F411295

General Info

Members Datasets Scaffolds Average Seq Length
333 191 328 121

Family's Representative Sequence

Representative Sequence 3300005719|Ga0068861_100542735|Ga0068861_1005427352
Length 143
Sequence MFYLRSNLVAGQRHRTTFYLPGMNSSNTHNQRFAKMTFASVYPLYLAKVEKKGRTKEELHRVITWLTGFDNKKLQELIKEKVTFEIFFQRASLNPNVQLITGVICGYRIEEIEDPLTRQVRYLDKLVDELAKGRKMEKMLRSA

Samples

Sample ID Description Type Environment
1 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
2 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
3 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
93 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
94 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
145 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
147 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
148 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
151 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
152 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
153 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
154 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
155 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
156 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
157 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
162 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
163 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
164 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
165 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
166 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
167 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
168 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
169 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
170 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
174 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
175 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
176 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
177 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
178 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
181 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
182 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
183 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
184 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
185 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
186 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
187 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
188 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
189 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
190 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
191 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.2
Metatranscriptomes 0.3
Isolates 1.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.2
Nodule 0
Rhizoplane 0.9
Rhizosphere 90.69
Stem 0
Stem Tuber 0
Unclassified 4.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25157J39369_1006390 3300002741 Bacteria 1798
2 rootH2_10118059 3300003320 Bacteria 5952
3 rootH1_10168635 3300003323 Unclassified 2555
4 Ga0065714_10148886 3300005288 Bacteria 1119
5 Ga0065714_10297806 3300005288 Bacteria 698
6 Ga0065715_10383355 3300005293 Bacteria 904
7 Ga0065707_10284448 3300005295 Bacteria 1033
8 Ga0070676_10000097 3300005328 Bacteria 30711
9 Ga0070683_100015535 3300005329 Bacteria 6691
10 Ga0070690_100063051 3300005330 Bacteria 2391
11 Ga0070690_100078241 3300005330 Bacteria 2160
12 Ga0068869_100151270 3300005334 Bacteria 1800
13 Ga0068869_100507494 3300005334 Bacteria 1008
14 Ga0070666_10000041 3300005335 Bacteria 112410
15 Ga0070666_10000740 3300005335 Bacteria 19756
16 Ga0070666_10104576 3300005335 Bacteria 1954
17 Ga0070680_100045285 3300005336 Bacteria 3576
18 Ga0070682_100002628 3300005337 Bacteria 9931
19 Ga0068868_100004669 3300005338 Bacteria 9620
20 Ga0070660_100188471 3300005339 Bacteria 1670
21 Ga0070660_100296763 3300005339 Bacteria 1324
22 Ga0070660_100584027 3300005339 Bacteria 933
23 Ga0070689_101557130 3300005340 Bacteria 599
24 Ga0070691_10001069 3300005341 Bacteria 11325
25 Ga0070661_100588968 3300005344 Bacteria 898
26 Ga0070692_10168144 3300005345 Unclassified 1262
27 Ga0070692_10713644 3300005345 Bacteria 676
28 Ga0070668_100001435 3300005347 Bacteria 17198
29 Ga0070668_100155041 3300005347 Bacteria 1855
30 Ga0070671_100337062 3300005355 Bacteria 1286
31 Ga0070673_100000390 3300005364 Bacteria 23156
32 Ga0070659_100097541 3300005366 Bacteria 2362
33 Ga0070667_100001708 3300005367 Bacteria 19644
34 Ga0070667_100435607 3300005367 Bacteria 1197
35 Ga0070700_100755469 3300005441 Bacteria 779
36 Ga0070663_100150755 3300005455 Bacteria 1783
37 Ga0070678_100518330 3300005456 Bacteria 1054
38 Ga0070678_100587195 3300005456 Bacteria 993
39 Ga0070662_100017277 3300005457 Bacteria 4861
40 Ga0070681_10072067 3300005458 Bacteria 3418
41 Ga0068867_100001161 3300005459 Bacteria 18001
42 Ga0068867_100569126 3300005459 Bacteria 984
43 Ga0070698_100152422 3300005471 Bacteria 2259
44 Ga0070699_100191566 3300005518 Unclassified 1817
45 Ga0070679_100078720 3300005530 Bacteria 3285
46 Ga0070684_100050825 3300005535 Bacteria 3601
47 Ga0068853_100022315 3300005539 Bacteria 5285
48 Ga0068853_100149686 3300005539 Bacteria 2100
49 Ga0068853_100478992 3300005539 Bacteria 1173
50 Ga0070672_100000454 3300005543 Bacteria 23864
51 Ga0070672_100226070 3300005543 Bacteria 1571
52 Ga0070672_101500320 3300005543 Bacteria 604
53 Ga0070693_100005951 3300005547 Bacteria 5897
54 Ga0070665_100005379 3300005548 Bacteria 13222
55 Ga0068855_100034556 3300005563 Bacteria 6028
56 Ga0068855_100151652 3300005563 Bacteria 2635
57 Ga0068855_100394795 3300005563 Bacteria 1517
58 Ga0068855_100457460 3300005563 Bacteria 1392
59 Ga0070664_100192340 3300005564 Bacteria 1818
60 Ga0068857_100273355 3300005577 Bacteria 1553
61 Ga0068856_100576248 3300005614 Bacteria 1147
62 Ga0068852_100030072 3300005616 Bacteria 4467
63 Ga0068852_100066193 3300005616 Bacteria 3155
64 Ga0068852_100131197 3300005616 Bacteria 2308
65 Ga0068852_100220565 3300005616 Bacteria 1803
66 Ga0068852_102398455 3300005616 Bacteria 548
67 Ga0068859_100000083 3300005617 Bacteria 87079
68 Ga0068859_100301985 3300005617 Bacteria 1694
69 Ga0068859_100367347 3300005617 Bacteria 1534
70 Ga0068859_101216626 3300005617 Bacteria 830
71 Ga0068864_100002317 3300005618 Bacteria 15748
72 Ga0068864_100089637 3300005618 Bacteria 2710
73 Ga0068864_100594760 3300005618 Bacteria 1073
74 Ga0068866_10874106 3300005718 Bacteria 630
75 Ga0068861_100004515 3300005719 Bacteria 9347
76 Ga0068861_100542735 3300005719 Unclassified 1058
77 Ga0068851_10001613 3300005834 Bacteria 9916
78 Ga0068851_10034061 3300005834 Bacteria 2541
79 Ga0068851_10207748 3300005834 Bacteria 1095
80 Ga0068863_100001816 3300005841 Bacteria 21206
81 Ga0068863_100002508 3300005841 Bacteria 18243
82 Ga0068858_100005312 3300005842 Bacteria 12629
83 Ga0068858_100017208 3300005842 Bacteria 6784
84 Ga0068858_100097657 3300005842 Bacteria 2738
85 Ga0068860_100002451 3300005843 Bacteria 19478
86 Ga0068860_100006153 3300005843 Bacteria 12068
87 Ga0068860_100320184 3300005843 Bacteria 1522
88 Ga0068862_100040109 3300005844 Unclassified 3979
89 Ga0081540_1010118 3300005983 Bacteria 6420
90 Ga0075366_10493456 3300006195 Bacteria 757
91 Ga0097621_100000393 3300006237 Bacteria 30466
92 Ga0097621_100387202 3300006237 Bacteria 1250
93 Ga0068871_100019930 3300006358 Bacteria 5128
94 Ga0068871_100292193 3300006358 Bacteria 1428
95 Ga0068871_102213286 3300006358 Bacteria 524
96 Ga0075431_100278593 3300006847 Unclassified 1693
97 Ga0068865_100001665 3300006881 Bacteria 12998
98 Ga0097620_100000083 3300006931 Bacteria 87079
99 Ga0097620_100302007 3300006931 Bacteria 1694
100 Ga0097620_100367349 3300006931 Bacteria 1534
101 Ga0097620_101216704 3300006931 Bacteria 830
102 Ga0105240_10002509 3300009093 Bacteria 29492
103 Ga0105240_10012344 3300009093 Bacteria 11797
104 Ga0105240_10365656 3300009093 Bacteria 1633
105 Ga0105240_10458688 3300009093 Bacteria 1425
106 Ga0105240_11061460 3300009093 Bacteria 864
107 Ga0111539_10192547 3300009094 Bacteria 2379
108 Ga0111539_10199586 3300009094 Unclassified 2333
109 Ga0105245_10052404 3300009098 Bacteria 3659
110 Ga0105245_10159145 3300009098 Bacteria 2142
111 Ga0105245_11214138 3300009098 Bacteria 802
112 Ga0105247_10009535 3300009101 Bacteria 5891
113 Ga0105247_10042667 3300009101 Bacteria 2778
114 Ga0114129_10082294 3300009147 Bacteria 4473
115 Ga0105243_10650800 3300009148 Bacteria 1021
116 Ga0105241_10013985 3300009174 Bacteria 5884
117 Ga0105241_10375435 3300009174 Bacteria 1241
118 Ga0105242_10014804 3300009176 Bacteria 6041
119 Ga0105248_10373876 3300009177 Bacteria 1604
120 Ga0105237_10009157 3300009545 Bacteria 10637
121 Ga0105237_10046277 3300009545 Bacteria 4376
122 Ga0105237_10821125 3300009545 Bacteria 936
123 Ga0105238_10021422 3300009551 Bacteria 6584
124 Ga0105238_10950071 3300009551 Bacteria 879
125 Ga0105249_10006834 3300009553 Bacteria 9947
126 Ga0105249_10038863 3300009553 Unclassified 4319
127 Ga0105249_10202006 3300009553 Bacteria 1945
128 Ga0105239_10049235 3300010375 Bacteria 4621
129 Ga0105239_10091236 3300010375 Bacteria 3362
130 Ga0105239_10119777 3300010375 Bacteria 2922
131 Ga0105246_10002179 3300011119 Bacteria 11813
132 Ga0105246_10054486 3300011119 Bacteria 2756
133 Ga0157373_10093963 3300013100 Bacteria 2112
134 Ga0157373_10224382 3300013100 Bacteria 1326
135 Ga0157371_10056355 3300013102 Bacteria 2788
136 Ga0157371_10347091 3300013102 Bacteria 1080
137 Ga0157371_10826852 3300013102 Bacteria 699
138 Ga0157371_11450485 3300013102 Bacteria 534
139 Ga0157370_10034585 3300013104 Bacteria 4918
140 Ga0157370_11602813 3300013104 Bacteria 585
141 Ga0157369_10086644 3300013105 Bacteria 3345
142 Ga0157369_10106503 3300013105 Bacteria 2983
143 Ga0157369_10735534 3300013105 Bacteria 1015
144 Ga0157369_11041195 3300013105 Bacteria 837
145 Ga0157374_10001680 3300013296 Bacteria 18540
146 Ga0157374_10546962 3300013296 Bacteria 1165
147 Ga0157374_10838946 3300013296 Bacteria 936
148 Ga0157374_12811138 3300013296 Bacteria 514
149 Ga0157378_10022959 3300013297 Bacteria 5492
150 Ga0157378_12778478 3300013297 Bacteria 542
151 Ga0163162_10001349 3300013306 Bacteria 22859
152 Ga0163162_10001438 3300013306 Bacteria 22185
153 Ga0163162_10023631 3300013306 Bacteria 6069
154 Ga0163162_10296282 3300013306 Bacteria 1749
155 Ga0163162_11228761 3300013306 Bacteria 851
156 Ga0163162_12417089 3300013306 Bacteria 604
157 Ga0163162_12778965 3300013306 Bacteria 563
158 Ga0157372_10003268 3300013307 Bacteria 17515
159 Ga0157372_10026537 3300013307 Bacteria 6304
160 Ga0157372_10265208 3300013307 Bacteria 1994
161 Ga0157372_10804555 3300013307 Bacteria 1092
162 Ga0157372_11804638 3300013307 Unclassified 703
163 Ga0157375_10001768 3300013308 Bacteria 18557
164 Ga0157375_10097261 3300013308 Bacteria 3018
165 Ga0157375_10920074 3300013308 Bacteria 1018
166 Ga0157375_13785043 3300013308 Bacteria 502
167 Ga0163163_10001387 3300014325 Bacteria 20467
168 Ga0163163_11484495 3300014325 Bacteria 739
169 Ga0182008_10032885 3300014497 Bacteria 2604
170 Ga0157379_10000812 3300014968 Bacteria 25341
171 Ga0157379_10035924 3300014968 Bacteria 4419
172 Ga0157376_10000939 3300014969 Bacteria 18934
173 Ga0157376_10248566 3300014969 Bacteria 1660
174 Ga0157376_10430240 3300014969 Bacteria 1283
175 Ga0157376_10704448 3300014969 Bacteria 1015
176 Ga0163161_10001125 3300017792 Bacteria 20161
177 Ga0163161_10001590 3300017792 Bacteria 16755
178 Ga0206352_10709332 3300020078 Bacteria 633
179 Ga0209646_1000006 3300025246 Bacteria 694084
180 Ga0209026_1000185 3300025250 Bacteria 91252
181 Ga0209455_1000882 3300025272 Bacteria 15832
182 Ga0209050_1009128 3300025298 Bacteria 5141
183 Ga0209257_1018889 3300025304 Bacteria 2626
184 Ga0207697_10286650 3300025315 Bacteria 730
185 Ga0207656_10020009 3300025321 Bacteria 2654
186 Ga0207656_10148995 3300025321 Bacteria 1107
187 Ga0207710_10021272 3300025900 Bacteria 2778
188 Ga0207710_10060049 3300025900 Bacteria 1722
189 Ga0207680_10000077 3300025903 Bacteria 43842
190 Ga0207680_10000860 3300025903 Bacteria 14326
191 Ga0207647_10000689 3300025904 Bacteria 26518
192 Ga0207647_10119444 3300025904 Bacteria 1555
193 Ga0207645_10000332 3300025907 Bacteria 39392
194 Ga0207645_10397714 3300025907 Bacteria 926
195 Ga0207705_10000937 3300025909 Bacteria 23816
196 Ga0207654_10008279 3300025911 Bacteria 5251
197 Ga0207707_10001291 3300025912 Bacteria 23352
198 Ga0207707_10376632 3300025912 Bacteria 1221
199 Ga0207695_10007723 3300025913 Bacteria 13622
200 Ga0207695_10054373 3300025913 Bacteria 4182
201 Ga0207695_10070884 3300025913 Bacteria 3561
202 Ga0207695_10213262 3300025913 Bacteria 1840
203 Ga0207695_10606594 3300025913 Bacteria 976
204 Ga0207671_10001576 3300025914 Bacteria 25992
205 Ga0207671_10194528 3300025914 Bacteria 1582
206 Ga0207671_10358029 3300025914 Bacteria 1158
207 Ga0207660_10011999 3300025917 Bacteria 5658
208 Ga0207660_10211629 3300025917 Unclassified 1518
209 Ga0207657_10047328 3300025919 Bacteria 3762
210 Ga0207649_10776014 3300025920 Bacteria 747
211 Ga0207652_10010964 3300025921 Bacteria 7307
212 Ga0207694_10026026 3300025924 Bacteria 4449
213 Ga0207659_11290418 3300025926 Bacteria 627
214 Ga0207687_10396284 3300025927 Bacteria 1134
215 Ga0207644_10314380 3300025931 Bacteria 1265
216 Ga0207706_10004763 3300025933 Bacteria 12706
217 Ga0207686_10012027 3300025934 Bacteria 4752
218 Ga0207709_10122292 3300025935 Bacteria 1759
219 Ga0207709_10217532 3300025935 Bacteria 1375
220 Ga0207709_10334825 3300025935 Bacteria 1137
221 Ga0207670_10251639 3300025936 Bacteria 1366
222 Ga0207704_10000639 3300025938 Bacteria 15472
223 Ga0207691_10000164 3300025940 Bacteria 61768
224 Ga0207691_10011633 3300025940 Bacteria 8447
225 Ga0207711_10698694 3300025941 Bacteria 946
226 Ga0207689_10002044 3300025942 Bacteria 19050
227 Ga0207689_10077050 3300025942 Bacteria 2741
228 Ga0207689_10143863 3300025942 Bacteria 1965
229 Ga0207661_10039888 3300025944 Bacteria 3688
230 Ga0207661_10506511 3300025944 Bacteria 1103
231 Ga0207667_10028557 3300025949 Bacteria 6058
232 Ga0207667_10040505 3300025949 Bacteria 4961
233 Ga0207667_10270072 3300025949 Bacteria 1738
234 Ga0207667_10692902 3300025949 Bacteria 1022
235 Ga0207651_10000648 3300025960 Bacteria 14769
236 Ga0207712_10015037 3300025961 Bacteria 4986
237 Ga0207712_10077612 3300025961 Bacteria 2408
238 Ga0207668_10000264 3300025972 Bacteria 34945
239 Ga0207668_10348360 3300025972 Bacteria 1238
240 Ga0207658_10000445 3300025986 Bacteria 38969
241 Ga0207677_10000570 3300026023 Bacteria 23162
242 Ga0207703_10002150 3300026035 Bacteria 17328
243 Ga0207703_10003481 3300026035 Bacteria 13177
244 Ga0207639_10008026 3300026041 Bacteria 7214
245 Ga0207708_11491594 3300026075 Bacteria 594
246 Ga0207641_10000975 3300026088 Bacteria 29289
247 Ga0207641_10100982 3300026088 Bacteria 2541
248 Ga0207648_10007045 3300026089 Bacteria 11111
249 Ga0207676_10004877 3300026095 Bacteria 9495
250 Ga0207676_10120405 3300026095 Bacteria 2212
251 Ga0207674_10419469 3300026116 Bacteria 1293
252 Ga0207674_10862187 3300026116 Bacteria 873
253 Ga0207675_100008996 3300026118 Bacteria 9372
254 Ga0207675_100429072 3300026118 Unclassified 1306
255 Ga0207683_10096416 3300026121 Bacteria 2637
256 Ga0207698_10176557 3300026142 Bacteria 1887
257 Ga0207698_10227213 3300026142 Bacteria 1691
258 Ga0207698_10273693 3300026142 Bacteria 1558
259 Ga0207698_10808386 3300026142 Bacteria 940
260 Ga0268266_10001035 3300028379 Bacteria 34953
261 Ga0268266_11769227 3300028379 Bacteria 593
262 Ga0268265_10266309 3300028380 Bacteria 1526
263 Ga0268265_10806397 3300028380 Bacteria 915
264 Ga0268264_10000159 3300028381 Bacteria 152716
265 Ga0268264_10000982 3300028381 Bacteria 29187
266 Ga0268264_10010764 3300028381 Bacteria 7557
267 Ga0268264_11419795 3300028381 Bacteria 705
268 Ga0307515_10000003 3300028794 Bacteria 891317
269 Ga0265327_10011262 3300031251 Bacteria 6182
270 Ga0265327_10015024 3300031251 Bacteria 5031
271 Ga0307513_10192051 3300031456 Bacteria 1893
272 Ga0307509_10227622 3300031507 Bacteria 1671
273 Ga0307514_10186378 3300031649 Bacteria 1329
274 Ga0307406_10222033 3300031901 Bacteria 1405
275 Ga0373940_0307131 3300035088 Bacteria 548
276 Ga0373927_0059974 3300035695 Bacteria 2461
277 Ga0395899_0013383 3300037312 Bacteria 6278
278 Ga0451807_2136032 3300041486 Bacteria 2320
279 Ga0451807_2518234 3300041486 Bacteria 850
280 Ga0451853_1120257 3300041512 Bacteria 1820
281 Ga0439441_023790 3300042001 Bacteria 1146
282 Ga0451577_0147617 3300042876 Bacteria 2115
283 Ga0451577_0208473 3300042876 Bacteria 1765
284 Ga0451577_1962430 3300042876 Bacteria 512
285 Ga0453683_0295121 3300044673 Bacteria 1036
286 Ga0453683_0433779 3300044673 Unclassified 849
287 Ga0453683_0599666 3300044673 Unclassified 718
288 Ga0466961_0536783 3300044693 Bacteria 705
289 Ga0453684_0000920 3300044712 Bacteria 97531
290 Ga0453684_0001530 3300044712 Bacteria 64680
291 Ga0453684_0082910 3300044712 Unclassified 3993
292 Ga0453684_0087226 3300044712 Bacteria 3868
293 Ga0453684_0367015 3300044712 Bacteria 1619
294 Ga0453684_0877708 3300044712 Unclassified 962
295 Ga0453684_1621230 3300044712 Bacteria 663
296 Ga0451576_0705126 3300045051 Bacteria 1060
297 Ga0451576_2698079 3300045051 Unclassified 506
298 Ga0495592_0306469 3300046454 Bacteria 1031
299 Ga0495638_0000020 3300046460 Bacteria 372434
300 Ga0495606_0645776 3300046507 Bacteria 513
301 Ga0495616_0403701 3300046513 Bacteria 561
302 Ga0495643_0126879 3300046522 Bacteria 1284
303 Ga0495648_0028894 3300046524 Bacteria 3687
304 Ga0495652_0132753 3300046529 Bacteria 1969
305 Ga0495654_0037278 3300046530 Bacteria 2439
306 Ga0495668_0001230 3300046616 Bacteria 25789
307 Ga0495672_0067674 3300047320 Bacteria 2034
308 Ga0496109_0054155 3300048912 Bacteria 3660
309 Ga0501034_1253691 3300049571 Bacteria 619
310 Ga0501034_1348382 3300049571 Bacteria 589
311 Ga0501073_0016243 3300049589 Bacteria 5396
312 Ga0501074_0426463 3300049590 Bacteria 941
313 Ga0501230_087596 3300049667 Bacteria 659
314 Ga0501257_049000 3300049686 Bacteria 1051
315 Ga0501241_006266 3300049758 Bacteria 2191
316 nmdc:mga0qj67_162119_c1 3300050509 Bacteria 1815
317 nmdc:mga06r32_271829_c1 3300050510 Bacteria 1682
318 Ga0500644_0129514 3300053088 Unclassified 992
319 Ga0500583_0001253 3300053092 Bacteria 7246
320 Ga0500556_0361446 3300053104 Bacteria 561
321 Ga0500642_0052801 3300053130 Bacteria 1800
322 Ga0500655_025237 3300053133 Bacteria 1128
323 Ga0500568_0068203 3300053139 Bacteria 1365
324 Ga0500588_0071346 3300053146 Bacteria 1140
325 Ga0500622_0002806 3300053156 Bacteria 12242
326 Ga0500622_0006047 3300053156 Bacteria 7109
327 Ga0500656_024083 3300053732 Bacteria 773
328 Ga0466962_0118421 3300061719 Bacteria 1277

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005345 Ga0070692_10713644 Ga0070692_107136441 94
2 3300005834 Ga0068851_10207748 Ga0068851_102077482 99
3 3300009093 Ga0105240_10002509 Ga0105240_1000250919 107
4 3300009551 Ga0105238_10021422 Ga0105238_100214223 107
5 3300013105 Ga0157369_10735534 Ga0157369_107355342 107
6 3300013307 Ga0157372_10265208 Ga0157372_102652083 107
7 3300005329 Ga0070683_100015535 Ga0070683_1000155353 115
8 3300005535 Ga0070684_100050825 Ga0070684_1000508252 115
9 3300020078 Ga0206352_10709332 Ga0206352_107093322 115
10 3300025913 Ga0207695_10007723 Ga0207695_100077235 115
11 3300025924 Ga0207694_10026026 Ga0207694_100260264 115
12 3300025942 Ga0207689_10077050 Ga0207689_100770504 115
13 3300025944 Ga0207661_10039888 Ga0207661_100398884 115
14 3300044673 Ga0453683_0433779 Ga0453683_0433779_226_576 116
15 3300049590 Ga0501074_0426463 Ga0501074_0426463_10_363 116
16 iso_pu_bacteria 2739367857 2740002734 116
17 iso_pu_bacteria 2739367858 2740007551 116
18 iso_pu_bacteria 8056440228 8056443611 116
19 iso_pu_bacteria 8003151029 8003154250 117
20 3300044712 Ga0453684_0082910 Ga0453684_0082910_1971_2327 118
21 3300049589 Ga0501073_0016243 Ga0501073_0016243_127_600 118
22 iso_pu_bacteria 2929154850 2929154880 118
23 3300005843 Ga0068860_100320184 Ga0068860_1003201843 119
24 3300028381 Ga0268264_11419795 Ga0268264_114197952 119
25 3300046507 Ga0495606_0645776 Ga0495606_0645776_70_474 119
26 3300005288 Ga0065714_10148886 Ga0065714_101488861 120
27 3300005339 Ga0070660_100584027 Ga0070660_1005840272 120
28 3300005366 Ga0070659_100097541 Ga0070659_1000975412 120
29 3300005456 Ga0070678_100587195 Ga0070678_1005871952 120
30 3300005543 Ga0070672_101500320 Ga0070672_1015003202 120
31 3300005616 Ga0068852_100066193 Ga0068852_1000661934 120
32 3300005616 Ga0068852_102398455 Ga0068852_1023984551 120
33 3300006358 Ga0068871_102213286 Ga0068871_1022132861 120
34 3300009094 Ga0111539_10192547 Ga0111539_101925474 120
35 3300013102 Ga0157371_10056355 Ga0157371_100563553 120
36 3300013104 Ga0157370_11602813 Ga0157370_116028131 120
37 3300013105 Ga0157369_10106503 Ga0157369_101065033 120
38 3300013296 Ga0157374_10546962 Ga0157374_105469622 120
39 3300013306 Ga0163162_12417089 Ga0163162_124170892 120
40 3300014969 Ga0157376_10704448 Ga0157376_107044482 120
41 3300025304 Ga0209257_1018889 Ga0209257_10188891 120
42 3300025904 Ga0207647_10000689 Ga0207647_100006895 120
43 3300025907 Ga0207645_10397714 Ga0207645_103977142 120
44 3300025919 Ga0207657_10047328 Ga0207657_100473285 120
45 3300025926 Ga0207659_11290418 Ga0207659_112904182 120
46 3300025949 Ga0207667_10692902 Ga0207667_106929021 120
47 3300026142 Ga0207698_10227213 Ga0207698_102272132 120
48 3300028379 Ga0268266_11769227 Ga0268266_117692272 120
49 3300037312 Ga0395899_0013383 Ga0395899_0013383_2626_2988 120
50 3300041486 Ga0451807_2136032 Ga0451807_2136032_823_1188 120
51 3300042001 Ga0439441_023790 Ga0439441_023790_581_955 120
52 3300044712 Ga0453684_0001530 Ga0453684_0001530_31884_32246 120
53 3300045051 Ga0451576_2698079 Ga0451576_2698079_13_387 120
54 3300046513 Ga0495616_0403701 Ga0495616_0403701_108_470 120
55 3300046530 Ga0495654_0037278 Ga0495654_0037278_756_1118 120
56 3300046616 Ga0495668_0001230 Ga0495668_0001230_1348_1710 120
57 3300003320 rootH2_10118059 rootH2_101180598 121
58 3300005288 Ga0065714_10297806 Ga0065714_102978061 121
59 3300005293 Ga0065715_10383355 Ga0065715_103833551 121
60 3300005295 Ga0065707_10284448 Ga0065707_102844481 121
61 3300005328 Ga0070676_10000097 Ga0070676_1000009712 121
62 3300005330 Ga0070690_100063051 Ga0070690_1000630513 121
63 3300005330 Ga0070690_100078241 Ga0070690_1000782412 121
64 3300005334 Ga0068869_100151270 Ga0068869_1001512702 121
65 3300005334 Ga0068869_100507494 Ga0068869_1005074942 121
66 3300005335 Ga0070666_10000041 Ga0070666_1000004134 121
67 3300005335 Ga0070666_10000740 Ga0070666_1000074021 121
68 3300005336 Ga0070680_100045285 Ga0070680_1000452853 121
69 3300005337 Ga0070682_100002628 Ga0070682_1000026284 121
70 3300005338 Ga0068868_100004669 Ga0068868_1000046692 121
71 3300005339 Ga0070660_100188471 Ga0070660_1001884713 121
72 3300005339 Ga0070660_100296763 Ga0070660_1002967632 121
73 3300005340 Ga0070689_101557130 Ga0070689_1015571301 121
74 3300005341 Ga0070691_10001069 Ga0070691_100010694 121
75 3300005344 Ga0070661_100588968 Ga0070661_1005889681 121
76 3300005345 Ga0070692_10168144 Ga0070692_101681443 121
77 3300005347 Ga0070668_100001435 Ga0070668_10000143516 121
78 3300005347 Ga0070668_100155041 Ga0070668_1001550413 121
79 3300005355 Ga0070671_100337062 Ga0070671_1003370622 121
80 3300005364 Ga0070673_100000390 Ga0070673_10000039021 121
81 3300005367 Ga0070667_100001708 Ga0070667_1000017085 121
82 3300005367 Ga0070667_100435607 Ga0070667_1004356072 121
83 3300005441 Ga0070700_100755469 Ga0070700_1007554691 121
84 3300005455 Ga0070663_100150755 Ga0070663_1001507552 121
85 3300005456 Ga0070678_100518330 Ga0070678_1005183302 121
86 3300005457 Ga0070662_100017277 Ga0070662_1000172773 121
87 3300005458 Ga0070681_10072067 Ga0070681_100720673 121
88 3300005459 Ga0068867_100001161 Ga0068867_10000116117 121
89 3300005471 Ga0070698_100152422 Ga0070698_1001524221 121
90 3300005518 Ga0070699_100191566 Ga0070699_1001915663 121
91 3300005530 Ga0070679_100078720 Ga0070679_1000787202 121
92 3300005539 Ga0068853_100022315 Ga0068853_1000223154 121
93 3300005539 Ga0068853_100149686 Ga0068853_1001496862 121
94 3300005543 Ga0070672_100000454 Ga0070672_10000045426 121
95 3300005543 Ga0070672_100226070 Ga0070672_1002260702 121
96 3300005547 Ga0070693_100005951 Ga0070693_1000059515 121
97 3300005548 Ga0070665_100005379 Ga0070665_1000053795 121
98 3300005563 Ga0068855_100034556 Ga0068855_1000345564 121
99 3300005563 Ga0068855_100151652 Ga0068855_1001516524 121
100 3300005563 Ga0068855_100394795 Ga0068855_1003947952 121
101 3300005563 Ga0068855_100457460 Ga0068855_1004574602 121
102 3300005564 Ga0070664_100192340 Ga0070664_1001923402 121
103 3300005577 Ga0068857_100273355 Ga0068857_1002733553 121
104 3300005614 Ga0068856_100576248 Ga0068856_1005762482 121
105 3300005616 Ga0068852_100030072 Ga0068852_1000300722 121
106 3300005616 Ga0068852_100131197 Ga0068852_1001311974 121
107 3300005616 Ga0068852_100220565 Ga0068852_1002205653 121
108 3300005617 Ga0068859_100000083 Ga0068859_10000008334 121
109 3300005617 Ga0068859_100367347 Ga0068859_1003673473 121
110 3300005617 Ga0068859_101216626 Ga0068859_1012166261 121
111 3300005618 Ga0068864_100002317 Ga0068864_10000231712 121
112 3300005618 Ga0068864_100089637 Ga0068864_1000896375 121
113 3300005618 Ga0068864_100594760 Ga0068864_1005947602 121
114 3300005718 Ga0068866_10874106 Ga0068866_108741062 121
115 3300005719 Ga0068861_100004515 Ga0068861_1000045157 121
116 3300005719 Ga0068861_100542735 Ga0068861_1005427352 121
117 3300005834 Ga0068851_10001613 Ga0068851_100016139 121
118 3300005834 Ga0068851_10034061 Ga0068851_100340611 121
119 3300005841 Ga0068863_100001816 Ga0068863_10000181619 121
120 3300005841 Ga0068863_100002508 Ga0068863_1000025086 121
121 3300005842 Ga0068858_100005312 Ga0068858_10000531210 121
122 3300005842 Ga0068858_100017208 Ga0068858_10001720810 121
123 3300005842 Ga0068858_100097657 Ga0068858_1000976572 121
124 3300005843 Ga0068860_100002451 Ga0068860_1000024515 121
125 3300005843 Ga0068860_100006153 Ga0068860_1000061535 121
126 3300005844 Ga0068862_100040109 Ga0068862_1000401095 121
127 3300005983 Ga0081540_1010118 Ga0081540_10101183 121
128 3300006195 Ga0075366_10493456 Ga0075366_104934562 121
129 3300006237 Ga0097621_100000393 Ga0097621_1000003935 121
130 3300006237 Ga0097621_100387202 Ga0097621_1003872022 121
131 3300006358 Ga0068871_100019930 Ga0068871_1000199302 121
132 3300006358 Ga0068871_100292193 Ga0068871_1002921932 121
133 3300006847 Ga0075431_100278593 Ga0075431_1002785932 121
134 3300006881 Ga0068865_100001665 Ga0068865_10000166515 121
135 3300006931 Ga0097620_100000083 Ga0097620_10000008334 121
136 3300006931 Ga0097620_100367349 Ga0097620_1003673493 121
137 3300006931 Ga0097620_101216704 Ga0097620_1012167041 121
138 3300009093 Ga0105240_10012344 Ga0105240_100123443 121
139 3300009093 Ga0105240_10365656 Ga0105240_103656562 121
140 3300009093 Ga0105240_10458688 Ga0105240_104586882 121
141 3300009093 Ga0105240_11061460 Ga0105240_110614601 121
142 3300009094 Ga0111539_10199586 Ga0111539_101995862 121
143 3300009098 Ga0105245_10052404 Ga0105245_100524045 121
144 3300009098 Ga0105245_10159145 Ga0105245_101591451 121
145 3300009098 Ga0105245_11214138 Ga0105245_112141381 121
146 3300009101 Ga0105247_10009535 Ga0105247_100095356 121
147 3300009101 Ga0105247_10042667 Ga0105247_100426674 121
148 3300009148 Ga0105243_10650800 Ga0105243_106508001 121
149 3300009174 Ga0105241_10013985 Ga0105241_100139855 121
150 3300009174 Ga0105241_10375435 Ga0105241_103754352 121
151 3300009176 Ga0105242_10014804 Ga0105242_100148045 121
152 3300009177 Ga0105248_10373876 Ga0105248_103738762 121
153 3300009545 Ga0105237_10009157 Ga0105237_1000915712 121
154 3300009545 Ga0105237_10046277 Ga0105237_100462774 121
155 3300009545 Ga0105237_10821125 Ga0105237_108211251 121
156 3300009551 Ga0105238_10950071 Ga0105238_109500711 121
157 3300009553 Ga0105249_10006834 Ga0105249_100068348 121
158 3300009553 Ga0105249_10038863 Ga0105249_100388634 121
159 3300009553 Ga0105249_10202006 Ga0105249_102020062 121
160 3300010375 Ga0105239_10049235 Ga0105239_100492354 121
161 3300010375 Ga0105239_10091236 Ga0105239_100912364 121
162 3300010375 Ga0105239_10119777 Ga0105239_101197774 121
163 3300011119 Ga0105246_10002179 Ga0105246_100021794 121
164 3300011119 Ga0105246_10054486 Ga0105246_100544863 121
165 3300013100 Ga0157373_10093963 Ga0157373_100939633 121
166 3300013100 Ga0157373_10224382 Ga0157373_102243822 121
167 3300013102 Ga0157371_10347091 Ga0157371_103470911 121
168 3300013102 Ga0157371_10826852 Ga0157371_108268522 121
169 3300013102 Ga0157371_11450485 Ga0157371_114504851 121
170 3300013104 Ga0157370_10034585 Ga0157370_100345853 121
171 3300013105 Ga0157369_10086644 Ga0157369_100866442 121
172 3300013105 Ga0157369_11041195 Ga0157369_110411951 121
173 3300013296 Ga0157374_10001680 Ga0157374_100016804 121
174 3300013296 Ga0157374_10838946 Ga0157374_108389462 121
175 3300013296 Ga0157374_12811138 Ga0157374_128111381 121
176 3300013297 Ga0157378_10022959 Ga0157378_100229592 121
177 3300013297 Ga0157378_12778478 Ga0157378_127784781 121
178 3300013306 Ga0163162_10001349 Ga0163162_100013495 121
179 3300013306 Ga0163162_10001438 Ga0163162_100014386 121
180 3300013306 Ga0163162_10023631 Ga0163162_100236312 121
181 3300013306 Ga0163162_10296282 Ga0163162_102962822 121
182 3300013306 Ga0163162_11228761 Ga0163162_112287612 121
183 3300013306 Ga0163162_12778965 Ga0163162_127789651 121
184 3300013307 Ga0157372_10003268 Ga0157372_1000326817 121
185 3300013307 Ga0157372_10026537 Ga0157372_100265378 121
186 3300013307 Ga0157372_10804555 Ga0157372_108045552 121
187 3300013307 Ga0157372_11804638 Ga0157372_118046381 121
188 3300013308 Ga0157375_10001768 Ga0157375_100017684 121
189 3300013308 Ga0157375_10097261 Ga0157375_100972614 121
190 3300013308 Ga0157375_10920074 Ga0157375_109200742 121
191 3300013308 Ga0157375_13785043 Ga0157375_137850431 121
192 3300014325 Ga0163163_10001387 Ga0163163_100013875 121
193 3300014325 Ga0163163_11484495 Ga0163163_114844952 121
194 3300014497 Ga0182008_10032885 Ga0182008_100328853 121
195 3300014968 Ga0157379_10000812 Ga0157379_100008126 121
196 3300014968 Ga0157379_10035924 Ga0157379_100359241 121
197 3300014969 Ga0157376_10000939 Ga0157376_1000093916 121
198 3300014969 Ga0157376_10248566 Ga0157376_102485662 121
199 3300014969 Ga0157376_10430240 Ga0157376_104302402 121
200 3300017792 Ga0163161_10001125 Ga0163161_100011256 121
201 3300017792 Ga0163161_10001590 Ga0163161_100015903 121
202 3300025272 Ga0209455_1000882 Ga0209455_100088215 121
203 3300025298 Ga0209050_1009128 Ga0209050_10091284 121
204 3300025315 Ga0207697_10286650 Ga0207697_102866502 121
205 3300025321 Ga0207656_10020009 Ga0207656_100200093 121
206 3300025321 Ga0207656_10148995 Ga0207656_101489952 121
207 3300025900 Ga0207710_10021272 Ga0207710_100212724 121
208 3300025900 Ga0207710_10060049 Ga0207710_100600494 121
209 3300025903 Ga0207680_10000077 Ga0207680_1000007721 121
210 3300025903 Ga0207680_10000860 Ga0207680_1000086010 121
211 3300025904 Ga0207647_10119444 Ga0207647_101194442 121
212 3300025907 Ga0207645_10000332 Ga0207645_1000033228 121
213 3300025909 Ga0207705_10000937 Ga0207705_100009376 121
214 3300025911 Ga0207654_10008279 Ga0207654_100082793 121
215 3300025912 Ga0207707_10001291 Ga0207707_1000129117 121
216 3300025912 Ga0207707_10376632 Ga0207707_103766323 121
217 3300025913 Ga0207695_10054373 Ga0207695_100543735 121
218 3300025913 Ga0207695_10070884 Ga0207695_100708842 121
219 3300025913 Ga0207695_10213262 Ga0207695_102132622 121
220 3300025913 Ga0207695_10606594 Ga0207695_106065942 121
221 3300025914 Ga0207671_10001576 Ga0207671_1000157626 121
222 3300025914 Ga0207671_10194528 Ga0207671_101945283 121
223 3300025914 Ga0207671_10358029 Ga0207671_103580291 121
224 3300025917 Ga0207660_10011999 Ga0207660_100119995 121
225 3300025917 Ga0207660_10211629 Ga0207660_102116292 121
226 3300025920 Ga0207649_10776014 Ga0207649_107760141 121
227 3300025921 Ga0207652_10010964 Ga0207652_100109644 121
228 3300025927 Ga0207687_10396284 Ga0207687_103962842 121
229 3300025931 Ga0207644_10314380 Ga0207644_103143802 121
230 3300025933 Ga0207706_10004763 Ga0207706_1000476310 121
231 3300025934 Ga0207686_10012027 Ga0207686_100120275 121
232 3300025935 Ga0207709_10122292 Ga0207709_101222923 121
233 3300025935 Ga0207709_10217532 Ga0207709_102175322 121
234 3300025935 Ga0207709_10334825 Ga0207709_103348252 121
235 3300025936 Ga0207670_10251639 Ga0207670_102516391 121
236 3300025938 Ga0207704_10000639 Ga0207704_100006394 121
237 3300025940 Ga0207691_10000164 Ga0207691_1000016428 121
238 3300025940 Ga0207691_10011633 Ga0207691_100116339 121
239 3300025941 Ga0207711_10698694 Ga0207711_106986941 121
240 3300025942 Ga0207689_10002044 Ga0207689_1000204418 121
241 3300025942 Ga0207689_10143863 Ga0207689_101438632 121
242 3300025944 Ga0207661_10506511 Ga0207661_105065112 121
243 3300025949 Ga0207667_10028557 Ga0207667_100285574 121
244 3300025949 Ga0207667_10040505 Ga0207667_100405056 121
245 3300025949 Ga0207667_10270072 Ga0207667_102700722 121
246 3300025960 Ga0207651_10000648 Ga0207651_100006486 121
247 3300025961 Ga0207712_10015037 Ga0207712_100150372 121
248 3300025961 Ga0207712_10077612 Ga0207712_100776122 121
249 3300025972 Ga0207668_10000264 Ga0207668_1000026421 121
250 3300025972 Ga0207668_10348360 Ga0207668_103483602 121
251 3300025986 Ga0207658_10000445 Ga0207658_1000044510 121
252 3300026023 Ga0207677_10000570 Ga0207677_100005704 121
253 3300026035 Ga0207703_10002150 Ga0207703_100021505 121
254 3300026035 Ga0207703_10003481 Ga0207703_100034812 121
255 3300026041 Ga0207639_10008026 Ga0207639_100080267 121
256 3300026075 Ga0207708_11491594 Ga0207708_114915941 121
257 3300026088 Ga0207641_10000975 Ga0207641_100009754 121
258 3300026088 Ga0207641_10100982 Ga0207641_101009823 121
259 3300026089 Ga0207648_10007045 Ga0207648_1000704513 121
260 3300026095 Ga0207676_10004877 Ga0207676_100048777 121
261 3300026095 Ga0207676_10120405 Ga0207676_101204051 121
262 3300026116 Ga0207674_10419469 Ga0207674_104194691 121
263 3300026116 Ga0207674_10862187 Ga0207674_108621871 121
264 3300026118 Ga0207675_100008996 Ga0207675_1000089967 121
265 3300026118 Ga0207675_100429072 Ga0207675_1004290724 121
266 3300026121 Ga0207683_10096416 Ga0207683_100964162 121
267 3300026142 Ga0207698_10176557 Ga0207698_101765573 121
268 3300026142 Ga0207698_10273693 Ga0207698_102736932 121
269 3300026142 Ga0207698_10808386 Ga0207698_108083862 121
270 3300028379 Ga0268266_10001035 Ga0268266_1000103532 121
271 3300028380 Ga0268265_10266309 Ga0268265_102663092 121
272 3300028380 Ga0268265_10806397 Ga0268265_108063971 121
273 3300028381 Ga0268264_10000159 Ga0268264_1000015917 121
274 3300028381 Ga0268264_10000982 Ga0268264_1000098218 121
275 3300028381 Ga0268264_10010764 Ga0268264_100107646 121
276 3300031251 Ga0265327_10011262 Ga0265327_100112626 121
277 3300031251 Ga0265327_10015024 Ga0265327_100150241 121
278 3300031456 Ga0307513_10192051 Ga0307513_101920512 121
279 3300031507 Ga0307509_10227622 Ga0307509_102276221 121
280 3300031901 Ga0307406_10222033 Ga0307406_102220332 121
281 3300035088 Ga0373940_0307131 Ga0373940_0307131_144_509 121
282 3300035695 Ga0373927_0059974 Ga0373927_0059974_712_1077 121
283 3300041486 Ga0451807_2518234 Ga0451807_2518234_348_713 121
284 3300041512 Ga0451853_1120257 Ga0451853_1120257_879_1244 121
285 3300042876 Ga0451577_0147617 Ga0451577_0147617_390_755 121
286 3300042876 Ga0451577_0208473 Ga0451577_0208473_971_1336 121
287 3300042876 Ga0451577_1962430 Ga0451577_1962430_133_498 121
288 3300044673 Ga0453683_0295121 Ga0453683_0295121_355_720 121
289 3300044673 Ga0453683_0599666 Ga0453683_0599666_29_394 121
290 3300044693 Ga0466961_0536783 Ga0466961_0536783_135_500 121
291 3300044712 Ga0453684_0000920 Ga0453684_0000920_75975_76340 121
292 3300044712 Ga0453684_0087226 Ga0453684_0087226_1901_2266 121
293 3300044712 Ga0453684_0367015 Ga0453684_0367015_366_731 121
294 3300044712 Ga0453684_0877708 Ga0453684_0877708_369_734 121
295 3300044712 Ga0453684_1621230 Ga0453684_1621230_66_431 121
296 3300045051 Ga0451576_0705126 Ga0451576_0705126_235_600 121
297 3300046454 Ga0495592_0306469 Ga0495592_0306469_647_1012 121
298 3300046460 Ga0495638_0000020 Ga0495638_0000020_305573_305938 121
299 3300046522 Ga0495643_0126879 Ga0495643_0126879_378_743 121
300 3300046524 Ga0495648_0028894 Ga0495648_0028894_1082_1447 121
301 3300046529 Ga0495652_0132753 Ga0495652_0132753_162_527 121
302 3300047320 Ga0495672_0067674 Ga0495672_0067674_1354_1719 121
303 3300048912 Ga0496109_0054155 Ga0496109_0054155_2200_2565 121
304 3300049571 Ga0501034_1253691 Ga0501034_1253691_229_594 121
305 3300049571 Ga0501034_1348382 Ga0501034_1348382_47_412 121
306 3300049667 Ga0501230_087596 Ga0501230_087596_270_635 121
307 3300049686 Ga0501257_049000 Ga0501257_049000_615_980 121
308 3300049758 Ga0501241_006266 Ga0501241_006266_743_1108 121
309 3300050509 nmdc:mga0qj67_162119_c1 nmdc:mga0qj67_162119_c1_590_955 121
310 3300050510 nmdc:mga06r32_271829_c1 nmdc:mga06r32_271829_c1_828_1193 121
311 3300053088 Ga0500644_0129514 Ga0500644_0129514_309_674 121
312 3300053092 Ga0500583_0001253 Ga0500583_0001253_6202_6567 121
313 3300053104 Ga0500556_0361446 Ga0500556_0361446_179_544 121
314 3300053130 Ga0500642_0052801 Ga0500642_0052801_993_1358 121
315 3300053133 Ga0500655_025237 Ga0500655_025237_248_613 121
316 3300053139 Ga0500568_0068203 Ga0500568_0068203_213_578 121
317 3300053146 Ga0500588_0071346 Ga0500588_0071346_398_763 121
318 3300053156 Ga0500622_0002806 Ga0500622_0002806_8669_9034 121
319 3300061719 Ga0466962_0118421 Ga0466962_0118421_879_1244 121
320 3300002741 JGI25157J39369_1006390 JGI25157J39369_10063902 122
321 3300003323 rootH1_10168635 rootH1_101686352 122
322 3300005335 Ga0070666_10104576 Ga0070666_101045762 122
323 3300005459 Ga0068867_100569126 Ga0068867_1005691262 122
324 3300005539 Ga0068853_100478992 Ga0068853_1004789921 122
325 3300005617 Ga0068859_100301985 Ga0068859_1003019853 122
326 3300006931 Ga0097620_100302007 Ga0097620_1003020073 122
327 3300009147 Ga0114129_10082294 Ga0114129_100822943 122
328 3300025246 Ga0209646_1000006 Ga0209646_1000006140 122
329 3300025250 Ga0209026_1000185 Ga0209026_100018523 122
330 3300028794 Ga0307515_10000003 Ga0307515_10000003260 122
331 3300031649 Ga0307514_10186378 Ga0307514_101863782 122
332 3300053156 Ga0500622_0006047 Ga0500622_0006047_3788_4162 122
333 3300053732 Ga0500656_024083 Ga0500656_024083_74_448 122

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09966

DUF2200

Uncharacterized protein conserved in bacteria (DUF2200)

32

141

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c9p-assembly1.cif.gz_A crystal structure of uncharacterized protein sp1917 0.9356 9 119
5cd4-assembly2.cif.gz_P the type ie crispr cascade complex from e. coli, with two assemblies in the asymmetric unit arranged back-to-back 0.3623 7 119
6p0d-assembly1.cif.gz_A human dna ligase 1 (e346a/e592a) bound to an adenylated, hydroxyl terminated dna nick 0.361 30 119
4tvx-assembly1.cif.gz_P crystal structure of the e. coli crispr rna-guided surveillance complex, cascade 0.3605 7 119
4tvx-assembly1.cif.gz_O crystal structure of the e. coli crispr rna-guided surveillance complex, cascade 0.3356 3 119
ID Description Score Start End Superfamily
3c9pA00 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;uncharacterized protein sp1917 domain 0.9226 9 119 1.10.8.290
3c9pA00 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;uncharacterized protein sp1917 domain 0.8496 9 119 1.10.8.290
af_Q2FWE1_2_83_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.7529 14 122 1.10.8.10
af_P9WHV3_1_82_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.7383 14 122 1.10.8.10
af_P0ACC1_1_83_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.7219 14 122 1.10.8.10
ID Description Score Start End GO Terms
AF-A0A4T0V573-F1-model_v4 DUF2200 domain-containing protein 1.001 10 120
AF-A0A512HVD9-F1-model_v4 DUF2200 domain-containing protein 1.001 14 120
AF-I4B552-F1-model_v4 YdhG-like domain-containing protein 0.9999 7 120
AF-A0A4Q7M3Q8-F1-model_v4 DUF2200 domain-containing protein 0.9994 8 120
AF-A0A1E8ZN79-F1-model_v4 deleted 0.9977 10 120

Feature Viewer

pLDDT pTM Quality
90.83 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map