F411658

General Info

Members Datasets Scaffolds Average Seq Length
334 186 668 141

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100033335|Ga0070671_1000333352
Length 157
Sequence VISDWQPQRLPYNAYEMAETFESSRAPEPVGAFPHAKRVGNFLFLSGIGPRVRGSKEIPGVTLDADGNIVSYDIKKQCRAVFENVRLVLEDAGASWNDIVDVTVFLTNMKKDFPIYNKLYAEHFAGDGKPNPTRTTIEITALPTPIAIELKVIAALK

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
124 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
132 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
133 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
134 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
135 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
136 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
137 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
138 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
139 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
141 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
152 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
153 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
154 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
155 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
156 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
157 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
158 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
159 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
160 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
161 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
162 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
163 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
166 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
178 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
179 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
180 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
184 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
185 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
186 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 5.39
Rhizosphere 93.71
Stem 0
Stem Tuber 0
Unclassified 26.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_100033335 3300005355 Bacteria 4258
2 CNXas_1000101 3300000545 Bacteria 15756
3 JGI25406J46586_10000541 3300003203 Bacteria 17699
4 JGI25405J52794_10004488 3300003911 Unclassified 2491
5 Ga0065704_10162239 3300005289 Bacteria 1346
6 Ga0065712_10013082 3300005290 Unclassified 2712
7 Ga0065712_10410532 3300005290 Unclassified 722
8 Ga0065715_10127859 3300005293 Bacteria 2075
9 Ga0065707_10227296 3300005295 Bacteria 1202
10 Ga0065707_10255931 3300005295 Bacteria 1111
11 Ga0070658_10053116 3300005327 Bacteria 3288
12 Ga0070676_10159944 3300005328 Bacteria 1449
13 Ga0070676_10163068 3300005328 Bacteria 1436
14 Ga0070690_100061166 3300005330 Bacteria 2425
15 Ga0070690_100117039 3300005330 Unclassified 1785
16 Ga0070690_100328530 3300005330 Bacteria 1104
17 Ga0070670_100033291 3300005331 Archaea 4439
18 Ga0070677_10108208 3300005333 Bacteria 1237
19 Ga0068869_100303367 3300005334 Bacteria 1290
20 Ga0070666_10017143 3300005335 Bacteria 4642
21 Ga0070666_10099498 3300005335 Unclassified 2003
22 Ga0068868_100028418 3300005338 Bacteria 4275
23 Ga0070660_100210913 3300005339 Bacteria 1577
24 Ga0070691_10821671 3300005341 Unclassified 568
25 Ga0070687_100559948 3300005343 Bacteria 779
26 Ga0070687_101178421 3300005343 Bacteria 564
27 Ga0070668_100056469 3300005347 Unclassified 3032
28 Ga0070668_100231292 3300005347 Unclassified 1528
29 Ga0070668_100906853 3300005347 Bacteria 788
30 Ga0070669_100021430 3300005353 Bacteria 4618
31 Ga0070669_100218244 3300005353 Bacteria 1507
32 Ga0070669_100627494 3300005353 Bacteria 902
33 Ga0070675_100081490 3300005354 Bacteria 2699
34 Ga0070675_100513801 3300005354 Bacteria 1080
35 Ga0070671_100023290 3300005355 Bacteria 5066
36 Ga0070671_100475234 3300005355 Bacteria 1074
37 Ga0070671_101057570 3300005355 Unclassified 712
38 Ga0070671_101885498 3300005355 Unclassified 531
39 Ga0070674_100021362 3300005356 Bacteria 4153
40 Ga0070673_100006473 3300005364 Bacteria 7615
41 Ga0070673_100024342 3300005364 Bacteria 4438
42 Ga0070673_100159174 3300005364 Bacteria 1919
43 Ga0070673_100428289 3300005364 Bacteria 1187
44 Ga0070688_100421421 3300005365 Bacteria 992
45 Ga0070667_100059500 3300005367 Unclassified 3232
46 Ga0070667_100366547 3300005367 Unclassified 1306
47 Ga0070667_100426658 3300005367 Bacteria 1209
48 Ga0070667_101911022 3300005367 Bacteria 559
49 Ga0070709_10040168 3300005434 Unclassified 2875
50 Ga0070709_11533271 3300005434 Bacteria 542
51 Ga0070714_100123832 3300005435 Unclassified 2302
52 Ga0070714_100129135 3300005435 Unclassified 2257
53 Ga0070714_101697494 3300005435 Unclassified 617
54 Ga0070713_100031541 3300005436 Bacteria 4222
55 Ga0070713_100510795 3300005436 Unclassified 1135
56 Ga0070713_102201362 3300005436 Unclassified 534
57 Ga0070710_10042842 3300005437 Bacteria 2504
58 Ga0070701_10154753 3300005438 Bacteria 1323
59 Ga0070711_100030650 3300005439 Unclassified 3563
60 Ga0070711_100059860 3300005439 Bacteria 2645
61 Ga0070705_100033787 3300005440 Unclassified 2853
62 Ga0070705_100754222 3300005440 Bacteria 770
63 Ga0070700_100710634 3300005441 Unclassified 800
64 Ga0070708_100020597 3300005445 Bacteria 5564
65 Ga0070708_100184762 3300005445 Bacteria 1949
66 Ga0070708_100232102 3300005445 Bacteria 1731
67 Ga0070708_100240254 3300005445 Unclassified 1700
68 Ga0070708_100629519 3300005445 Unclassified 1011
69 Ga0070708_101133704 3300005445 Unclassified 732
70 Ga0070678_100018166 3300005456 Bacteria 4553
71 Ga0070678_100079935 3300005456 Unclassified 2474
72 Ga0070678_100214453 3300005456 Bacteria 1597
73 Ga0070662_100245254 3300005457 Bacteria 1438
74 Ga0068867_100200681 3300005459 Bacteria 1597
75 Ga0068867_100539034 3300005459 Bacteria 1009
76 Ga0070685_10449587 3300005466 Bacteria 902
77 Ga0070706_100001280 3300005467 Bacteria 26834
78 Ga0070706_100062241 3300005467 Bacteria 3448
79 Ga0070706_100076080 3300005467 Unclassified 3107
80 Ga0070706_100081360 3300005467 Bacteria 2999
81 Ga0070706_100095870 3300005467 Unclassified 2754
82 Ga0070706_100352162 3300005467 Bacteria 1372
83 Ga0070706_100457841 3300005467 Bacteria 1187
84 Ga0070707_100022134 3300005468 Bacteria 6009
85 Ga0070707_100025181 3300005468 Bacteria 5643
86 Ga0070707_100094491 3300005468 Bacteria 2895
87 Ga0070707_100103964 3300005468 Bacteria 2753
88 Ga0070707_100486624 3300005468 Bacteria 1195
89 Ga0070707_100925264 3300005468 Bacteria 837
90 Ga0070707_100973603 3300005468 Bacteria 813
91 Ga0070707_101255302 3300005468 Unclassified 707
92 Ga0070707_101559263 3300005468 Unclassified 627
93 Ga0070698_100024479 3300005471 Bacteria 6300
94 Ga0070698_100545237 3300005471 Bacteria 1099
95 Ga0070698_100563292 3300005471 Bacteria 1079
96 Ga0070698_101031493 3300005471 Unclassified 770
97 Ga0070698_101405749 3300005471 Bacteria 649
98 Ga0070699_100049199 3300005518 Bacteria 3649
99 Ga0070699_100130428 3300005518 Bacteria 2216
100 Ga0070699_100237748 3300005518 Bacteria 1625
101 Ga0070697_100007880 3300005536 Bacteria 8299
102 Ga0070697_100016674 3300005536 Bacteria 5779
103 Ga0070697_100020642 3300005536 Bacteria 5214
104 Ga0070697_100467890 3300005536 Bacteria 1100
105 Ga0070672_100009621 3300005543 Bacteria 6671
106 Ga0070686_100039293 3300005544 Bacteria 2948
107 Ga0070693_101223285 3300005547 Unclassified 578
108 Ga0070665_100007633 3300005548 Bacteria 10997
109 Ga0070665_100249761 3300005548 Bacteria 1774
110 Ga0070665_100505606 3300005548 Bacteria 1220
111 Ga0070704_100049140 3300005549 Bacteria 2957
112 Ga0070704_100112081 3300005549 Bacteria 2078
113 Ga0068855_100530725 3300005563 Bacteria 1276
114 Ga0068857_100454806 3300005577 Bacteria 1197
115 Ga0068856_100116542 3300005614 Unclassified 2672
116 Ga0070702_100377770 3300005615 Unclassified 1006
117 Ga0068859_100852943 3300005617 Bacteria 997
118 Ga0068866_10060723 3300005718 Bacteria 1961
119 Ga0068863_100623082 3300005841 Bacteria 1069
120 Ga0068858_101450698 3300005842 Unclassified 676
121 Ga0081455_10057280 3300005937 Bacteria 3303
122 Ga0081455_10107390 3300005937 Unclassified 2225
123 Ga0081539_10000287 3300005985 Bacteria 113988
124 Ga0081539_10069452 3300005985 Bacteria 1896
125 Ga0081539_10108418 3300005985 Bacteria 1403
126 Ga0070717_10021210 3300006028 Bacteria 5119
127 Ga0070717_10122203 3300006028 Unclassified 2232
128 Ga0070717_10142752 3300006028 Bacteria 2066
129 Ga0070717_10563564 3300006028 Bacteria 1032
130 Ga0070717_11557244 3300006028 Bacteria 599
131 Ga0070715_10045674 3300006163 Bacteria 1858
132 Ga0070716_100022069 3300006173 Unclassified 3361
133 Ga0070716_100082609 3300006173 Bacteria 1922
134 Ga0070716_100427415 3300006173 Unclassified 960
135 Ga0070716_100679536 3300006173 Unclassified 784
136 Ga0070716_101228894 3300006173 Bacteria 603
137 Ga0070712_100029249 3300006175 Unclassified 3692
138 Ga0070712_100030762 3300006175 Bacteria 3612
139 Ga0097621_100412179 3300006237 Bacteria 1211
140 Ga0097621_101607018 3300006237 Unclassified 618
141 Ga0068871_100409872 3300006358 Bacteria 1208
142 Ga0068865_100282474 3300006881 Bacteria 1322
143 Ga0075436_100028255 3300006914 Bacteria 3858
144 Ga0075436_100652882 3300006914 Bacteria 777
145 Ga0097620_100852905 3300006931 Bacteria 997
146 Ga0105250_10166039 3300009092 Unclassified 923
147 Ga0105240_10656104 3300009093 Bacteria 1149
148 Ga0111539_10372294 3300009094 Bacteria 1663
149 Ga0111539_10686013 3300009094 Bacteria 1192
150 Ga0105245_10106735 3300009098 Bacteria 2599
151 Ga0105245_10268196 3300009098 Bacteria 1664
152 Ga0105245_10866053 3300009098 Bacteria 944
153 Ga0114129_10000880 3300009147 Bacteria 39098
154 Ga0114129_10707861 3300009147 Unclassified 1294
155 Ga0105237_10361969 3300009545 Bacteria 1455
156 Ga0105237_10442130 3300009545 Bacteria 1306
157 Ga0157371_10495591 3300013102 Unclassified 902
158 Ga0157374_10018584 3300013296 Bacteria 6138
159 Ga0157374_10019237 3300013296 Bacteria 6041
160 Ga0157374_10114730 3300013296 Unclassified 2594
161 Ga0157374_10259165 3300013296 Bacteria 1712
162 Ga0157374_10410936 3300013296 Bacteria 1351
163 Ga0157378_10027967 3300013297 Bacteria 4972
164 Ga0157378_10161358 3300013297 Bacteria 2096
165 Ga0157378_10173398 3300013297 Unclassified 2024
166 Ga0157378_10234071 3300013297 Bacteria 1752
167 Ga0163162_10530341 3300013306 Bacteria 1307
168 Ga0163162_11971460 3300013306 Unclassified 669
169 Ga0157372_10160724 3300013307 Unclassified 2596
170 Ga0157372_10283832 3300013307 Bacteria 1925
171 Ga0157375_10025531 3300013308 Bacteria 5492
172 Ga0157375_10077936 3300013308 Unclassified 3346
173 Ga0157375_11173871 3300013308 Bacteria 900
174 Ga0157375_11564727 3300013308 Unclassified 779
175 Ga0163163_10172668 3300014325 Bacteria 2208
176 Ga0157379_10349679 3300014968 Bacteria 1353
177 Ga0157379_10582939 3300014968 Unclassified 1043
178 Ga0157376_10021880 3300014969 Bacteria 4972
179 Ga0163161_10008101 3300017792 Bacteria 7267
180 Ga0207666_1035226 3300025271 Bacteria 775
181 Ga0207697_10000854 3300025315 Bacteria 17240
182 Ga0207697_10047605 3300025315 Bacteria 1768
183 Ga0207692_10058641 3300025898 Bacteria 1984
184 Ga0207642_10095434 3300025899 Bacteria 1480
185 Ga0207680_10018756 3300025903 Unclassified 3686
186 Ga0207680_10115137 3300025903 Unclassified 1750
187 Ga0207685_10001970 3300025905 Bacteria 4552
188 Ga0207699_10033016 3300025906 Unclassified 2922
189 Ga0207645_10036836 3300025907 Bacteria 3141
190 Ga0207645_10208746 3300025907 Bacteria 1286
191 Ga0207645_10739390 3300025907 Bacteria 669
192 Ga0207684_10000236 3300025910 Bacteria 83977
193 Ga0207684_10040388 3300025910 Bacteria 3955
194 Ga0207684_10085139 3300025910 Bacteria 2693
195 Ga0207684_10088592 3300025910 Unclassified 2637
196 Ga0207684_10190346 3300025910 Bacteria 1770
197 Ga0207695_10372939 3300025913 Bacteria 1313
198 Ga0207693_10003406 3300025915 Bacteria 13576
199 Ga0207693_10005749 3300025915 Bacteria 10291
200 Ga0207693_10030131 3300025915 Bacteria 4284
201 Ga0207663_10081084 3300025916 Bacteria 2124
202 Ga0207663_10148536 3300025916 Bacteria 1641
203 Ga0207663_11201352 3300025916 Bacteria 610
204 Ga0207662_10751508 3300025918 Bacteria 685
205 Ga0207646_10001068 3300025922 Bacteria 34893
206 Ga0207646_10019117 3300025922 Bacteria 6371
207 Ga0207646_10070868 3300025922 Bacteria 3113
208 Ga0207646_10120873 3300025922 Bacteria 2353
209 Ga0207646_10231964 3300025922 Bacteria 1668
210 Ga0207681_10027734 3300025923 Bacteria 3664
211 Ga0207681_10104157 3300025923 Bacteria 2052
212 Ga0207650_10389311 3300025925 Unclassified 1152
213 Ga0207650_10408943 3300025925 Bacteria 1124
214 Ga0207659_10566984 3300025926 Bacteria 966
215 Ga0207687_10137293 3300025927 Bacteria 1851
216 Ga0207687_10630997 3300025927 Bacteria 905
217 Ga0207687_10642726 3300025927 Unclassified 897
218 Ga0207700_10330950 3300025928 Bacteria 1322
219 Ga0207664_10052176 3300025929 Unclassified 3233
220 Ga0207664_11126507 3300025929 Bacteria 701
221 Ga0207644_10067745 3300025931 Unclassified 2603
222 Ga0207644_10077668 3300025931 Unclassified 2445
223 Ga0207644_10275312 3300025931 Bacteria 1350
224 Ga0207644_10622271 3300025931 Bacteria 897
225 Ga0207706_10026311 3300025933 Bacteria 5207
226 Ga0207669_10486610 3300025937 Bacteria 984
227 Ga0207669_10593975 3300025937 Bacteria 899
228 Ga0207704_10390520 3300025938 Bacteria 1095
229 Ga0207665_10028782 3300025939 Unclassified 3672
230 Ga0207665_10115683 3300025939 Unclassified 1890
231 Ga0207665_11006416 3300025939 Unclassified 663
232 Ga0207691_10007536 3300025940 Bacteria 10474
233 Ga0207691_11096470 3300025940 Unclassified 662
234 Ga0207689_10308560 3300025942 Bacteria 1312
235 Ga0207667_10523800 3300025949 Bacteria 1201
236 Ga0207651_10521046 3300025960 Bacteria 1030
237 Ga0207651_11151525 3300025960 Unclassified 696
238 Ga0207651_12029585 3300025960 Unclassified 517
239 Ga0207668_10034009 3300025972 Unclassified 3381
240 Ga0207668_10831056 3300025972 Bacteria 819
241 Ga0207658_10009327 3300025986 Bacteria 6655
242 Ga0207658_10107506 3300025986 Unclassified 2198
243 Ga0207658_11450128 3300025986 Bacteria 628
244 Ga0207677_10214980 3300026023 Bacteria 1538
245 Ga0207708_11171216 3300026075 Bacteria 671
246 Ga0207702_10110654 3300026078 Bacteria 2441
247 Ga0207648_10535233 3300026089 Bacteria 1075
248 Ga0207683_10030250 3300026121 Bacteria 4691
249 Ga0207683_10031593 3300026121 Bacteria 4595
250 Ga0207683_10237527 3300026121 Bacteria 1662
251 Ga0268266_10050663 3300028379 Unclassified 3562
252 Ga0268266_10526375 3300028379 Unclassified 1131
253 Ga0268266_10937004 3300028379 Bacteria 838
254 Ga0268264_10340298 3300028381 Bacteria 1425
255 Ga0307513_10083116 3300031456 Bacteria 3294
256 Ga0307509_10049990 3300031507 Bacteria 4479
257 Ga0307408_100309804 3300031548 Bacteria 1326
258 Ga0307413_10408620 3300031824 Bacteria 1066
259 Ga0307410_10058251 3300031852 Bacteria 2633
260 Ga0307410_10694447 3300031852 Bacteria 857
261 Ga0307410_10760304 3300031852 Unclassified 821
262 Ga0307409_100318971 3300031995 Bacteria 1453
263 Ga0307414_10801606 3300032004 Bacteria 859
264 Ga0307411_10421102 3300032005 Bacteria 1109
265 Ga0373934_0269079 3300035086 Bacteria 705
266 Ga0373944_0245536 3300035089 Bacteria 659
267 Ga0373944_0301979 3300035089 Unclassified 601
268 Ga0373953_0033221 3300035117 Bacteria 2017
269 Ga0373953_0257000 3300035117 Bacteria 760
270 Ga0373943_0063719 3300035170 Bacteria 1849
271 Ga0373943_0065791 3300035170 Bacteria 1824
272 Ga0373955_0030406 3300035172 Bacteria 2819
273 Ga0373955_0401108 3300035172 Bacteria 833
274 Ga0316574_0047364 3300035398 Bacteria 2668
275 Ga0373924_0440422 3300035410 Bacteria 584
276 Ga0373931_0153300 3300035691 Bacteria 1345
277 Ga0373935_0792034 3300035692 Bacteria 700
278 Ga0373933_0672345 3300035724 Bacteria 681
279 Ga0373947_0199001 3300035725 Bacteria 1310
280 Ga0373937_0534273 3300036401 Bacteria 1114
281 Ga0316584_0701095 3300036712 Bacteria 694
282 Ga0373925_0758469 3300037068 Bacteria 800
283 Ga0395899_0526226 3300037312 Unclassified 763
284 Ga0395899_0706300 3300037312 Unclassified 632
285 Ga0395900_0004019 3300037418 Bacteria 15697
286 Ga0395905_0282554 3300037471 Unclassified 1546
287 Ga0395901_0824330 3300038443 Unclassified 915
288 Ga0395901_0934233 3300038443 Unclassified 847
289 Ga0495653_0207577 3300046463 Bacteria 1325
290 Ga0495580_0184843 3300046472 Bacteria 1439
291 Ga0495662_0276592 3300046476 Bacteria 826
292 Ga0495664_0372949 3300046477 Unclassified 858
293 Ga0495585_0214206 3300046492 Bacteria 975
294 Ga0495618_0039749 3300046514 Bacteria 2958
295 Ga0495628_0179299 3300046516 Bacteria 1603
296 Ga0495640_0090619 3300046533 Bacteria 2018
297 Ga0495587_0290429 3300046536 Bacteria 915
298 Ga0495598_0013232 3300046537 Bacteria 2041
299 Ga0495598_0122407 3300046537 Unclassified 883
300 Ga0495635_0546725 3300046663 Bacteria 759
301 Ga0495669_0274510 3300046684 Unclassified 811
302 Ga0495604_0228261 3300047317 Bacteria 1278
303 Ga0495672_0037908 3300047320 Unclassified 2946
304 Ga0495680_0241748 3300047322 Bacteria 1282
305 Ga0495684_0046964 3300047471 Bacteria 3303
306 Ga0496100_0031777 3300048903 Bacteria 3285
307 Ga0496100_0939594 3300048903 Unclassified 680
308 Ga0496101_0036346 3300048904 Unclassified 3488
309 Ga0496102_0034275 3300048905 Unclassified 4565
310 Ga0496104_0422160 3300048907 Bacteria 1246
311 Ga0496106_0002638 3300048909 Bacteria 13335
312 Ga0496107_0035700 3300048910 Bacteria 3564
313 Ga0496107_0866412 3300048910 Bacteria 659
314 Ga0496108_0198615 3300048911 Bacteria 1740
315 Ga0496108_1739725 3300048911 Unclassified 512
316 Ga0496110_0911330 3300048913 Unclassified 785
317 Ga0496112_0136174 3300048915 Bacteria 2426
318 Ga0496112_0185247 3300048915 Unclassified 2045
319 Ga0496112_0185252 3300048915 Bacteria 2045
320 Ga0496113_0292484 3300048916 Bacteria 1303
321 Ga0496113_0337800 3300048916 Bacteria 1208
322 Ga0496114_0068055 3300048917 Bacteria 2989
323 Ga0496115_0362194 3300048918 Bacteria 1181
324 Ga0501069_0662388 3300049585 Unclassified 628
325 Ga0501247_010477 3300049677 Unclassified 1105
326 Ga0501225_0162989 3300049705 Bacteria 687
327 Ga0501270_071866 3300049767 Unclassified 671
328 nmdc:mga05p37_19871_c1 3300050507 Bacteria 8126
329 nmdc:mga08y16_142727_c1 3300050511 Bacteria 2489
330 nmdc:mga08x19_2184_c1 3300050514 Bacteria 11955
331 nmdc:mga08x19_361092_c1 3300050514 Bacteria 1015
332 nmdc:mga0a205_910965_c1 3300050515 Bacteria 726
333 Ga0495595_0597089 3300053084 Bacteria 564
334 Ga0500577_0002612 3300053142 Bacteria 4615
335 Ga0070671_100033335
336 CNXas_1000101
337 JGI25406J46586_10000541
338 JGI25405J52794_10004488
339 Ga0065704_10162239
340 Ga0065712_10013082
341 Ga0065712_10410532
342 Ga0065715_10127859
343 Ga0065707_10227296
344 Ga0065707_10255931
345 Ga0070658_10053116
346 Ga0070676_10159944
347 Ga0070676_10163068
348 Ga0070690_100061166
349 Ga0070690_100117039
350 Ga0070690_100328530
351 Ga0070670_100033291
352 Ga0070677_10108208
353 Ga0068869_100303367
354 Ga0070666_10017143
355 Ga0070666_10099498
356 Ga0068868_100028418
357 Ga0070660_100210913
358 Ga0070691_10821671
359 Ga0070687_100559948
360 Ga0070687_101178421
361 Ga0070668_100056469
362 Ga0070668_100231292
363 Ga0070668_100906853
364 Ga0070669_100021430
365 Ga0070669_100218244
366 Ga0070669_100627494
367 Ga0070675_100081490
368 Ga0070675_100513801
369 Ga0070671_100023290
370 Ga0070671_100475234
371 Ga0070671_101057570
372 Ga0070671_101885498
373 Ga0070674_100021362
374 Ga0070673_100006473
375 Ga0070673_100024342
376 Ga0070673_100159174
377 Ga0070673_100428289
378 Ga0070688_100421421
379 Ga0070667_100059500
380 Ga0070667_100366547
381 Ga0070667_100426658
382 Ga0070667_101911022
383 Ga0070709_10040168
384 Ga0070709_11533271
385 Ga0070714_100123832
386 Ga0070714_100129135
387 Ga0070714_101697494
388 Ga0070713_100031541
389 Ga0070713_100510795
390 Ga0070713_102201362
391 Ga0070710_10042842
392 Ga0070701_10154753
393 Ga0070711_100030650
394 Ga0070711_100059860
395 Ga0070705_100033787
396 Ga0070705_100754222
397 Ga0070700_100710634
398 Ga0070708_100020597
399 Ga0070708_100184762
400 Ga0070708_100232102
401 Ga0070708_100240254
402 Ga0070708_100629519
403 Ga0070708_101133704
404 Ga0070678_100018166
405 Ga0070678_100079935
406 Ga0070678_100214453
407 Ga0070662_100245254
408 Ga0068867_100200681
409 Ga0068867_100539034
410 Ga0070685_10449587
411 Ga0070706_100001280
412 Ga0070706_100062241
413 Ga0070706_100076080
414 Ga0070706_100081360
415 Ga0070706_100095870
416 Ga0070706_100352162
417 Ga0070706_100457841
418 Ga0070707_100022134
419 Ga0070707_100025181
420 Ga0070707_100094491
421 Ga0070707_100103964
422 Ga0070707_100486624
423 Ga0070707_100925264
424 Ga0070707_100973603
425 Ga0070707_101255302
426 Ga0070707_101559263
427 Ga0070698_100024479
428 Ga0070698_100545237
429 Ga0070698_100563292
430 Ga0070698_101031493
431 Ga0070698_101405749
432 Ga0070699_100049199
433 Ga0070699_100130428
434 Ga0070699_100237748
435 Ga0070697_100007880
436 Ga0070697_100016674
437 Ga0070697_100020642
438 Ga0070697_100467890
439 Ga0070672_100009621
440 Ga0070686_100039293
441 Ga0070693_101223285
442 Ga0070665_100007633
443 Ga0070665_100249761
444 Ga0070665_100505606
445 Ga0070704_100049140
446 Ga0070704_100112081
447 Ga0068855_100530725
448 Ga0068857_100454806
449 Ga0068856_100116542
450 Ga0070702_100377770
451 Ga0068859_100852943
452 Ga0068866_10060723
453 Ga0068863_100623082
454 Ga0068858_101450698
455 Ga0081455_10057280
456 Ga0081455_10107390
457 Ga0081539_10000287
458 Ga0081539_10069452
459 Ga0081539_10108418
460 Ga0070717_10021210
461 Ga0070717_10122203
462 Ga0070717_10142752
463 Ga0070717_10563564
464 Ga0070717_11557244
465 Ga0070715_10045674
466 Ga0070716_100022069
467 Ga0070716_100082609
468 Ga0070716_100427415
469 Ga0070716_100679536
470 Ga0070716_101228894
471 Ga0070712_100029249
472 Ga0070712_100030762
473 Ga0097621_100412179
474 Ga0097621_101607018
475 Ga0068871_100409872
476 Ga0068865_100282474
477 Ga0075436_100028255
478 Ga0075436_100652882
479 Ga0097620_100852905
480 Ga0105250_10166039
481 Ga0105240_10656104
482 Ga0111539_10372294
483 Ga0111539_10686013
484 Ga0105245_10106735
485 Ga0105245_10268196
486 Ga0105245_10866053
487 Ga0114129_10000880
488 Ga0114129_10707861
489 Ga0105237_10361969
490 Ga0105237_10442130
491 Ga0157371_10495591
492 Ga0157374_10018584
493 Ga0157374_10019237
494 Ga0157374_10114730
495 Ga0157374_10259165
496 Ga0157374_10410936
497 Ga0157378_10027967
498 Ga0157378_10161358
499 Ga0157378_10173398
500 Ga0157378_10234071
501 Ga0163162_10530341
502 Ga0163162_11971460
503 Ga0157372_10160724
504 Ga0157372_10283832
505 Ga0157375_10025531
506 Ga0157375_10077936
507 Ga0157375_11173871
508 Ga0157375_11564727
509 Ga0163163_10172668
510 Ga0157379_10349679
511 Ga0157379_10582939
512 Ga0157376_10021880
513 Ga0163161_10008101
514 Ga0207666_1035226
515 Ga0207697_10000854
516 Ga0207697_10047605
517 Ga0207692_10058641
518 Ga0207642_10095434
519 Ga0207680_10018756
520 Ga0207680_10115137
521 Ga0207685_10001970
522 Ga0207699_10033016
523 Ga0207645_10036836
524 Ga0207645_10208746
525 Ga0207645_10739390
526 Ga0207684_10000236
527 Ga0207684_10040388
528 Ga0207684_10085139
529 Ga0207684_10088592
530 Ga0207684_10190346
531 Ga0207695_10372939
532 Ga0207693_10003406
533 Ga0207693_10005749
534 Ga0207693_10030131
535 Ga0207663_10081084
536 Ga0207663_10148536
537 Ga0207663_11201352
538 Ga0207662_10751508
539 Ga0207646_10001068
540 Ga0207646_10019117
541 Ga0207646_10070868
542 Ga0207646_10120873
543 Ga0207646_10231964
544 Ga0207681_10027734
545 Ga0207681_10104157
546 Ga0207650_10389311
547 Ga0207650_10408943
548 Ga0207659_10566984
549 Ga0207687_10137293
550 Ga0207687_10630997
551 Ga0207687_10642726
552 Ga0207700_10330950
553 Ga0207664_10052176
554 Ga0207664_11126507
555 Ga0207644_10067745
556 Ga0207644_10077668
557 Ga0207644_10275312
558 Ga0207644_10622271
559 Ga0207706_10026311
560 Ga0207669_10486610
561 Ga0207669_10593975
562 Ga0207704_10390520
563 Ga0207665_10028782
564 Ga0207665_10115683
565 Ga0207665_11006416
566 Ga0207691_10007536
567 Ga0207691_11096470
568 Ga0207689_10308560
569 Ga0207667_10523800
570 Ga0207651_10521046
571 Ga0207651_11151525
572 Ga0207651_12029585
573 Ga0207668_10034009
574 Ga0207668_10831056
575 Ga0207658_10009327
576 Ga0207658_10107506
577 Ga0207658_11450128
578 Ga0207677_10214980
579 Ga0207708_11171216
580 Ga0207702_10110654
581 Ga0207648_10535233
582 Ga0207683_10030250
583 Ga0207683_10031593
584 Ga0207683_10237527
585 Ga0268266_10050663
586 Ga0268266_10526375
587 Ga0268266_10937004
588 Ga0268264_10340298
589 Ga0307513_10083116
590 Ga0307509_10049990
591 Ga0307408_100309804
592 Ga0307413_10408620
593 Ga0307410_10058251
594 Ga0307410_10694447
595 Ga0307410_10760304
596 Ga0307409_100318971
597 Ga0307414_10801606
598 Ga0307411_10421102
599 Ga0373934_0269079
600 Ga0373944_0245536
601 Ga0373944_0301979
602 Ga0373953_0033221
603 Ga0373953_0257000
604 Ga0373943_0063719
605 Ga0373943_0065791
606 Ga0373955_0030406
607 Ga0373955_0401108
608 Ga0316574_0047364
609 Ga0373924_0440422
610 Ga0373931_0153300
611 Ga0373935_0792034
612 Ga0373933_0672345
613 Ga0373947_0199001
614 Ga0373937_0534273
615 Ga0316584_0701095
616 Ga0373925_0758469
617 Ga0395899_0526226
618 Ga0395899_0706300
619 Ga0395900_0004019
620 Ga0395905_0282554
621 Ga0395901_0824330
622 Ga0395901_0934233
623 Ga0495653_0207577
624 Ga0495580_0184843
625 Ga0495662_0276592
626 Ga0495664_0372949
627 Ga0495585_0214206
628 Ga0495618_0039749
629 Ga0495628_0179299
630 Ga0495640_0090619
631 Ga0495587_0290429
632 Ga0495598_0013232
633 Ga0495598_0122407
634 Ga0495635_0546725
635 Ga0495669_0274510
636 Ga0495604_0228261
637 Ga0495672_0037908
638 Ga0495680_0241748
639 Ga0495684_0046964
640 Ga0496100_0031777
641 Ga0496100_0939594
642 Ga0496101_0036346
643 Ga0496102_0034275
644 Ga0496104_0422160
645 Ga0496106_0002638
646 Ga0496107_0035700
647 Ga0496107_0866412
648 Ga0496108_0198615
649 Ga0496108_1739725
650 Ga0496110_0911330
651 Ga0496112_0136174
652 Ga0496112_0185247
653 Ga0496112_0185252
654 Ga0496113_0292484
655 Ga0496113_0337800
656 Ga0496114_0068055
657 Ga0496115_0362194
658 Ga0501069_0662388
659 Ga0501247_010477
660 Ga0501225_0162989
661 Ga0501270_071866
662 nmdc:mga05p37_19871_c1
663 nmdc:mga08y16_142727_c1
664 nmdc:mga08x19_2184_c1
665 nmdc:mga08x19_361092_c1
666 nmdc:mga0a205_910965_c1
667 Ga0495595_0597089
668 Ga0500577_0002612

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

23

156

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jd1-assembly1.cif.gz_F crystal structure of yeo7_yeast 0.939 1 141
2uyk-assembly1.cif.gz_A crystal structure of e. coli tdcf with bound serine 0.934 3 141
3quw-assembly1.cif.gz_A crystal structure of yeast mmf1 0.9324 1 141
1jd1-assembly1.cif.gz_F crystal structure of yeo7_yeast 0.9318 1 141
2dyy-assembly4.cif.gz_K crystal structure of putative translation initiation inhibitor ph0854 from pyrococcus horikoshii 0.9316 3 141
ID Description Score Start End Superfamily
1jd1F00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.939 1 141 3.30.1330.40
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9319 19 140 3.30.1330.40
1jd1F00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9318 1 141 3.30.1330.40
af_Q86KR5_2_129_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9238 1 141 3.30.1330.40
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9154 19 140 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A2E3RQM2-F1-model_v4 2-aminomuconate deaminase 0.9947 1 141 GO:0005829
GO:0019239
AF-A0A7W1P402-F1-model_v4 RidA family protein 0.9901 1 128 GO:0005829
GO:0019239
AF-A0A520QCZ0-F1-model_v4 RidA family protein 0.9884 3 141 GO:0005829
GO:0019239
AF-A0A2W6AJR0-F1-model_v4 2-aminomuconate deaminase 0.9873 1 141 GO:0005829
GO:0019239
AF-A0A661Y2G5-F1-model_v4 RidA family protein 0.9866 1 106 GO:0005829
GO:0019239

Map