F411627

General Info

Members Datasets Scaffolds Average Seq Length
334 255 134 553

Family's Representative Sequence

Representative Sequence 3300003761|Ga0055535_1003552|Ga0055535_10035521
Length 615
Sequence VHEYATILNKLIFKFGWRIENRNCTLVYDFSVIAVFLFFDVSISEYLLSCRLYDEGGYHMTTVFSAMKRKSIVQAMGQKPLDVIVIGGGITGAGIALDATTRGLRTALFEMQDFAAGTSSRSTKLVHGGLRYLKQFDVKTVAEVGKERAIVYENGPHVTTPEWMLLPLHRGGTFGKFSTGIGLRVYDXLAGVKRSERRRMLSEQETLSREPLLKXEGLLGGGYYVEYRTDDARLTIEVMKEAVRNGAMALNYMKVDSFLYENGKIIGVRVIDQLDGEAFEFRAKKIINAAGPWVDELRNKDHSKTGKHLQLSKGVHLVIDQSKFPLKQAIYFDTPDGRMVFAIPRDGKTYVGTTDTFYKADPVQPVMTKEDRDYIMKAIQYMFPSIQLTADDVESSWAGVRPLIXEEGKNASEISRRDXIWQSPSGLITIAGGKLTGYRKMAEMIVDLVMKLLSQDEGITFTAAKTKEMPISGGHVGGSADFLGFVEGKMNEGVRNGLDGSLAKRWARMYGSNVDVIFDLADRYQSKTEQSGLPLEVLVPLVYAMEEEMTLKPVDFFIRRTGALFFNIQWVRKWKQPVIAYMASTFGWTEEQRNQYAAELDTALHQAVVPQVEAN

Samples

Sample ID Description Type Environment
1 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
2 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
3 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
4 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
5 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
6 2554235283 Bacillus safensis VK Isolate Rhizosphere
7 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
8 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
9 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
10 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
11 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
12 2599185353 Staphylococcus sp. NFPP34 Isolate Rhizoplane
13 2600254943 Staphylococcus pasteuri NFIX07 Isolate Rhizoplane
14 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
15 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
16 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
17 2643221729 Bacillus sp. Root11 Isolate Unclassified
18 2643221730 Bacillus sp. Root131 Isolate Unclassified
19 2643221731 Bacillus sp. Root147 Isolate Unclassified
20 2643221732 Bacillus sp. Root239 Isolate Unclassified
21 2643221735 Bacillus sp. Root920 Isolate Unclassified
22 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
23 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
24 2671180694 Paenibacillus sp. A3 Isolate Unclassified
25 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
26 2684622632 Bacillus cereus 905 Isolate Unclassified
27 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
28 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
29 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
30 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
31 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
32 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
33 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
34 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
35 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
36 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
37 2738541295 Bacillus sp. OK085 Isolate Unclassified
38 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
39 2738541358 Bacillus sp. OV752 Isolate Unclassified
40 2738543006 Bacillus sp. OK077 Isolate Unclassified
41 2738543010 Bacillus sp. YR335 Isolate Unclassified
42 2738543017 Bacillus sp. OV186 Isolate Unclassified
43 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
44 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
45 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
46 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
47 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
48 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
49 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
50 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
51 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
52 2811994870 Bacillus sp. JB4 Isolate Unclassified
53 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
54 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
55 2818991441 Niallia circulans 3243 Isolate Rhizosphere
56 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
57 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
58 2818991459 Paenibacillus sp. 597 Isolate Unclassified
59 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
60 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
61 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
62 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
63 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
64 2842682962 Bacillus sp. R-72492 Isolate Unclassified
65 2842882022 Bacillus sp. R-71893 Isolate Unclassified
66 2849139964 Bacillus sp. R-71875 Isolate Unclassified
67 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
68 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
69 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
70 2857472729 Cohnella sp. R-74144 Isolate Unclassified
71 2857581216 Bacillus sp. R-71922 Isolate Unclassified
72 2857586860 Bacillus sp. R-71935 Isolate Unclassified
73 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
74 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
75 2860837431 Bacillus sp. WR11 Isolate Unclassified
76 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
77 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
78 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
79 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
80 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
81 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
82 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
83 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
84 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
85 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
86 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
87 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
88 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
89 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
90 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
91 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
92 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
93 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
94 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
95 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
96 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
97 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
98 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
99 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
100 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
101 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
102 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
103 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
104 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
105 2919720352 Priestia megaterium 4340 Isolate Unclassified
106 2919726948 Bacillus pumilus 4489 Isolate Unclassified
107 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
108 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
109 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
110 2929004312 Priestia megaterium 1104 Isolate Unclassified
111 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
112 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
113 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
114 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
115 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
116 2938917290 Bacillus sp. CR71 Isolate Unclassified
117 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
118 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
119 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
120 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
121 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
122 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
123 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
124 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
125 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
126 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
127 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
128 2965761152 Bacillus sp. COPE52 Isolate Unclassified
129 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
130 2969141011 Bacillus velezensis MH25 Isolate Unclassified
131 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
132 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
133 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
134 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
135 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
136 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
137 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
138 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
139 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
140 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
141 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
142 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
143 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
144 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
145 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
146 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
147 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
148 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
149 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
150 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
151 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
152 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
153 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
154 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
155 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
156 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
157 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
158 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
159 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
160 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
161 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
162 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
163 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
164 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
165 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
166 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
167 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
168 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
169 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
170 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
171 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
172 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
173 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
174 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
175 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
176 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
177 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
181 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
182 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
184 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
190 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
191 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
192 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
193 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
194 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
195 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
199 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
200 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
201 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
202 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
203 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
206 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
207 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
208 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
209 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
210 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
222 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
223 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
224 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
225 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
226 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
227 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
228 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
229 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
230 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
233 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
234 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
235 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
236 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
237 8022653035 Bacillus sp. Rc4 Isolate Unclassified
238 8022792930 Bacillus sp. Xin Isolate Rhizosphere
239 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
240 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
241 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
242 8023438354 Bacillus sp. BH2 Isolate Unclassified
243 8023444577 Bacillus sp. BH32 Isolate Unclassified
244 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
245 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
246 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
247 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
248 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
249 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
250 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
251 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
252 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
253 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere
254 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
255 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 39.52
Metatranscriptomes 0.6
Isolates 59.88

Biome Distribution

Category Percentage (%)
Aerial Root 0.6
Bulb 0
Endosphere 17.07
Nodule 0.3
Rhizoplane 4.49
Rhizosphere 38.62
Stem 0
Stem Tuber 0
Unclassified 38.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000009 3300003187 Bacteria 296412
2 JGI25151J46595_10002010 3300003187 Bacteria 12727
3 JGI25151J46595_10004937 3300003187 Bacteria 6962
4 JGI25151J46595_10009020 3300003187 Bacteria 4753
5 JGI25151J46595_10009322 3300003187 Bacteria 4655
6 JGI25151J46595_10009989 3300003187 Bacteria 4449
7 JGI25151J46595_10027576 3300003187 Bacteria 2273
8 JGI25151J46595_10028339 3300003187 Bacteria 2232
9 rootH1_10003422 3300003316 Bacteria 22736
10 rootH1_10005035 3300003316 Bacteria 36177
11 rootH1_10038110 3300003316 Unclassified 2787
12 rootH2_10005602 3300003320 Bacteria 2943
13 rootH2_10156093 3300003320 Unclassified 4819
14 rootL2_10003800 3300003322 Bacteria 36331
15 rootL2_10045290 3300003322 Bacteria 4749
16 rootL2_10272636 3300003322 Bacteria 3645
17 rootH1_10001636 3300003323 Bacteria 76904
18 rootH1_10024796 3300003323 Bacteria 6122
19 rootH1_10095601 3300003323 Bacteria 3905
20 rootH1_10255422 3300003323 Bacteria 4780
21 Ga0006562J51391_1000707 3300003578 Bacteria 9540
22 Ga0006562J51391_1010186 3300003578 Bacteria 4126
23 Ga0055538_1000068 3300003751 Bacteria 97329
24 Ga0055538_1000187 3300003751 Bacteria 37729
25 Ga0055538_1000280 3300003751 Bacteria 26196
26 Ga0055538_1000387 3300003751 Bacteria 17964
27 Ga0055532_1000030 3300003758 Bacteria 232738
28 Ga0055535_1003552 3300003761 Bacteria 4327
29 Ga0055536_1024730 3300003781 Bacteria 1732
30 Ga0055531_10005052 3300003794 Bacteria 7820
31 Ga0055541_1002741 3300003841 Bacteria 3434
32 Ga0065165_1000505 3300005262 Bacteria 60144
33 Ga0070671_100013454 3300005355 Bacteria 6596
34 Ga0111539_10026074 3300009094 Bacteria 7156
35 Ga0111539_10044579 3300009094 Bacteria 5313
36 Ga0105247_10010264 3300009101 Bacteria 5670
37 Ga0105242_10006312 3300009176 Bacteria 9135
38 Ga0105246_10000452 3300011119 Bacteria 22011
39 Ga0157378_10049646 3300013297 Bacteria 3733
40 Ga0209784_100041 3300025224 Bacteria 228573
41 Ga0209784_100072 3300025224 Bacteria 149587
42 Ga0209784_100078 3300025224 Bacteria 137701
43 Ga0209784_100208 3300025224 Bacteria 41620
44 Ga0209566_100029 3300025225 Bacteria 349213
45 Ga0209566_100046 3300025225 Bacteria 247053
46 Ga0209566_100072 3300025225 Bacteria 167764
47 Ga0209147_100065 3300025229 Bacteria 232777
48 Ga0209147_100342 3300025229 Bacteria 34412
49 Ga0209147_105994 3300025229 Bacteria 1740
50 Ga0209437_101201 3300025233 Bacteria 7539
51 Ga0209673_1011090 3300025273 Bacteria 3743
52 Ga0209676_1000493 3300025292 Bacteria 63491
53 Ga0209676_1000631 3300025292 Bacteria 50835
54 Ga0209676_1000851 3300025292 Bacteria 39362
55 Ga0209676_1001431 3300025292 Bacteria 22537
56 Ga0209676_1011031 3300025292 Bacteria 3692
57 Ga0209025_1000001 3300025294 Bacteria 1888151
58 Ga0209025_1000167 3300025294 Bacteria 164554
59 Ga0209025_1000209 3300025294 Bacteria 140401
60 Ga0209025_1000449 3300025294 Bacteria 80562
61 Ga0209025_1000997 3300025294 Bacteria 41992
62 Ga0209025_1001107 3300025294 Bacteria 38671
63 Ga0209025_1001856 3300025294 Bacteria 24783
64 Ga0209025_1002627 3300025294 Bacteria 18426
65 Ga0209025_1002827 3300025294 Bacteria 17457
66 Ga0209025_1003662 3300025294 Bacteria 14220
67 Ga0209025_1003968 3300025294 Bacteria 13280
68 Ga0209025_1004019 3300025294 Bacteria 13183
69 Ga0209025_1005407 3300025294 Bacteria 10431
70 Ga0209025_1008124 3300025294 Bacteria 7622
71 Ga0209025_1015012 3300025294 Bacteria 4709
72 Ga0209025_1018883 3300025294 Bacteria 3876
73 Ga0209025_1031732 3300025294 Bacteria 2490
74 Ga0209050_1003363 3300025298 Bacteria 11910
75 Ga0209050_1014231 3300025298 Bacteria 3447
76 Ga0209257_1000005 3300025304 Bacteria 1592528
77 Ga0209257_1021827 3300025304 Bacteria 2308
78 Ga0207696_1001996 3300025711 Bacteria 10336
79 Ga0207709_10004773 3300025935 Bacteria 7778
80 Ga0209371_1004889 3300027312 Bacteria 5591
81 Ga0207428_10035753 3300027907 Unclassified 4057
82 Ga0307515_10000394 3300028794 Bacteria 105754
83 Ga0268256_1004678 3300030500 Bacteria 5591
84 Ga0307509_10062094 3300031507 Bacteria 3941
85 Ga0307408_100007540 3300031548 Bacteria 7193
86 Ga0307408_100043554 3300031548 Bacteria 3194
87 Ga0307414_10001002 3300032004 Bacteria 14432
88 Ga0373927_0023113 3300035695 Bacteria 4072
89 Ga0395900_0018138 3300037418 Bacteria 7182
90 Ga0395901_0000819 3300038443 Bacteria 34465
91 Ga0237819_00052 3300038705 Bacteria 40279
92 Ga0237819_00551 3300038705 Bacteria 12581
93 Ga0439439_0004652 3300041406 Bacteria 3102
94 Ga0439433_0006285 3300041999 Bacteria 2556
95 Ga0439449_0000338 3300042007 Bacteria 17044
96 Ga0453684_0125734 3300044712 Bacteria 3086
97 Ga0466959_0001415 3300045049 Bacteria 14672
98 Ga0451576_0022420 3300045051 Bacteria 6847
99 Ga0466967_0000127 3300045976 Bacteria 28993
100 Ga0495590_0013849 3300046457 Bacteria 2957
101 Ga0495638_0000020 3300046460 Bacteria 372434
102 Ga0495625_0013312 3300046660 Bacteria 6615
103 Ga0495676_0032889 3300047321 Bacteria 4373
104 Ga0495626_0043232 3300048091 Bacteria 2115
105 Ga0496102_0114625 3300048905 Bacteria 2515
106 Ga0496104_0013268 3300048907 Bacteria 7427
107 Ga0496105_0000183 3300048908 Bacteria 41823
108 Ga0496106_0001718 3300048909 Bacteria 16333
109 Ga0496107_0032505 3300048910 Bacteria 3729
110 Ga0496108_0004146 3300048911 Bacteria 11654
111 Ga0496109_0000900 3300048912 Bacteria 24752
112 Ga0496110_0006901 3300048913 Bacteria 9028
113 Ga0496110_0008837 3300048913 Bacteria 8116
114 Ga0496111_0031840 3300048914 Bacteria 3758
115 Ga0496112_0003137 3300048915 Bacteria 13562
116 Ga0496116_0033599 3300048919 Bacteria 3637
117 Ga0496117_0006054 3300048920 Bacteria 12421
118 Ga0496117_0106359 3300048920 Bacteria 1761
119 Ga0496118_0058272 3300048921 Bacteria 2888
120 Ga0496119_0008566 3300048922 Bacteria 8967
121 Ga0496119_0011991 3300048922 Bacteria 7097
122 Ga0496120_0004759 3300048923 Bacteria 11137
123 Ga0496121_0029789 3300048924 Bacteria 5032
124 Ga0496122_0038384 3300048925 Bacteria 3839
125 Ga0496124_0049579 3300048927 Bacteria 3581
126 Ga0496125_0002237 3300048928 Bacteria 25736
127 Ga0496125_0006468 3300048928 Bacteria 12656
128 Ga0496125_0018033 3300048928 Bacteria 6709
129 Ga0496125_0072181 3300048928 Bacteria 2692
130 Ga0496126_0003568 3300048929 Bacteria 19513
131 Ga0496126_0102213 3300048929 Bacteria 2506
132 nmdc:mga08y16_167914_c1 3300050511 Bacteria 2280
133 nmdc:mga08y16_25835_c1 3300050511 Bacteria 6197
134 Ga0500616_0000004 3300053153 Bacteria 1002714

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003323 rootH1_10095601 rootH1_100956013 455
2 iso_pu_bacteria 2695420354 2695626781 476
3 3300003316 rootH1_10038110 rootH1_100381103 491
4 3300003794 Ga0055531_10005052 Ga0055531_100050524 491
5 3300025304 Ga0209257_1000005 Ga0209257_10000051323 491
6 3300044712 Ga0453684_0125734 Ga0453684_0125734_662_2308 499
7 3300048920 Ga0496117_0106359 Ga0496117_0106359_175_1731 510
8 3300035695 Ga0373927_0023113 Ga0373927_0023113_1591_3156 518
9 3300025294 Ga0209025_1002627 Ga0209025_100262712 521
10 3300032004 Ga0307414_10001002 Ga0307414_1000100214 521
11 3300003320 rootH2_10156093 rootH2_101560932 524
12 3300025294 Ga0209025_1031732 Ga0209025_10317322 527
13 3300048905 Ga0496102_0114625 Ga0496102_0114625_839_2485 530
14 iso_pu_bacteria 2881644220 2881647247 534
15 3300045051 Ga0451576_0022420 Ga0451576_0022420_3339_5003 535
16 iso_pu_bacteria 2857604169 2857605212 536
17 iso_pu_bacteria 2857609550 2857611966 536
18 3300003578 Ga0006562J51391_1010186 Ga0006562J51391_10101863 537
19 3300025294 Ga0209025_1002827 Ga0209025_100282711 537
20 3300048908 Ga0496105_0000183 Ga0496105_0000183_32_1672 538
21 iso_pu_bacteria 2928510474 2928510976 538
22 iso_pu_bacteria 3006984091 3006986667 538
23 3300025294 Ga0209025_1000209 Ga0209025_100020926 539
24 3300025294 Ga0209025_1003662 Ga0209025_10036629 539
25 3300031507 Ga0307509_10062094 Ga0307509_100620943 539
26 3300038705 Ga0237819_00052 Ga0237819_00052_14511_16193 539
27 3300038705 Ga0237819_00551 Ga0237819_00551_2132_3814 539
28 3300045976 Ga0466967_0000127 Ga0466967_0000127_7693_9375 539
29 iso_pu_bacteria 8057632132 8057634959 539
30 3300003751 Ga0055538_1000187 Ga0055538_100018733 540
31 3300009094 Ga0111539_10026074 Ga0111539_100260742 540
32 3300025224 Ga0209784_100078 Ga0209784_10007869 540
33 3300046660 Ga0495625_0013312 Ga0495625_0013312_4339_5973 540
34 3300050511 nmdc:mga08y16_167914_c1 nmdc:mga08y16_167914_c1_119_1756 540
35 3300003316 rootH1_10003422 rootH1_100034224 541
36 3300003323 rootH1_10001636 rootH1_1000163623 541
37 3300003323 rootH1_10024796 rootH1_100247963 541
38 3300048091 Ga0495626_0043232 Ga0495626_0043232_279_1904 541
39 iso_pu_bacteria 3001267043 3001267707 541
40 iso_pu_bacteria 3001272096 3001273182 541
41 iso_pu_bacteria 3006988479 3006989522 541
42 3300009094 Ga0111539_10044579 Ga0111539_100445793 542
43 3300025298 Ga0209050_1003363 Ga0209050_10033637 542
44 3300025298 Ga0209050_1014231 Ga0209050_10142312 542
45 3300025304 Ga0209257_1021827 Ga0209257_10218271 542
46 3300027907 Ga0207428_10035753 Ga0207428_100357534 542
47 3300028794 Ga0307515_10000394 Ga0307515_1000039456 542
48 3300046460 Ga0495638_0000020 Ga0495638_0000020_157463_159106 542
49 3300050511 nmdc:mga08y16_25835_c1 nmdc:mga08y16_25835_c1_3064_4707 542
50 3300053153 Ga0500616_0000004 Ga0500616_0000004_952385_954028 542
51 iso_pu_bacteria 2738541299 2738837692 542
52 iso_pu_bacteria 2818991451 2819629121 542
53 iso_pu_bacteria 2852673933 2852675083 542
54 iso_pu_bacteria 2928510474 2928512038 542
55 3300003322 rootL2_10272636 rootL2_102726363 543
56 iso_pu_bacteria 2788500588 2791212444 543
57 iso_pu_bacteria 2818991451 2819626049 543
58 iso_pu_bacteria 2904606771 2904611189 543
59 iso_pu_bacteria 2939593269 2939593483 543
60 iso_pu_bacteria 3006973921 3006976759 543
61 iso_pu_bacteria 8055531788 8055533123 543
62 3300013297 Ga0157378_10049646 Ga0157378_100496464 544
63 3300025292 Ga0209676_1011031 Ga0209676_10110313 544
64 3300025294 Ga0209025_1001856 Ga0209025_100185612 544
65 iso_pu_bacteria 2593339131 2595091010 544
66 iso_pu_bacteria 2757320391 2757566508 544
67 iso_pu_bacteria 2775507177 2777761616 544
68 iso_pu_bacteria 2775507192 2777836004 544
69 iso_pu_bacteria 2936340661 2936343644 544
70 iso_pu_bacteria 3006969106 3006973523 544
71 iso_pu_bacteria 8055632911 8055637282 544
72 3300003751 Ga0055538_1000280 Ga0055538_100028015 545
73 3300003781 Ga0055536_1024730 Ga0055536_10247301 545
74 3300025224 Ga0209784_100208 Ga0209784_10020818 545
75 3300025292 Ga0209676_1000631 Ga0209676_100063140 545
76 3300025294 Ga0209025_1001107 Ga0209025_10011077 545
77 3300025294 Ga0209025_1005407 Ga0209025_10054075 545
78 iso_pu_bacteria 2925326138 2925327789 545
79 iso_pu_bacteria 8002317523 8002318617 545
80 iso_pu_bacteria 8022948649 8022951255 545
81 3300003758 Ga0055532_1000030 Ga0055532_1000030179 546
82 3300025229 Ga0209147_100065 Ga0209147_100065181 546
83 3300038443 Ga0395901_0000819 Ga0395901_0000819_27361_29016 546
84 iso_pu_bacteria 2599185353 2600198208 546
85 iso_pu_bacteria 2643221543 2643740622 546
86 iso_pu_bacteria 2671180330 2672338272 546
87 iso_pu_bacteria 2816332186 2816865781 546
88 iso_pu_bacteria 2818991441 2819569441 546
89 iso_pu_bacteria 2821111986 2821116524 546
90 iso_pu_bacteria 2842682962 2842686253 546
91 iso_pu_bacteria 2849139964 2849143122 546
92 iso_pu_bacteria 2857581216 2857583588 546
93 iso_pu_bacteria 2864733723 2864734595 546
94 iso_pu_bacteria 2864997549 2864999765 546
95 iso_pu_bacteria 2885526491 2885532259 546
96 iso_pu_bacteria 2889042446 2889048362 546
97 iso_pu_bacteria 2889295896 2889299821 546
98 iso_pu_bacteria 2904162308 2904167778 546
99 iso_pu_bacteria 2904490793 2904494622 546
100 iso_pu_bacteria 2919160200 2919164240 546
101 iso_pu_bacteria 2931384279 2931385478 546
102 iso_pu_bacteria 2939679117 2939680348 546
103 iso_pu_bacteria 2945991243 2945995885 546
104 iso_pu_bacteria 2946053406 2946058589 546
105 iso_pu_bacteria 2981284811 2981287093 546
106 iso_pu_bacteria 2981289755 2981292043 546
107 iso_pu_bacteria 2981980479 2981982727 546
108 iso_pu_bacteria 2981985349 2981987485 546
109 3300003187 JGI25151J46595_10004937 JGI25151J46595_100049375 547
110 3300003322 rootL2_10045290 rootL2_100452903 547
111 3300003323 rootH1_10255422 rootH1_102554223 547
112 3300003751 Ga0055538_1000068 Ga0055538_100006884 547
113 3300005262 Ga0065165_1000505 Ga0065165_100050537 547
114 3300025292 Ga0209676_1000851 Ga0209676_10008513 547
115 3300025294 Ga0209025_1004019 Ga0209025_10040193 547
116 iso_pu_bacteria 2600254943 2600400979 547
117 iso_pu_bacteria 2643221731 2644720995 547
118 iso_pu_bacteria 2643221732 2644722603 547
119 iso_pu_bacteria 2738543010 2739233042 547
120 iso_pu_bacteria 2818991465 2819711707 547
121 iso_pu_bacteria 2842882022 2842887276 547
122 iso_pu_bacteria 2904524088 2904529705 547
123 iso_pu_bacteria 2919143609 2919148782 547
124 iso_pu_bacteria 2919517244 2919522247 547
125 iso_pu_bacteria 2919720352 2919725579 547
126 iso_pu_bacteria 2928093941 2928099128 547
127 iso_pu_bacteria 2929004312 2929009261 547
128 iso_pu_bacteria 2960319331 2960324775 547
129 iso_pu_bacteria 2960375949 2960378209 547
130 iso_pu_bacteria 2990275345 2990279183 547
131 iso_pu_bacteria 8022893055 8022894613 547
132 iso_pu_bacteria 8022914991 8022915225 547
133 3300011119 Ga0105246_10000452 Ga0105246_1000045219 548
134 3300025224 Ga0209784_100041 Ga0209784_100041215 548
135 3300025233 Ga0209437_101201 Ga0209437_1012015 548
136 3300027312 Ga0209371_1004889 Ga0209371_10048896 548
137 3300030500 Ga0268256_1004678 Ga0268256_10046781 548
138 3300037418 Ga0395900_0018138 Ga0395900_0018138_164_1822 548
139 3300046457 Ga0495590_0013849 Ga0495590_0013849_425_2098 548
140 3300048925 Ga0496122_0038384 Ga0496122_0038384_2126_3799 548
141 3300048928 Ga0496125_0006468 Ga0496125_0006468_8715_10460 548
142 3300048928 Ga0496125_0072181 Ga0496125_0072181_822_2480 548
143 iso_pu_bacteria 2831905167 2831907664 548
144 iso_pu_bacteria 2907202186 2907204911 548
145 iso_pu_bacteria 2956897341 2956898546 548
146 iso_pu_bacteria 2977254563 2977259306 548
147 iso_pu_bacteria 2990275345 2990280351 548
148 iso_pu_bacteria 8057733483 8057737537 548
149 iso_pu_bacteria 2551306519 2553392871 549
150 iso_pu_bacteria 2554235283 2555470492 549
151 iso_pu_bacteria 2554235469 2556063053 549
152 iso_pu_bacteria 2593339131 2595092351 549
153 iso_pu_bacteria 2593339198 2595320406 549
154 iso_pu_bacteria 2643221729 2644707885 549
155 iso_pu_bacteria 2643221730 2644712085 549
156 iso_pu_bacteria 2643221735 2644739276 549
157 iso_pu_bacteria 2684622632 2685148958 549
158 iso_pu_bacteria 2684623153 2686996159 549
159 iso_pu_bacteria 2687453109 2687497409 549
160 iso_pu_bacteria 2695420987 2698324208 549
161 iso_pu_bacteria 2703719227 2705992993 549
162 iso_pu_bacteria 2718218445 2721504362 549
163 iso_pu_bacteria 2738541295 2738812996 549
164 iso_pu_bacteria 2738541358 2739156698 549
165 iso_pu_bacteria 2738543006 2739210299 549
166 iso_pu_bacteria 2738543017 2739271939 549
167 iso_pu_bacteria 2744054657 2745168041 549
168 iso_pu_bacteria 2757320391 2757569085 549
169 iso_pu_bacteria 2775507177 2777762549 549
170 iso_pu_bacteria 2775507192 2777838199 549
171 iso_pu_bacteria 2808606364 2808868826 549
172 iso_pu_bacteria 2811994870 2812315281 549
173 iso_pu_bacteria 2818991443 2819582781 549
174 iso_pu_bacteria 2818991468 2819725289 549
175 iso_pu_bacteria 2823526263 2823527258 549
176 iso_pu_bacteria 2857472729 2857478047 549
177 iso_pu_bacteria 2857586860 2857591085 549
178 iso_pu_bacteria 2865002811 2865006213 549
179 iso_pu_bacteria 2908665501 2908666531 549
180 iso_pu_bacteria 2919093281 2919093355 549
181 iso_pu_bacteria 2919414237 2919414773 549
182 iso_pu_bacteria 2919726948 2919729726 549
183 iso_pu_bacteria 2929233124 2929234223 549
184 iso_pu_bacteria 2936340661 2936343734 549
185 iso_pu_bacteria 2936361878 2936365077 549
186 iso_pu_bacteria 2938917290 2938918402 549
187 iso_pu_bacteria 2947426588 2947427756 549
188 iso_pu_bacteria 2954773129 2954775241 549
189 iso_pu_bacteria 2965761152 2965762265 549
190 iso_pu_bacteria 2979083700 2979084681 549
191 iso_pu_bacteria 2980125574 2980128614 549
192 iso_pu_bacteria 3001892409 3001893686 549
193 iso_pu_bacteria 3006826541 3006827169 549
194 iso_pu_bacteria 3006978542 3006981352 549
195 iso_pu_bacteria 8022621104 8022622183 549
196 iso_pu_bacteria 8022792930 8022798763 549
197 iso_pu_bacteria 8023438354 8023443445 549
198 iso_pu_bacteria 8023444577 8023449261 549
199 iso_pu_bacteria 8055632911 8055637500 549
200 iso_pu_bacteria 8057582654 8057583764 549
201 3300003187 JGI25151J46595_10002010 JGI25151J46595_100020103 550
202 3300003187 JGI25151J46595_10009322 JGI25151J46595_100093222 550
203 3300003751 Ga0055538_1000387 Ga0055538_100038711 550
204 3300025224 Ga0209784_100072 Ga0209784_100072105 550
205 3300025292 Ga0209676_1000493 Ga0209676_10004937 550
206 3300025294 Ga0209025_1000167 Ga0209025_1000167118 550
207 3300025294 Ga0209025_1000997 Ga0209025_10009972 550
208 3300025294 Ga0209025_1003968 Ga0209025_10039682 550
209 3300048913 Ga0496110_0008837 Ga0496110_0008837_210_1916 550
210 3300048914 Ga0496111_0031840 Ga0496111_0031840_866_2572 550
211 iso_pu_bacteria 2545555800 2545558074 550
212 iso_pu_bacteria 2593339198 2595320199 550
213 iso_pu_bacteria 2630968484 2631984789 550
214 iso_pu_bacteria 2648501850 2651530224 550
215 iso_pu_bacteria 2711768088 2712199208 550
216 iso_pu_bacteria 2808606399 2809054271 550
217 iso_pu_bacteria 2857460504 2857463878 550
218 iso_pu_bacteria 2919425241 2919430505 550
219 iso_pu_bacteria 2969765954 2969768369 550
220 iso_pu_bacteria 3006879489 3006880089 550
221 3300003316 rootH1_10005035 rootH1_100050357 551
222 3300003320 rootH2_10005602 rootH2_100056022 551
223 3300003322 rootL2_10003800 rootL2_100038007 551
224 3300003578 Ga0006562J51391_1000707 Ga0006562J51391_10007076 551
225 3300005355 Ga0070671_100013454 Ga0070671_1000134545 551
226 3300009101 Ga0105247_10010264 Ga0105247_100102642 551
227 3300009176 Ga0105242_10006312 Ga0105242_100063127 551
228 3300025229 Ga0209147_100342 Ga0209147_10034233 551
229 3300025273 Ga0209673_1011090 Ga0209673_10110902 551
230 3300025711 Ga0207696_1001996 Ga0207696_10019966 551
231 3300025935 Ga0207709_10004773 Ga0207709_100047732 551
232 3300031548 Ga0307408_100007540 Ga0307408_1000075402 551
233 3300031548 Ga0307408_100043554 Ga0307408_1000435541 551
234 3300047321 Ga0495676_0032889 Ga0495676_0032889_1527_3206 551
235 3300048907 Ga0496104_0013268 Ga0496104_0013268_1372_3051 551
236 3300048909 Ga0496106_0001718 Ga0496106_0001718_2928_4607 551
237 3300048910 Ga0496107_0032505 Ga0496107_0032505_1638_3317 551
238 3300048911 Ga0496108_0004146 Ga0496108_0004146_7806_9485 551
239 3300048912 Ga0496109_0000900 Ga0496109_0000900_626_2305 551
240 3300048913 Ga0496110_0006901 Ga0496110_0006901_6972_8651 551
241 3300048915 Ga0496112_0003137 Ga0496112_0003137_1099_2778 551
242 3300048919 Ga0496116_0033599 Ga0496116_0033599_526_2268 551
243 3300048921 Ga0496118_0058272 Ga0496118_0058272_78_1757 551
244 3300048922 Ga0496119_0008566 Ga0496119_0008566_7096_8775 551
245 3300048927 Ga0496124_0049579 Ga0496124_0049579_475_2217 551
246 3300048928 Ga0496125_0018033 Ga0496125_0018033_569_2248 551
247 3300048929 Ga0496126_0102213 Ga0496126_0102213_403_2082 551
248 iso_pu_bacteria 2511231119 2511698861 551
249 iso_pu_bacteria 2512564039 2512736818 551
250 iso_pu_bacteria 2540341094 2540606071 551
251 iso_pu_bacteria 2576861599 2578932492 551
252 iso_pu_bacteria 2593339198 2595319350 551
253 iso_pu_bacteria 2671180694 2673819044 551
254 iso_pu_bacteria 2671180844 2674420166 551
255 iso_pu_bacteria 2716884898 2717917400 551
256 iso_pu_bacteria 2860837431 2860838445 551
257 iso_pu_bacteria 2864997549 2864998514 551
258 iso_pu_bacteria 2877768649 2877769601 551
259 iso_pu_bacteria 2880169592 2880170598 551
260 iso_pu_bacteria 2889295896 2889298718 551
261 iso_pu_bacteria 2897109615 2897110583 551
262 iso_pu_bacteria 2904560550 2904563051 551
263 iso_pu_bacteria 2929206907 2929212073 551
264 iso_pu_bacteria 2962290636 2962291802 551
265 iso_pu_bacteria 2969136845 2969137852 551
266 iso_pu_bacteria 2969141011 2969142049 551
267 iso_pu_bacteria 2969770375 2969771636 551
268 iso_pu_bacteria 2971893375 2971894349 551
269 iso_pu_bacteria 2980492589 2980493627 551
270 iso_pu_bacteria 2981284811 2981288244 551
271 iso_pu_bacteria 2981289755 2981293065 551
272 iso_pu_bacteria 2981980479 2981983793 551
273 iso_pu_bacteria 2981985349 2981988713 551
274 iso_pu_bacteria 2984527788 2984531076 551
275 iso_pu_bacteria 2984532647 2984537185 551
276 iso_pu_bacteria 3001892409 3001894626 551
277 iso_pu_bacteria 3006858327 3006859443 551
278 iso_pu_bacteria 8022630665 8022633809 551
279 iso_pu_bacteria 8022653035 8022655017 551
280 iso_pu_bacteria 8051952484 8051953578 551
281 iso_pu_bacteria 8052174270 8052176999 551
282 iso_pu_bacteria 8054280661 8054284338 551
283 3300003841 Ga0055541_1002741 Ga0055541_10027411 552
284 3300025225 Ga0209566_100046 Ga0209566_100046151 552
285 3300025225 Ga0209566_100072 Ga0209566_100072119 552
286 3300025229 Ga0209147_105994 Ga0209147_1059941 552
287 3300041406 Ga0439439_0004652 Ga0439439_0004652_230_1924 552
288 3300041999 Ga0439433_0006285 Ga0439433_0006285_354_2039 552
289 3300042007 Ga0439449_0000338 Ga0439449_0000338_13051_14745 552
290 3300045049 Ga0466959_0001415 Ga0466959_0001415_12783_14468 552
291 iso_pu_bacteria 2585428059 2587744381 552
292 iso_pu_bacteria 2643221676 2644422788 552
293 iso_pu_bacteria 2818991459 2819674211 552
294 iso_pu_bacteria 2857453340 2857457644 552
295 iso_pu_bacteria 2888578766 2888583242 552
296 iso_pu_bacteria 2889049205 2889053459 552
297 iso_pu_bacteria 2904113452 2904113471 552
298 iso_pu_bacteria 2904755435 2904762543 552
299 iso_pu_bacteria 2939702853 2939703090 552
300 iso_pu_bacteria 2971410472 2971410681 552
301 iso_pu_bacteria 8054795415 8054800537 552
302 iso_pu_bacteria 8056533031 8056535001 552
303 iso_pu_bacteria 8057473075 8057477936 552
304 iso_pu_bacteria 8057977335 8057979330 552
305 3300003187 JGI25151J46595_10000009 JGI25151J46595_1000000970 553
306 3300003187 JGI25151J46595_10009020 JGI25151J46595_100090203 553
307 3300003187 JGI25151J46595_10009989 JGI25151J46595_100099895 553
308 3300003187 JGI25151J46595_10027576 JGI25151J46595_100275761 553
309 3300003187 JGI25151J46595_10028339 JGI25151J46595_100283391 553
310 3300003761 Ga0055535_1003552 Ga0055535_10035521 553
311 3300025225 Ga0209566_100029 Ga0209566_10002984 553
312 3300025292 Ga0209676_1001431 Ga0209676_100143126 553
313 3300025294 Ga0209025_1000001 Ga0209025_10000011971 553
314 3300025294 Ga0209025_1000449 Ga0209025_10004498 553
315 3300025294 Ga0209025_1008124 Ga0209025_10081246 553
316 3300025294 Ga0209025_1015012 Ga0209025_10150123 553
317 3300025294 Ga0209025_1018883 Ga0209025_10188832 553
318 3300048920 Ga0496117_0006054 Ga0496117_0006054_10079_11785 553
319 3300048922 Ga0496119_0011991 Ga0496119_0011991_3196_4902 553
320 3300048923 Ga0496120_0004759 Ga0496120_0004759_8797_10503 553
321 3300048924 Ga0496121_0029789 Ga0496121_0029789_942_2648 553
322 3300048928 Ga0496125_0002237 Ga0496125_0002237_23708_25414 553
323 3300048929 Ga0496126_0003568 Ga0496126_0003568_9030_10736 553
324 iso_pu_bacteria 2671180694 2673821330 553
325 iso_pu_bacteria 2721755693 2723606554 553
326 iso_pu_bacteria 2728369359 2730137147 553
327 iso_pu_bacteria 2751185905 2753808861 553
328 iso_pu_bacteria 2802428803 2802437777 553
329 iso_pu_bacteria 2816332295 2817479112 553
330 iso_pu_bacteria 2888578766 2888584109 553
331 iso_pu_bacteria 2889276214 2889277104 553
332 iso_pu_bacteria 2904595352 2904596202 553
333 iso_pu_bacteria 2996706504 2996708949 553
334 iso_pu_bacteria 648028048 648172532 553

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16901

DAO_C

C-terminal domain of alpha-glycerophosphate oxidase

464

593

0.87

PF01266

DAO

FAD dependent oxidoreductase

82

439

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
8jyt-assembly1.cif.gz_A ancestral imine reducatase n560 0.9756 22 48
3da1-assembly1.cif.gz_A x-ray structure of the glycerol-3-phosphate dehydrogenase from bacillus halodurans complexed with fad. northeast structural genomics consortium target bhr167. 0.9729 3 550
6jiz-assembly1.cif.gz_A apo structure of an imine reductase at 1.76 angstrom resolution 0.9678 22 48
8ozw-assembly1.cif.gz_A imine reductase from ajellomyces dermatitidis in complex nadph4 0.9658 22 48
5a9r-assembly1.cif.gz_A apo form of imine reductase from amycolatopsis orientalis 0.9644 22 48
ID Description Score Start End Superfamily
3da1A03 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Alpha-glycerophosphate oxidase, cap domain 0.9747 422 545 1.10.8.870
af_P37127_327_452_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9747 22 51 3.50.50.60
af_Q2FYZ4_421_556_1.10.8.870 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Alpha-glycerophosphate oxidase, cap domain 0.9731 420 546 1.10.8.870
af_K8F7V7_1826_1944_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9708 22 51 3.50.50.60
af_O61709_2_252_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9642 22 48 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6D0ZNZ0-F1-model_v4 deleted 0.987 432 540
AF-A0A6L7EA93-F1-model_v4 deleted 0.9795 235 459
AF-A0A0D6ZE84-F1-model_v4 Glycerol-3-phosphate dehydrogenase (EC 1.1.5.3) 0.979 1 405 GO:0004368
GO:0009331
GO:0019563
GO:0046168
AF-A0A0D6Z8N9-F1-model_v4 Glycerol-3-phosphate dehydrogenase 0.977 452 550
AF-A0A0D6ZE84-F1-model_v4 Glycerol-3-phosphate dehydrogenase (EC 1.1.5.3) 0.9767 1 405 GO:0004368
GO:0009331
GO:0019563
GO:0046168

Feature Viewer

pLDDT pTM Quality
91.45 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map