680_100299903 259
52 3300025907 Ga0207645_10018557 Ga0207645_100185575 259
53 3300025920 Ga0207649_10220109 Ga0207649_102201091 259
54 3300025925 Ga0207650_10067504 Ga0207650_100675042 259
55 3300025933 Ga0207706_10002124 Ga0207706_100021247 259
56 3300025940 Ga0207691_10133808 Ga0207691_101338082 259
57 3300025942 Ga0207689_10008442 Ga0207689_100084422 259
58 3300025960 Ga0207651_10031683 Ga0207651_100316833 259
59 3300025986 Ga0207658_10053933 Ga0207658_100539332 259
60 3300026023 Ga0207677_10071602 Ga0207677_100716022 259
61 3300026089 Ga0207648_10012771 Ga0207648_100127715 259
62 3300026121 Ga0207683_10009230 Ga0207683_100092304 259
63 3300026142 Ga0207698_10143490 Ga0207698_101434902 259
64 3300028381 Ga0268264_10422430 Ga0268264_104224302 259
65 3300035692 Ga0373935_0202010 Ga0373935_0202010_215_1027 259
66 3300026118 Ga0207675_100217973 Ga0207675_1002179732 261
67 3300032002 Ga0307416_100078164 Ga0307416_1000781641 261
68 3300013306 Ga0163162_10038221 Ga0163162_100382213 262
69 3300003322 rootL2_10034048 rootL2_100340482 263
70 3300031852 Ga0307410_10179040 Ga0307410_101790401 264
71 3300032005 Ga0307411_10061717 Ga0307411_100617172 264
72 3300010375 Ga0105239_10001348 Ga0105239_1000134824 265
73 3300005331 Ga0070670_100040434 Ga0070670_1000404344 266
74 3300013306 Ga0163162_10184219 Ga0163162_101842193 266
75 3300014325 Ga0163163_10000407 Ga0163163_100004079 266
76 3300025925 Ga0207650_10063261 Ga0207650_100632612 266
77 3300028381 Ga0268264_10326056 Ga0268264_103260561 266
78 3300053139 Ga0500568_0004113 Ga0500568_0004113_12_818 266
79 3300005290 Ga0065712_10069689 Ga0065712_100696894 267
80 3300005335 Ga0070666_10008965 Ga0070666_100089652 267
81 3300005340 Ga0070689_100040332 Ga0070689_1000403322 267
82 3300005353 Ga0070669_100197316 Ga0070669_1001973162 267
83 3300005354 Ga0070675_100083249 Ga0070675_1000832492 267
84 3300005365 Ga0070688_100002313 Ga0070688_1000023132 267
85 3300005365 Ga0070688_100183930 Ga0070688_1001839302 267
86 3300005367 Ga0070667_100062669 Ga0070667_1000626693 267
87 3300005457 Ga0070662_100123967 Ga0070662_1001239672 267
88 3300005459 Ga0068867_100078110 Ga0068867_1000781103 267
89 3300005466 Ga0070685_10009007 Ga0070685_100090072 267
90 3300005564 Ga0070664_100072775 Ga0070664_1000727752 267
91 3300005617 Ga0068859_100015958 Ga0068859_1000159588 267
92 3300005618 Ga0068864_100054233 Ga0068864_1000542332 267
93 3300005840 Ga0068870_10102344 Ga0068870_101023442 267
94 3300005841 Ga0068863_100325277 Ga0068863_1003252772 267
95 3300005842 Ga0068858_100015472 Ga0068858_1000154722 267
96 3300005843 Ga0068860_100010746 Ga0068860_1000107469 267
97 3300006358 Ga0068871_100098114 Ga0068871_1000981142 267
98 3300006931 Ga0097620_100015958 Ga0097620_1000159582 267
99 3300009011 Ga0105251_10083217 Ga0105251_100832171 267
100 3300009553 Ga0105249_10055458 Ga0105249_100554582 267
101 3300010375 Ga0105239_10059214 Ga0105239_100592143 267
102 3300013296 Ga0157374_10061533 Ga0157374_100615333 267
103 3300013306 Ga0163162_10040262 Ga0163162_100402623 267
104 3300014326 Ga0157380_10033793 Ga0157380_100337932 267
105 3300014745 Ga0157377_10017442 Ga0157377_100174422 267
106 3300014968 Ga0157379_10024256 Ga0157379_100242562 267
107 3300014969 Ga0157376_10687624 Ga0157376_106876241 267
108 3300025908 Ga0207643_10177252 Ga0207643_101772522 267
109 3300025933 Ga0207706_10094248 Ga0207706_100942483 267
110 3300025945 Ga0207679_10453888 Ga0207679_104538881 267
111 3300025961 Ga0207712_10013631 Ga0207712_100136312 267
112 3300025986 Ga0207658_10021496 Ga0207658_100214961 267
113 3300026035 Ga0207703_10024850 Ga0207703_100248502 267
114 3300026089 Ga0207648_10077795 Ga0207648_100777952 267
115 3300028381 Ga0268264_10004303 Ga0268264_100043037 267
116 3300031901 Ga0307406_10048222 Ga0307406_100482222 267
117 3300049515 Ga0501292_003538 Ga0501292_003538_283_1089 267
118 3300049521 Ga0501298_025331 Ga0501298_025331_36_842 267
119 3300049572 Ga0501036_0295643 Ga0501036_0295643_69_875 267
120 3300049651 Ga0501201_000273 Ga0501201_000273_2465_3271 267
121 3300049652 Ga0501202_000479 Ga0501202_000479_3612_4418 267
122 3300049663 Ga0501223_000506 Ga0501223_000506_3088_3894 267
123 3300049664 Ga0501224_000674 Ga0501224_000674_2640_3446 267
124 3300049668 Ga0501233_000572 Ga0501233_000572_1768_2574 267
125 3300049669 Ga0501235_006597 Ga0501235_006597_57_863 267
126 3300049675 Ga0501243_012607 Ga0501243_012607_445_1251 267
127 3300049680 Ga0501250_012416 Ga0501250_012416_69_875 267
128 3300049688 Ga0501259_008340 Ga0501259_008340_394_1200 267
129 3300049704 Ga0501221_001361 Ga0501221_001361_1585_2391 267
130 3300049705 Ga0501225_0013790 Ga0501225_0013790_395_1201 267
131 3300049707 Ga0501234_000503 Ga0501234_000503_3083_3889 267
132 3300049708 Ga0501245_000412 Ga0501245_000412_3690_4496 267
133 3300049758 Ga0501241_036775 Ga0501241_036775_50_856 267
134 3300049761 Ga0501264_003932 Ga0501264_003932_13_819 267
135 3300049776 Ga0501280_014244 Ga0501280_014244_277_1083 267
136 3300049779 Ga0501283_010529 Ga0501283_010529_226_1032 267
137 3300005331 Ga0070670_100021174 Ga0070670_1000211742 268
138 3300005331 Ga0070670_100392560 Ga0070670_1003925601 268
139 3300005344 Ga0070661_100003722 Ga0070661_1000037228 268
140 3300005355 Ga0070671_100119679 Ga0070671_1001196793 268
141 3300005366 Ga0070659_100026117 Ga0070659_1000261171 268
142 3300005367 Ga0070667_100008582 Ga0070667_1000085824 268
143 3300005456 Ga0070678_100067417 Ga0070678_1000674172 268
144 3300005539 Ga0068853_100000097 Ga0068853_1000000979 268
145 3300005618 Ga0068864_100091855 Ga0068864_1000918553 268
146 3300005719 Ga0068861_100018453 Ga0068861_1000184532 268
147 3300005719 Ga0068861_100155413 Ga0068861_1001554132 268
148 3300005834 Ga0068851_10102102 Ga0068851_101021022 268
149 3300005843 Ga0068860_100009954 Ga0068860_1000099544 268
150 3300006195 Ga0075366_10020504 Ga0075366_100205043 268
151 3300006195 Ga0075366_10035365 Ga0075366_100353652 268
152 3300013100 Ga0157373_10069976 Ga0157373_100699761 268
153 3300013296 Ga0157374_10120903 Ga0157374_101209033 268
154 3300013297 Ga0157378_10021011 Ga0157378_100210115 268
155 3300013297 Ga0157378_10073400 Ga0157378_100734002 268
156 3300013308 Ga0157375_10219075 Ga0157375_102190752 268
157 3300014325 Ga0163163_10225849 Ga0163163_102258492 268
158 3300017792 Ga0163161_10563891 Ga0163161_105638911 268
159 3300025920 Ga0207649_10078676 Ga0207649_100786761 268
160 3300025923 Ga0207681_10280116 Ga0207681_102801162 268
161 3300025932 Ga0207690_10008634 Ga0207690_100086341 268
162 3300025944 Ga0207661_10003834 Ga0207661_100038342 268
163 3300025945 Ga0207679_10000408 Ga0207679_1000040819 268
164 3300025986 Ga0207658_10052877 Ga0207658_100528774 268
165 3300026023 Ga0207677_10002319 Ga0207677_100023194 268
166 3300026023 Ga0207677_10608208 Ga0207677_106082081 268
167 3300026095 Ga0207676_10518735 Ga0207676_105187351 268
168 3300026116 Ga0207674_10006350 Ga0207674_100063502 268
169 3300026116 Ga0207674_10047591 Ga0207674_100475912 268
170 3300026118 Ga0207675_100004172 Ga0207675_1000041724 268
171 3300026118 Ga0207675_100884787 Ga0207675_1008847871 268
172 3300026121 Ga0207683_10095922 Ga0207683_100959222 268
173 3300036401 Ga0373937_0056226 Ga0373937_0056226_1854_2702 268
174 3300037068 Ga0373925_0202013 Ga0373925_0202013_302_1150 268
175 3300045051 Ga0451576_0302996 Ga0451576_0302996_660_1472 268
176 3300046454 Ga0495592_0052624 Ga0495592_0052624_1280_2128 268
177 3300046511 Ga0495608_0117439 Ga0495608_0117439_659_1507 268
178 3300046514 Ga0495618_0064406 Ga0495618_0064406_185_1033 268
179 3300046533 Ga0495640_0093447 Ga0495640_0093447_1048_1896 268
180 3300046536 Ga0495587_0034069 Ga0495587_0034069_1180_2028 268
181 3300046642 Ga0495634_0037889 Ga0495634_0037889_1000_1848 268
182 3300046809 Ga0495600_0045579 Ga0495600_0045579_1818_2666 268
183 3300047322 Ga0495680_0197385 Ga0495680_0197385_364_1212 268
184 3300047472 Ga0495686_0146481 Ga0495686_0146481_512_1324 268
185 3300050493 nmdc:mga0k408_20567_c1 nmdc:mga0k408_20567_c1_2646_3458 268
186 3300003354 JGI25160J50197_1001194 JGI25160J50197_100119413 269
187 3300005289 Ga0065704_10119187 Ga0065704_101191873 269
188 3300005329 Ga0070683_100002537 Ga0070683_1000025377 269
189 3300005334 Ga0068869_100229783 Ga0068869_1002297832 269
190 3300005335 Ga0070666_10064934 Ga0070666_100649343 269
191 3300005340 Ga0070689_100327983 Ga0070689_1003279832 269
192 3300005347 Ga0070668_100381372 Ga0070668_1003813722 269
193 3300005355 Ga0070671_100007431 Ga0070671_1000074316 269
194 3300005367 Ga0070667_100161274 Ga0070667_1001612741 269
195 3300005367 Ga0070667_100248603 Ga0070667_1002486032 269
196 3300005455 Ga0070663_100191264 Ga0070663_1001912642 269
197 3300005459 Ga0068867_100511337 Ga0068867_1005113371 269
198 3300005535 Ga0070684_100014857 Ga0070684_1000148572 269
199 3300005547 Ga0070693_100200928 Ga0070693_1002009282 269
200 3300005548 Ga0070665_100397309 Ga0070665_1003973091 269
201 3300005548 Ga0070665_100684140 Ga0070665_1006841402 269
202 3300005564 Ga0070664_100047886 Ga0070664_1000478861 269
203 3300005564 Ga0070664_100367418 Ga0070664_1003674182 269
204 3300005616 Ga0068852_100262839 Ga0068852_1002628392 269
205 3300005617 Ga0068859_100064054 Ga0068859_1000640544 269
206 3300005618 Ga0068864_100008486 Ga0068864_1000084862 269
207 3300005718 Ga0068866_10094871 Ga0068866_100948712 269
208 3300005842 Ga0068858_100253957 Ga0068858_1002539572 269
209 3300005843 Ga0068860_100237979 Ga0068860_1002379792 269
210 3300006237 Ga0097621_100002405 Ga0097621_1000024054 269
211 3300006358 Ga0068871_100002763 Ga0068871_10000276310 269
212 3300006881 Ga0068865_100045343 Ga0068865_1000453433 269
213 3300006881 Ga0068865_100452706 Ga0068865_1004527061 269
214 3300006931 Ga0097620_100064052 Ga0097620_1000640524 269
215 3300009177 Ga0105248_10688165 Ga0105248_106881651 269
216 3300009553 Ga0105249_10032005 Ga0105249_100320052 269
217 3300009553 Ga0105249_10036505 Ga0105249_100365053 269
218 3300013297 Ga0157378_10010349 Ga0157378_100103496 269
219 3300013306 Ga0163162_10005357 Ga0163162_100053573 269
220 3300013306 Ga0163162_10017901 Ga0163162_100179011 269
221 3300013307 Ga0157372_10110899 Ga0157372_101108992 269
222 3300013308 Ga0157375_10001805 Ga0157375_1000180515 269
223 3300013308 Ga0157375_10107075 Ga0157375_101070752 269
224 3300013308 Ga0157375_10474752 Ga0157375_104747521 269
225 3300014325 Ga0163163_10000652 Ga0163163_100006521 269
226 3300014326 Ga0157380_10460201 Ga0157380_104602011 269
227 3300014968 Ga0157379_10083745 Ga0157379_100837452 269
228 3300014969 Ga0157376_10007323 Ga0157376_100073236 269
229 3300017792 Ga0163161_10000823 Ga0163161_1000082322 269
230 3300017792 Ga0163161_10130065 Ga0163161_101300652 269
231 3300025302 Ga0207426_1000258 Ga0207426_100025876 269
232 3300025920 Ga0207649_10003147 Ga0207649_100031474 269
233 3300025925 Ga0207650_10326262 Ga0207650_103262621 269
234 3300025926 Ga0207659_10018772 Ga0207659_100187723 269
235 3300025933 Ga0207706_10057700 Ga0207706_100577003 269
236 3300025938 Ga0207704_10285133 Ga0207704_102851332 269
237 3300025942 Ga0207689_10223100 Ga0207689_102231001 269
238 3300025944 Ga0207661_10368460 Ga0207661_103684601 269
239 3300025945 Ga0207679_10007934 Ga0207679_100079347 269
240 3300025945 Ga0207679_10267460 Ga0207679_102674601 269
241 3300025960 Ga0207651_10026288 Ga0207651_100262882 269
242 3300025961 Ga0207712_10098520 Ga0207712_100985202 269
243 3300026035 Ga0207703_10044403 Ga0207703_100444034 269
244 3300026067 Ga0207678_10086187 Ga0207678_100861872 269
245 3300026088 Ga0207641_10132141 Ga0207641_101321411 269
246 3300026088 Ga0207641_10245483 Ga0207641_102454832 269
247 3300026095 Ga0207676_10136945 Ga0207676_101369452 269
248 3300026116 Ga0207674_10009137 Ga0207674_100091375 269
249 3300027876 Ga0209974_10032891 Ga0209974_100328912 269
250 3300028379 Ga0268266_10353804 Ga0268266_103538041 269
251 3300031507 Ga0307509_10073631 Ga0307509_100736313 269
252 3300032004 Ga0307414_10100044 Ga0307414_101000442 269
253 3300044658 Ga0466972_0000003 Ga0466972_0000003_127531_128349 269
254 3300044712 Ga0453684_0040507 Ga0453684_0040507_4628_5440 269
255 3300044765 Ga0466970_0002117 Ga0466970_0002117_4013_4831 269
256 3300048911 Ga0496108_0402833 Ga0496108_0402833_278_1093 269
257 3300049571 Ga0501034_0132693 Ga0501034_0132693_1557_2369 269
258 3300049573 Ga0501037_0027096 Ga0501037_0027096_2552_3508 269
259 3300049579 Ga0501043_0148157 Ga0501043_0148157_503_1459 269
260 3300049581 Ga0501047_0118805 Ga0501047_0118805_779_1735 269
261 3300053101 Ga0500553_088339 Ga0500553_088339_338_1150 269
262 3300005295 Ga0065707_10100650 Ga0065707_101006501 270
263 3300005330 Ga0070690_100169433 Ga0070690_1001694331 270
264 3300005331 Ga0070670_100090298 Ga0070670_1000902982 270
265 3300005365 Ga0070688_100041662 Ga0070688_1000416622 270
266 3300005535 Ga0070684_100010258 Ga0070684_1000102584 270
267 3300005543 Ga0070672_100165880 Ga0070672_1001658801 270
268 3300005616 Ga0068852_100023529 Ga0068852_1000235293 270
269 3300005834 Ga0068851_10080771 Ga0068851_100807712 270
270 3300009101 Ga0105247_10003609 Ga0105247_100036094 270
271 3300013308 Ga0157375_10160330 Ga0157375_101603303 270
272 3300025900 Ga0207710_10003944 Ga0207710_100039442 270
273 3300025925 Ga0207650_10098844 Ga0207650_100988442 270
274 3300025945 Ga0207679_10146232 Ga0207679_101462321 270
275 3300026041 Ga0207639_10232685 Ga0207639_102326852 270
276 3300026142 Ga0207698_10057907 Ga0207698_100579073 270
277 3300028794 Ga0307515_10000039 Ga0307515_1000003966 270
278 3300031251 Ga0265327_10000368 Ga0265327_1000036836 270
279 3300046648 Ga0495611_0035457 Ga0495611_0035457_1210_2028 270
280 3300047320 Ga0495672_0015649 Ga0495672_0015649_2691_3509 270
281 3300047472 Ga0495686_0026138 Ga0495686_0026138_2353_3276 270
282 3300005335 Ga0070666_10000043 Ga0070666_1000004338 271
283 3300005340 Ga0070689_100195849 Ga0070689_1001958492 271
284 3300005355 Ga0070671_100100649 Ga0070671_1001006493 271
285 3300005364 Ga0070673_100066174 Ga0070673_1000661743 271
286 3300005367 Ga0070667_100027328 Ga0070667_1000273282 271
287 3300005547 Ga0070693_100300360 Ga0070693_1003003601 271
288 3300005617 Ga0068859_100000012 Ga0068859_100000012143 271
289 3300005618 Ga0068864_100005117 Ga0068864_1000051178 271
290 3300005841 Ga0068863_100006838 Ga0068863_1000068388 271
291 3300005841 Ga0068863_100075201 Ga0068863_1000752012 271
292 3300005842 Ga0068858_100005154 Ga0068858_10000515412 271
293 3300005843 Ga0068860_100004050 Ga0068860_10000405018 271
294 3300006237 Ga0097621_100013920 Ga0097621_1000139202 271
295 3300006358 Ga0068871_100041002 Ga0068871_1000410023 271
296 3300006881 Ga0068865_100190662 Ga0068865_1001906622 271
297 3300006931 Ga0097620_100000012 Ga0097620_100000012143 271
298 3300009101 Ga0105247_10006231 Ga0105247_100062315 271
299 3300009148 Ga0105243_10145741 Ga0105243_101457413 271
300 3300009174 Ga0105241_10001105 Ga0105241_1000110514 271
301 3300009176 Ga0105242_10138177 Ga0105242_101381772 271
302 3300009545 Ga0105237_10000725 Ga0105237_1000072527 271
303 3300009551 Ga0105238_10452790 Ga0105238_104527902 271
304 3300009553 Ga0105249_10020187 Ga0105249_100201876 271
305 3300010375 Ga0105239_10028798 Ga0105239_100287986 271
306 3300013100 Ga0157373_10118196 Ga0157373_101181961 271
307 3300013102 Ga0157371_10311806 Ga0157371_103118062 271
308 3300013297 Ga0157378_10088147 Ga0157378_100881474 271
309 3300013297 Ga0157378_10117790 Ga0157378_101177902 271
310 3300013306 Ga0163162_10004470 Ga0163162_100044708 271
311 3300014325 Ga0163163_10115435 Ga0163163_101154352 271
312 3300014969 Ga0157376_10002100 Ga0157376_100021008 271
313 3300025900 Ga0207710_10004413 Ga0207710_100044134 271
314 3300025903 Ga0207680_10000108 Ga0207680_1000010833 271
315 3300025914 Ga0207671_10141919 Ga0207671_101419192 271
316 3300025931 Ga0207644_10112662 Ga0207644_101126622 271
317 3300025938 Ga0207704_10049210 Ga0207704_100492103 271
318 3300025942 Ga0207689_10001398 Ga0207689_1000139819 271
319 3300025960 Ga0207651_10087409 Ga0207651_100874093 271
320 3300025961 Ga0207712_10018237 Ga0207712_100182373 271
321 3300025986 Ga0207658_10014585 Ga0207658_100145856 271
322 3300026035 Ga0207703_10001495 Ga0207703_1000149516 271
323 3300026088 Ga0207641_10000048 Ga0207641_1000004811 271
324 3300026088 Ga0207641_10053575 Ga0207641_100535752 271
325 3300026089 Ga0207648_10097823 Ga0207648_100978232 271
326 3300028381 Ga0268264_10001955 Ga0268264_100019552 271
327 3300046522 Ga0495643_0015358 Ga0495643_0015358_376_1206 271
328 3300053096 Ga0500641_0026717 Ga0500641_0026717_934_1779 271
329 3300053727 Ga0500611_000031 Ga0500611_000031_48943_49767 271
330 3300026067 Ga0207678_10060450 Ga0207678_100604503 272
331 3300032126 Ga0307415_100125849 Ga0307415_1001258492 272
332 3300003203 JGI25406J46586_10000644 JGI25406J46586_1000064410 273
333 3300005985 Ga0081539_10000641 Ga0081539_1000064155 273
334 3300042876 Ga0451577_0004954 Ga0451577_0004954_12335_13201 273

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00756

Esterase

Putative esterase

77

324

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c87-assembly3.cif.gz_A crystal structure of the enterobactin esterase fes from shigella flexneri in the presence of enterobactin 0.8659 12 265
3c8d-assembly5.cif.gz_A crystal structure of the enterobactin esterase fes from shigella flexneri in the presence of 2,3-di-hydroxy-n-benzoyl-glycine 0.8624 9 265
2b20-assembly1.cif.gz_A crystal structure of enterochelin esterase from shigella flexneri enterochelin esterase 0.8528 13 265
3c87-assembly3.cif.gz_B crystal structure of the enterobactin esterase fes from shigella flexneri in the presence of enterobactin 0.8492 12 265
3c8d-assembly6.cif.gz_D crystal structure of the enterobactin esterase fes from shigella flexneri in the presence of 2,3-di-hydroxy-n-benzoyl-glycine 0.8403 12 265
ID Description Score Start End Superfamily
3c8dD02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8403 12 265 3.40.50.1820
af_Q2FZQ0_2_248_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8283 12 273 3.40.50.1820
af_Q2FZQ0_2_248_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8034 12 273 3.40.50.1820
2gzrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7704 10 262 3.40.50.1820
1jt2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7628 5 266 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A258LH69-F1-model_v4 Esterase 0.961 42 271
AF-A0A4Q3RRI1-F1-model_v4 Esterase 0.9563 8 270
AF-A0A4Q3UP26-F1-model_v4 Esterase 0.9486 72 272
AF-A0A318UN94-F1-model_v4 Putative esterase 0.9431 10 273
AF-A0A4U6CZI7-F1-model_v4 Esterase family protein 0.9411 14 270

Feature Viewer

pLDDT pTM Quality
90.03 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map