F411295
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 333 | 191 | 328 | 121 |
Family's Representative Sequence
| Representative Sequence | 3300005719|Ga0068861_100542735|Ga0068861_1005427352 |
| Length | 143 |
| Sequence | MFYLRSNLVAGQRHRTTFYLPGMNSSNTHNQRFAKMTFASVYPLYLAKVEKKGRTKEELHRVITWLTGFDNKKLQELIKEKVTFEIFFQRASLNPNVQLITGVICGYRIEEIEDPLTRQVRYLDKLVDELAKGRKMEKMLRSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2739367857 | Flavobacterium sp. GV029 | Isolate | Unclassified |
| 2 | 2739367858 | Flavobacterium sp. GV028 | Isolate | Unclassified |
| 3 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 4 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 57 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 61 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 88 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 93 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 94 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 145 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 146 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 147 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 148 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 149 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 150 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 151 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 152 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 153 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 154 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 155 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 156 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 157 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 158 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 159 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 160 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 161 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 172 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 176 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 177 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 178 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 181 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 182 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 183 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 184 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 185 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 186 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 187 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 188 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 189 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 190 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
| 191 | 8056440228 | Flavobacterium hibisci THG-HG1.4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.2 |
| Metatranscriptomes | 0.3 |
| Isolates | 1.5 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.2 |
| Nodule | 0 |
| Rhizoplane | 0.9 |
| Rhizosphere | 90.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25157J39369_1006390 | 3300002741 | Bacteria | 1798 |
| 2 | rootH2_10118059 | 3300003320 | Bacteria | 5952 |
| 3 | rootH1_10168635 | 3300003323 | Unclassified | 2555 |
| 4 | Ga0065714_10148886 | 3300005288 | Bacteria | 1119 |
| 5 | Ga0065714_10297806 | 3300005288 | Bacteria | 698 |
| 6 | Ga0065715_10383355 | 3300005293 | Bacteria | 904 |
| 7 | Ga0065707_10284448 | 3300005295 | Bacteria | 1033 |
| 8 | Ga0070676_10000097 | 3300005328 | Bacteria | 30711 |
| 9 | Ga0070683_100015535 | 3300005329 | Bacteria | 6691 |
| 10 | Ga0070690_100063051 | 3300005330 | Bacteria | 2391 |
| 11 | Ga0070690_100078241 | 3300005330 | Bacteria | 2160 |
| 12 | Ga0068869_100151270 | 3300005334 | Bacteria | 1800 |
| 13 | Ga0068869_100507494 | 3300005334 | Bacteria | 1008 |
| 14 | Ga0070666_10000041 | 3300005335 | Bacteria | 112410 |
| 15 | Ga0070666_10000740 | 3300005335 | Bacteria | 19756 |
| 16 | Ga0070666_10104576 | 3300005335 | Bacteria | 1954 |
| 17 | Ga0070680_100045285 | 3300005336 | Bacteria | 3576 |
| 18 | Ga0070682_100002628 | 3300005337 | Bacteria | 9931 |
| 19 | Ga0068868_100004669 | 3300005338 | Bacteria | 9620 |
| 20 | Ga0070660_100188471 | 3300005339 | Bacteria | 1670 |
| 21 | Ga0070660_100296763 | 3300005339 | Bacteria | 1324 |
| 22 | Ga0070660_100584027 | 3300005339 | Bacteria | 933 |
| 23 | Ga0070689_101557130 | 3300005340 | Bacteria | 599 |
| 24 | Ga0070691_10001069 | 3300005341 | Bacteria | 11325 |
| 25 | Ga0070661_100588968 | 3300005344 | Bacteria | 898 |
| 26 | Ga0070692_10168144 | 3300005345 | Unclassified | 1262 |
| 27 | Ga0070692_10713644 | 3300005345 | Bacteria | 676 |
| 28 | Ga0070668_100001435 | 3300005347 | Bacteria | 17198 |
| 29 | Ga0070668_100155041 | 3300005347 | Bacteria | 1855 |
| 30 | Ga0070671_100337062 | 3300005355 | Bacteria | 1286 |
| 31 | Ga0070673_100000390 | 3300005364 | Bacteria | 23156 |
| 32 | Ga0070659_100097541 | 3300005366 | Bacteria | 2362 |
| 33 | Ga0070667_100001708 | 3300005367 | Bacteria | 19644 |
| 34 | Ga0070667_100435607 | 3300005367 | Bacteria | 1197 |
| 35 | Ga0070700_100755469 | 3300005441 | Bacteria | 779 |
| 36 | Ga0070663_100150755 | 3300005455 | Bacteria | 1783 |
| 37 | Ga0070678_100518330 | 3300005456 | Bacteria | 1054 |
| 38 | Ga0070678_100587195 | 3300005456 | Bacteria | 993 |
| 39 | Ga0070662_100017277 | 3300005457 | Bacteria | 4861 |
| 40 | Ga0070681_10072067 | 3300005458 | Bacteria | 3418 |
| 41 | Ga0068867_100001161 | 3300005459 | Bacteria | 18001 |
| 42 | Ga0068867_100569126 | 3300005459 | Bacteria | 984 |
| 43 | Ga0070698_100152422 | 3300005471 | Bacteria | 2259 |
| 44 | Ga0070699_100191566 | 3300005518 | Unclassified | 1817 |
| 45 | Ga0070679_100078720 | 3300005530 | Bacteria | 3285 |
| 46 | Ga0070684_100050825 | 3300005535 | Bacteria | 3601 |
| 47 | Ga0068853_100022315 | 3300005539 | Bacteria | 5285 |
| 48 | Ga0068853_100149686 | 3300005539 | Bacteria | 2100 |
| 49 | Ga0068853_100478992 | 3300005539 | Bacteria | 1173 |
| 50 | Ga0070672_100000454 | 3300005543 | Bacteria | 23864 |
| 51 | Ga0070672_100226070 | 3300005543 | Bacteria | 1571 |
| 52 | Ga0070672_101500320 | 3300005543 | Bacteria | 604 |
| 53 | Ga0070693_100005951 | 3300005547 | Bacteria | 5897 |
| 54 | Ga0070665_100005379 | 3300005548 | Bacteria | 13222 |
| 55 | Ga0068855_100034556 | 3300005563 | Bacteria | 6028 |
| 56 | Ga0068855_100151652 | 3300005563 | Bacteria | 2635 |
| 57 | Ga0068855_100394795 | 3300005563 | Bacteria | 1517 |
| 58 | Ga0068855_100457460 | 3300005563 | Bacteria | 1392 |
| 59 | Ga0070664_100192340 | 3300005564 | Bacteria | 1818 |
| 60 | Ga0068857_100273355 | 3300005577 | Bacteria | 1553 |
| 61 | Ga0068856_100576248 | 3300005614 | Bacteria | 1147 |
| 62 | Ga0068852_100030072 | 3300005616 | Bacteria | 4467 |
| 63 | Ga0068852_100066193 | 3300005616 | Bacteria | 3155 |
| 64 | Ga0068852_100131197 | 3300005616 | Bacteria | 2308 |
| 65 | Ga0068852_100220565 | 3300005616 | Bacteria | 1803 |
| 66 | Ga0068852_102398455 | 3300005616 | Bacteria | 548 |
| 67 | Ga0068859_100000083 | 3300005617 | Bacteria | 87079 |
| 68 | Ga0068859_100301985 | 3300005617 | Bacteria | 1694 |
| 69 | Ga0068859_100367347 | 3300005617 | Bacteria | 1534 |
| 70 | Ga0068859_101216626 | 3300005617 | Bacteria | 830 |
| 71 | Ga0068864_100002317 | 3300005618 | Bacteria | 15748 |
| 72 | Ga0068864_100089637 | 3300005618 | Bacteria | 2710 |
| 73 | Ga0068864_100594760 | 3300005618 | Bacteria | 1073 |
| 74 | Ga0068866_10874106 | 3300005718 | Bacteria | 630 |
| 75 | Ga0068861_100004515 | 3300005719 | Bacteria | 9347 |
| 76 | Ga0068861_100542735 | 3300005719 | Unclassified | 1058 |
| 77 | Ga0068851_10001613 | 3300005834 | Bacteria | 9916 |
| 78 | Ga0068851_10034061 | 3300005834 | Bacteria | 2541 |
| 79 | Ga0068851_10207748 | 3300005834 | Bacteria | 1095 |
| 80 | Ga0068863_100001816 | 3300005841 | Bacteria | 21206 |
| 81 | Ga0068863_100002508 | 3300005841 | Bacteria | 18243 |
| 82 | Ga0068858_100005312 | 3300005842 | Bacteria | 12629 |
| 83 | Ga0068858_100017208 | 3300005842 | Bacteria | 6784 |
| 84 | Ga0068858_100097657 | 3300005842 | Bacteria | 2738 |
| 85 | Ga0068860_100002451 | 3300005843 | Bacteria | 19478 |
| 86 | Ga0068860_100006153 | 3300005843 | Bacteria | 12068 |
| 87 | Ga0068860_100320184 | 3300005843 | Bacteria | 1522 |
| 88 | Ga0068862_100040109 | 3300005844 | Unclassified | 3979 |
| 89 | Ga0081540_1010118 | 3300005983 | Bacteria | 6420 |
| 90 | Ga0075366_10493456 | 3300006195 | Bacteria | 757 |
| 91 | Ga0097621_100000393 | 3300006237 | Bacteria | 30466 |
| 92 | Ga0097621_100387202 | 3300006237 | Bacteria | 1250 |
| 93 | Ga0068871_100019930 | 3300006358 | Bacteria | 5128 |
| 94 | Ga0068871_100292193 | 3300006358 | Bacteria | 1428 |
| 95 | Ga0068871_102213286 | 3300006358 | Bacteria | 524 |
| 96 | Ga0075431_100278593 | 3300006847 | Unclassified | 1693 |
| 97 | Ga0068865_100001665 | 3300006881 | Bacteria | 12998 |
| 98 | Ga0097620_100000083 | 3300006931 | Bacteria | 87079 |
| 99 | Ga0097620_100302007 | 3300006931 | Bacteria | 1694 |
| 100 | Ga0097620_100367349 | 3300006931 | Bacteria | 1534 |
| 101 | Ga0097620_101216704 | 3300006931 | Bacteria | 830 |
| 102 | Ga0105240_10002509 | 3300009093 | Bacteria | 29492 |
| 103 | Ga0105240_10012344 | 3300009093 | Bacteria | 11797 |
| 104 | Ga0105240_10365656 | 3300009093 | Bacteria | 1633 |
| 105 | Ga0105240_10458688 | 3300009093 | Bacteria | 1425 |
| 106 | Ga0105240_11061460 | 3300009093 | Bacteria | 864 |
| 107 | Ga0111539_10192547 | 3300009094 | Bacteria | 2379 |
| 108 | Ga0111539_10199586 | 3300009094 | Unclassified | 2333 |
| 109 | Ga0105245_10052404 | 3300009098 | Bacteria | 3659 |
| 110 | Ga0105245_10159145 | 3300009098 | Bacteria | 2142 |
| 111 | Ga0105245_11214138 | 3300009098 | Bacteria | 802 |
| 112 | Ga0105247_10009535 | 3300009101 | Bacteria | 5891 |
| 113 | Ga0105247_10042667 | 3300009101 | Bacteria | 2778 |
| 114 | Ga0114129_10082294 | 3300009147 | Bacteria | 4473 |
| 115 | Ga0105243_10650800 | 3300009148 | Bacteria | 1021 |
| 116 | Ga0105241_10013985 | 3300009174 | Bacteria | 5884 |
| 117 | Ga0105241_10375435 | 3300009174 | Bacteria | 1241 |
| 118 | Ga0105242_10014804 | 3300009176 | Bacteria | 6041 |
| 119 | Ga0105248_10373876 | 3300009177 | Bacteria | 1604 |
| 120 | Ga0105237_10009157 | 3300009545 | Bacteria | 10637 |
| 121 | Ga0105237_10046277 | 3300009545 | Bacteria | 4376 |
| 122 | Ga0105237_10821125 | 3300009545 | Bacteria | 936 |
| 123 | Ga0105238_10021422 | 3300009551 | Bacteria | 6584 |
| 124 | Ga0105238_10950071 | 3300009551 | Bacteria | 879 |
| 125 | Ga0105249_10006834 | 3300009553 | Bacteria | 9947 |
| 126 | Ga0105249_10038863 | 3300009553 | Unclassified | 4319 |
| 127 | Ga0105249_10202006 | 3300009553 | Bacteria | 1945 |
| 128 | Ga0105239_10049235 | 3300010375 | Bacteria | 4621 |
| 129 | Ga0105239_10091236 | 3300010375 | Bacteria | 3362 |
| 130 | Ga0105239_10119777 | 3300010375 | Bacteria | 2922 |
| 131 | Ga0105246_10002179 | 3300011119 | Bacteria | 11813 |
| 132 | Ga0105246_10054486 | 3300011119 | Bacteria | 2756 |
| 133 | Ga0157373_10093963 | 3300013100 | Bacteria | 2112 |
| 134 | Ga0157373_10224382 | 3300013100 | Bacteria | 1326 |
| 135 | Ga0157371_10056355 | 3300013102 | Bacteria | 2788 |
| 136 | Ga0157371_10347091 | 3300013102 | Bacteria | 1080 |
| 137 | Ga0157371_10826852 | 3300013102 | Bacteria | 699 |
| 138 | Ga0157371_11450485 | 3300013102 | Bacteria | 534 |
| 139 | Ga0157370_10034585 | 3300013104 | Bacteria | 4918 |
| 140 | Ga0157370_11602813 | 3300013104 | Bacteria | 585 |
| 141 | Ga0157369_10086644 | 3300013105 | Bacteria | 3345 |
| 142 | Ga0157369_10106503 | 3300013105 | Bacteria | 2983 |
| 143 | Ga0157369_10735534 | 3300013105 | Bacteria | 1015 |
| 144 | Ga0157369_11041195 | 3300013105 | Bacteria | 837 |
| 145 | Ga0157374_10001680 | 3300013296 | Bacteria | 18540 |
| 146 | Ga0157374_10546962 | 3300013296 | Bacteria | 1165 |
| 147 | Ga0157374_10838946 | 3300013296 | Bacteria | 936 |
| 148 | Ga0157374_12811138 | 3300013296 | Bacteria | 514 |
| 149 | Ga0157378_10022959 | 3300013297 | Bacteria | 5492 |
| 150 | Ga0157378_12778478 | 3300013297 | Bacteria | 542 |
| 151 | Ga0163162_10001349 | 3300013306 | Bacteria | 22859 |
| 152 | Ga0163162_10001438 | 3300013306 | Bacteria | 22185 |
| 153 | Ga0163162_10023631 | 3300013306 | Bacteria | 6069 |
| 154 | Ga0163162_10296282 | 3300013306 | Bacteria | 1749 |
| 155 | Ga0163162_11228761 | 3300013306 | Bacteria | 851 |
| 156 | Ga0163162_12417089 | 3300013306 | Bacteria | 604 |
| 157 | Ga0163162_12778965 | 3300013306 | Bacteria | 563 |
| 158 | Ga0157372_10003268 | 3300013307 | Bacteria | 17515 |
| 159 | Ga0157372_10026537 | 3300013307 | Bacteria | 6304 |
| 160 | Ga0157372_10265208 | 3300013307 | Bacteria | 1994 |
| 161 | Ga0157372_10804555 | 3300013307 | Bacteria | 1092 |
| 162 | Ga0157372_11804638 | 3300013307 | Unclassified | 703 |
| 163 | Ga0157375_10001768 | 3300013308 | Bacteria | 18557 |
| 164 | Ga0157375_10097261 | 3300013308 | Bacteria | 3018 |
| 165 | Ga0157375_10920074 | 3300013308 | Bacteria | 1018 |
| 166 | Ga0157375_13785043 | 3300013308 | Bacteria | 502 |
| 167 | Ga0163163_10001387 | 3300014325 | Bacteria | 20467 |
| 168 | Ga0163163_11484495 | 3300014325 | Bacteria | 739 |
| 169 | Ga0182008_10032885 | 3300014497 | Bacteria | 2604 |
| 170 | Ga0157379_10000812 | 3300014968 | Bacteria | 25341 |
| 171 | Ga0157379_10035924 | 3300014968 | Bacteria | 4419 |
| 172 | Ga0157376_10000939 | 3300014969 | Bacteria | 18934 |
| 173 | Ga0157376_10248566 | 3300014969 | Bacteria | 1660 |
| 174 | Ga0157376_10430240 | 3300014969 | Bacteria | 1283 |
| 175 | Ga0157376_10704448 | 3300014969 | Bacteria | 1015 |
| 176 | Ga0163161_10001125 | 3300017792 | Bacteria | 20161 |
| 177 | Ga0163161_10001590 | 3300017792 | Bacteria | 16755 |
| 178 | Ga0206352_10709332 | 3300020078 | Bacteria | 633 |
| 179 | Ga0209646_1000006 | 3300025246 | Bacteria | 694084 |
| 180 | Ga0209026_1000185 | 3300025250 | Bacteria | 91252 |
| 181 | Ga0209455_1000882 | 3300025272 | Bacteria | 15832 |
| 182 | Ga0209050_1009128 | 3300025298 | Bacteria | 5141 |
| 183 | Ga0209257_1018889 | 3300025304 | Bacteria | 2626 |
| 184 | Ga0207697_10286650 | 3300025315 | Bacteria | 730 |
| 185 | Ga0207656_10020009 | 3300025321 | Bacteria | 2654 |
| 186 | Ga0207656_10148995 | 3300025321 | Bacteria | 1107 |
| 187 | Ga0207710_10021272 | 3300025900 | Bacteria | 2778 |
| 188 | Ga0207710_10060049 | 3300025900 | Bacteria | 1722 |
| 189 | Ga0207680_10000077 | 3300025903 | Bacteria | 43842 |
| 190 | Ga0207680_10000860 | 3300025903 | Bacteria | 14326 |
| 191 | Ga0207647_10000689 | 3300025904 | Bacteria | 26518 |
| 192 | Ga0207647_10119444 | 3300025904 | Bacteria | 1555 |
| 193 | Ga0207645_10000332 | 3300025907 | Bacteria | 39392 |
| 194 | Ga0207645_10397714 | 3300025907 | Bacteria | 926 |
| 195 | Ga0207705_10000937 | 3300025909 | Bacteria | 23816 |
| 196 | Ga0207654_10008279 | 3300025911 | Bacteria | 5251 |
| 197 | Ga0207707_10001291 | 3300025912 | Bacteria | 23352 |
| 198 | Ga0207707_10376632 | 3300025912 | Bacteria | 1221 |
| 199 | Ga0207695_10007723 | 3300025913 | Bacteria | 13622 |
| 200 | Ga0207695_10054373 | 3300025913 | Bacteria | 4182 |
| 201 | Ga0207695_10070884 | 3300025913 | Bacteria | 3561 |
| 202 | Ga0207695_10213262 | 3300025913 | Bacteria | 1840 |
| 203 | Ga0207695_10606594 | 3300025913 | Bacteria | 976 |
| 204 | Ga0207671_10001576 | 3300025914 | Bacteria | 25992 |
| 205 | Ga0207671_10194528 | 3300025914 | Bacteria | 1582 |
| 206 | Ga0207671_10358029 | 3300025914 | Bacteria | 1158 |
| 207 | Ga0207660_10011999 | 3300025917 | Bacteria | 5658 |
| 208 | Ga0207660_10211629 | 3300025917 | Unclassified | 1518 |
| 209 | Ga0207657_10047328 | 3300025919 | Bacteria | 3762 |
| 210 | Ga0207649_10776014 | 3300025920 | Bacteria | 747 |
| 211 | Ga0207652_10010964 | 3300025921 | Bacteria | 7307 |
| 212 | Ga0207694_10026026 | 3300025924 | Bacteria | 4449 |
| 213 | Ga0207659_11290418 | 3300025926 | Bacteria | 627 |
| 214 | Ga0207687_10396284 | 3300025927 | Bacteria | 1134 |
| 215 | Ga0207644_10314380 | 3300025931 | Bacteria | 1265 |
| 216 | Ga0207706_10004763 | 3300025933 | Bacteria | 12706 |
| 217 | Ga0207686_10012027 | 3300025934 | Bacteria | 4752 |
| 218 | Ga0207709_10122292 | 3300025935 | Bacteria | 1759 |
| 219 | Ga0207709_10217532 | 3300025935 | Bacteria | 1375 |
| 220 | Ga0207709_10334825 | 3300025935 | Bacteria | 1137 |
| 221 | Ga0207670_10251639 | 3300025936 | Bacteria | 1366 |
| 222 | Ga0207704_10000639 | 3300025938 | Bacteria | 15472 |
| 223 | Ga0207691_10000164 | 3300025940 | Bacteria | 61768 |
| 224 | Ga0207691_10011633 | 3300025940 | Bacteria | 8447 |
| 225 | Ga0207711_10698694 | 3300025941 | Bacteria | 946 |
| 226 | Ga0207689_10002044 | 3300025942 | Bacteria | 19050 |
| 227 | Ga0207689_10077050 | 3300025942 | Bacteria | 2741 |
| 228 | Ga0207689_10143863 | 3300025942 | Bacteria | 1965 |
| 229 | Ga0207661_10039888 | 3300025944 | Bacteria | 3688 |
| 230 | Ga0207661_10506511 | 3300025944 | Bacteria | 1103 |
| 231 | Ga0207667_10028557 | 3300025949 | Bacteria | 6058 |
| 232 | Ga0207667_10040505 | 3300025949 | Bacteria | 4961 |
| 233 | Ga0207667_10270072 | 3300025949 | Bacteria | 1738 |
| 234 | Ga0207667_10692902 | 3300025949 | Bacteria | 1022 |
| 235 | Ga0207651_10000648 | 3300025960 | Bacteria | 14769 |
| 236 | Ga0207712_10015037 | 3300025961 | Bacteria | 4986 |
| 237 | Ga0207712_10077612 | 3300025961 | Bacteria | 2408 |
| 238 | Ga0207668_10000264 | 3300025972 | Bacteria | 34945 |
| 239 | Ga0207668_10348360 | 3300025972 | Bacteria | 1238 |
| 240 | Ga0207658_10000445 | 3300025986 | Bacteria | 38969 |
| 241 | Ga0207677_10000570 | 3300026023 | Bacteria | 23162 |
| 242 | Ga0207703_10002150 | 3300026035 | Bacteria | 17328 |
| 243 | Ga0207703_10003481 | 3300026035 | Bacteria | 13177 |
| 244 | Ga0207639_10008026 | 3300026041 | Bacteria | 7214 |
| 245 | Ga0207708_11491594 | 3300026075 | Bacteria | 594 |
| 246 | Ga0207641_10000975 | 3300026088 | Bacteria | 29289 |
| 247 | Ga0207641_10100982 | 3300026088 | Bacteria | 2541 |
| 248 | Ga0207648_10007045 | 3300026089 | Bacteria | 11111 |
| 249 | Ga0207676_10004877 | 3300026095 | Bacteria | 9495 |
| 250 | Ga0207676_10120405 | 3300026095 | Bacteria | 2212 |
| 251 | Ga0207674_10419469 | 3300026116 | Bacteria | 1293 |
| 252 | Ga0207674_10862187 | 3300026116 | Bacteria | 873 |
| 253 | Ga0207675_100008996 | 3300026118 | Bacteria | 9372 |
| 254 | Ga0207675_100429072 | 3300026118 | Unclassified | 1306 |
| 255 | Ga0207683_10096416 | 3300026121 | Bacteria | 2637 |
| 256 | Ga0207698_10176557 | 3300026142 | Bacteria | 1887 |
| 257 | Ga0207698_10227213 | 3300026142 | Bacteria | 1691 |
| 258 | Ga0207698_10273693 | 3300026142 | Bacteria | 1558 |
| 259 | Ga0207698_10808386 | 3300026142 | Bacteria | 940 |
| 260 | Ga0268266_10001035 | 3300028379 | Bacteria | 34953 |
| 261 | Ga0268266_11769227 | 3300028379 | Bacteria | 593 |
| 262 | Ga0268265_10266309 | 3300028380 | Bacteria | 1526 |
| 263 | Ga0268265_10806397 | 3300028380 | Bacteria | 915 |
| 264 | Ga0268264_10000159 | 3300028381 | Bacteria | 152716 |
| 265 | Ga0268264_10000982 | 3300028381 | Bacteria | 29187 |
| 266 | Ga0268264_10010764 | 3300028381 | Bacteria | 7557 |
| 267 | Ga0268264_11419795 | 3300028381 | Bacteria | 705 |
| 268 | Ga0307515_10000003 | 3300028794 | Bacteria | 891317 |
| 269 | Ga0265327_10011262 | 3300031251 | Bacteria | 6182 |
| 270 | Ga0265327_10015024 | 3300031251 | Bacteria | 5031 |
| 271 | Ga0307513_10192051 | 3300031456 | Bacteria | 1893 |
| 272 | Ga0307509_10227622 | 3300031507 | Bacteria | 1671 |
| 273 | Ga0307514_10186378 | 3300031649 | Bacteria | 1329 |
| 274 | Ga0307406_10222033 | 3300031901 | Bacteria | 1405 |
| 275 | Ga0373940_0307131 | 3300035088 | Bacteria | 548 |
| 276 | Ga0373927_0059974 | 3300035695 | Bacteria | 2461 |
| 277 | Ga0395899_0013383 | 3300037312 | Bacteria | 6278 |
| 278 | Ga0451807_2136032 | 3300041486 | Bacteria | 2320 |
| 279 | Ga0451807_2518234 | 3300041486 | Bacteria | 850 |
| 280 | Ga0451853_1120257 | 3300041512 | Bacteria | 1820 |
| 281 | Ga0439441_023790 | 3300042001 | Bacteria | 1146 |
| 282 | Ga0451577_0147617 | 3300042876 | Bacteria | 2115 |
| 283 | Ga0451577_0208473 | 3300042876 | Bacteria | 1765 |
| 284 | Ga0451577_1962430 | 3300042876 | Bacteria | 512 |
| 285 | Ga0453683_0295121 | 3300044673 | Bacteria | 1036 |
| 286 | Ga0453683_0433779 | 3300044673 | Unclassified | 849 |
| 287 | Ga0453683_0599666 | 3300044673 | Unclassified | 718 |
| 288 | Ga0466961_0536783 | 3300044693 | Bacteria | 705 |
| 289 | Ga0453684_0000920 | 3300044712 | Bacteria | 97531 |
| 290 | Ga0453684_0001530 | 3300044712 | Bacteria | 64680 |
| 291 | Ga0453684_0082910 | 3300044712 | Unclassified | 3993 |
| 292 | Ga0453684_0087226 | 3300044712 | Bacteria | 3868 |
| 293 | Ga0453684_0367015 | 3300044712 | Bacteria | 1619 |
| 294 | Ga0453684_0877708 | 3300044712 | Unclassified | 962 |
| 295 | Ga0453684_1621230 | 3300044712 | Bacteria | 663 |
| 296 | Ga0451576_0705126 | 3300045051 | Bacteria | 1060 |
| 297 | Ga0451576_2698079 | 3300045051 | Unclassified | 506 |
| 298 | Ga0495592_0306469 | 3300046454 | Bacteria | 1031 |
| 299 | Ga0495638_0000020 | 3300046460 | Bacteria | 372434 |
| 300 | Ga0495606_0645776 | 3300046507 | Bacteria | 513 |
| 301 | Ga0495616_0403701 | 3300046513 | Bacteria | 561 |
| 302 | Ga0495643_0126879 | 3300046522 | Bacteria | 1284 |
| 303 | Ga0495648_0028894 | 3300046524 | Bacteria | 3687 |
| 304 | Ga0495652_0132753 | 3300046529 | Bacteria | 1969 |
| 305 | Ga0495654_0037278 | 3300046530 | Bacteria | 2439 |
| 306 | Ga0495668_0001230 | 3300046616 | Bacteria | 25789 |
| 307 | Ga0495672_0067674 | 3300047320 | Bacteria | 2034 |
| 308 | Ga0496109_0054155 | 3300048912 | Bacteria | 3660 |
| 309 | Ga0501034_1253691 | 3300049571 | Bacteria | 619 |
| 310 | Ga0501034_1348382 | 3300049571 | Bacteria | 589 |
| 311 | Ga0501073_0016243 | 3300049589 | Bacteria | 5396 |
| 312 | Ga0501074_0426463 | 3300049590 | Bacteria | 941 |
| 313 | Ga0501230_087596 | 3300049667 | Bacteria | 659 |
| 314 | Ga0501257_049000 | 3300049686 | Bacteria | 1051 |
| 315 | Ga0501241_006266 | 3300049758 | Bacteria | 2191 |
| 316 | nmdc:mga0qj67_162119_c1 | 3300050509 | Bacteria | 1815 |
| 317 | nmdc:mga06r32_271829_c1 | 3300050510 | Bacteria | 1682 |
| 318 | Ga0500644_0129514 | 3300053088 | Unclassified | 992 |
| 319 | Ga0500583_0001253 | 3300053092 | Bacteria | 7246 |
| 320 | Ga0500556_0361446 | 3300053104 | Bacteria | 561 |
| 321 | Ga0500642_0052801 | 3300053130 | Bacteria | 1800 |
| 322 | Ga0500655_025237 | 3300053133 | Bacteria | 1128 |
| 323 | Ga0500568_0068203 | 3300053139 | Bacteria | 1365 |
| 324 | Ga0500588_0071346 | 3300053146 | Bacteria | 1140 |
| 325 | Ga0500622_0002806 | 3300053156 | Bacteria | 12242 |
| 326 | Ga0500622_0006047 | 3300053156 | Bacteria | 7109 |
| 327 | Ga0500656_024083 | 3300053732 | Bacteria | 773 |
| 328 | Ga0466962_0118421 | 3300061719 | Bacteria | 1277 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005345 | Ga0070692_10713644 | Ga0070692_107136441 | 94 |
| 2 | 3300005834 | Ga0068851_10207748 | Ga0068851_102077482 | 99 |
| 3 | 3300009093 | Ga0105240_10002509 | Ga0105240_1000250919 | 107 |
| 4 | 3300009551 | Ga0105238_10021422 | Ga0105238_100214223 | 107 |
| 5 | 3300013105 | Ga0157369_10735534 | Ga0157369_107355342 | 107 |
| 6 | 3300013307 | Ga0157372_10265208 | Ga0157372_102652083 | 107 |
| 7 | 3300005329 | Ga0070683_100015535 | Ga0070683_1000155353 | 115 |
| 8 | 3300005535 | Ga0070684_100050825 | Ga0070684_1000508252 | 115 |
| 9 | 3300020078 | Ga0206352_10709332 | Ga0206352_107093322 | 115 |
| 10 | 3300025913 | Ga0207695_10007723 | Ga0207695_100077235 | 115 |
| 11 | 3300025924 | Ga0207694_10026026 | Ga0207694_100260264 | 115 |
| 12 | 3300025942 | Ga0207689_10077050 | Ga0207689_100770504 | 115 |
| 13 | 3300025944 | Ga0207661_10039888 | Ga0207661_100398884 | 115 |
| 14 | 3300044673 | Ga0453683_0433779 | Ga0453683_0433779_226_576 | 116 |
| 15 | 3300049590 | Ga0501074_0426463 | Ga0501074_0426463_10_363 | 116 |
| 16 | iso_pu_bacteria | 2739367857 | 2740002734 | 116 |
| 17 | iso_pu_bacteria | 2739367858 | 2740007551 | 116 |
| 18 | iso_pu_bacteria | 8056440228 | 8056443611 | 116 |
| 19 | iso_pu_bacteria | 8003151029 | 8003154250 | 117 |
| 20 | 3300044712 | Ga0453684_0082910 | Ga0453684_0082910_1971_2327 | 118 |
| 21 | 3300049589 | Ga0501073_0016243 | Ga0501073_0016243_127_600 | 118 |
| 22 | iso_pu_bacteria | 2929154850 | 2929154880 | 118 |
| 23 | 3300005843 | Ga0068860_100320184 | Ga0068860_1003201843 | 119 |
| 24 | 3300028381 | Ga0268264_11419795 | Ga0268264_114197952 | 119 |
| 25 | 3300046507 | Ga0495606_0645776 | Ga0495606_0645776_70_474 | 119 |
| 26 | 3300005288 | Ga0065714_10148886 | Ga0065714_101488861 | 120 |
| 27 | 3300005339 | Ga0070660_100584027 | Ga0070660_1005840272 | 120 |
| 28 | 3300005366 | Ga0070659_100097541 | Ga0070659_1000975412 | 120 |
| 29 | 3300005456 | Ga0070678_100587195 | Ga0070678_1005871952 | 120 |
| 30 | 3300005543 | Ga0070672_101500320 | Ga0070672_1015003202 | 120 |
| 31 | 3300005616 | Ga0068852_100066193 | Ga0068852_1000661934 | 120 |
| 32 | 3300005616 | Ga0068852_102398455 | Ga0068852_1023984551 | 120 |
| 33 | 3300006358 | Ga0068871_102213286 | Ga0068871_1022132861 | 120 |
| 34 | 3300009094 | Ga0111539_10192547 | Ga0111539_101925474 | 120 |
| 35 | 3300013102 | Ga0157371_10056355 | Ga0157371_100563553 | 120 |
| 36 | 3300013104 | Ga0157370_11602813 | Ga0157370_116028131 | 120 |
| 37 | 3300013105 | Ga0157369_10106503 | Ga0157369_101065033 | 120 |
| 38 | 3300013296 | Ga0157374_10546962 | Ga0157374_105469622 | 120 |
| 39 | 3300013306 | Ga0163162_12417089 | Ga0163162_124170892 | 120 |
| 40 | 3300014969 | Ga0157376_10704448 | Ga0157376_107044482 | 120 |
| 41 | 3300025304 | Ga0209257_1018889 | Ga0209257_10188891 | 120 |
| 42 | 3300025904 | Ga0207647_10000689 | Ga0207647_100006895 | 120 |
| 43 | 3300025907 | Ga0207645_10397714 | Ga0207645_103977142 | 120 |
| 44 | 3300025919 | Ga0207657_10047328 | Ga0207657_100473285 | 120 |
| 45 | 3300025926 | Ga0207659_11290418 | Ga0207659_112904182 | 120 |
| 46 | 3300025949 | Ga0207667_10692902 | Ga0207667_106929021 | 120 |
| 47 | 3300026142 | Ga0207698_10227213 | Ga0207698_102272132 | 120 |
| 48 | 3300028379 | Ga0268266_11769227 | Ga0268266_117692272 | 120 |
| 49 | 3300037312 | Ga0395899_0013383 | Ga0395899_0013383_2626_2988 | 120 |
| 50 | 3300041486 | Ga0451807_2136032 | Ga0451807_2136032_823_1188 | 120 |
| 51 | 3300042001 | Ga0439441_023790 | Ga0439441_023790_581_955 | 120 |
| 52 | 3300044712 | Ga0453684_0001530 | Ga0453684_0001530_31884_32246 | 120 |
| 53 | 3300045051 | Ga0451576_2698079 | Ga0451576_2698079_13_387 | 120 |
| 54 | 3300046513 | Ga0495616_0403701 | Ga0495616_0403701_108_470 | 120 |
| 55 | 3300046530 | Ga0495654_0037278 | Ga0495654_0037278_756_1118 | 120 |
| 56 | 3300046616 | Ga0495668_0001230 | Ga0495668_0001230_1348_1710 | 120 |
| 57 | 3300003320 | rootH2_10118059 | rootH2_101180598 | 121 |
| 58 | 3300005288 | Ga0065714_10297806 | Ga0065714_102978061 | 121 |
| 59 | 3300005293 | Ga0065715_10383355 | Ga0065715_103833551 | 121 |
| 60 | 3300005295 | Ga0065707_10284448 | Ga0065707_102844481 | 121 |
| 61 | 3300005328 | Ga0070676_10000097 | Ga0070676_1000009712 | 121 |
| 62 | 3300005330 | Ga0070690_100063051 | Ga0070690_1000630513 | 121 |
| 63 | 3300005330 | Ga0070690_100078241 | Ga0070690_1000782412 | 121 |
| 64 | 3300005334 | Ga0068869_100151270 | Ga0068869_1001512702 | 121 |
| 65 | 3300005334 | Ga0068869_100507494 | Ga0068869_1005074942 | 121 |
| 66 | 3300005335 | Ga0070666_10000041 | Ga0070666_1000004134 | 121 |
| 67 | 3300005335 | Ga0070666_10000740 | Ga0070666_1000074021 | 121 |
| 68 | 3300005336 | Ga0070680_100045285 | Ga0070680_1000452853 | 121 |
| 69 | 3300005337 | Ga0070682_100002628 | Ga0070682_1000026284 | 121 |
| 70 | 3300005338 | Ga0068868_100004669 | Ga0068868_1000046692 | 121 |
| 71 | 3300005339 | Ga0070660_100188471 | Ga0070660_1001884713 | 121 |
| 72 | 3300005339 | Ga0070660_100296763 | Ga0070660_1002967632 | 121 |
| 73 | 3300005340 | Ga0070689_101557130 | Ga0070689_1015571301 | 121 |
| 74 | 3300005341 | Ga0070691_10001069 | Ga0070691_100010694 | 121 |
| 75 | 3300005344 | Ga0070661_100588968 | Ga0070661_1005889681 | 121 |
| 76 | 3300005345 | Ga0070692_10168144 | Ga0070692_101681443 | 121 |
| 77 | 3300005347 | Ga0070668_100001435 | Ga0070668_10000143516 | 121 |
| 78 | 3300005347 | Ga0070668_100155041 | Ga0070668_1001550413 | 121 |
| 79 | 3300005355 | Ga0070671_100337062 | Ga0070671_1003370622 | 121 |
| 80 | 3300005364 | Ga0070673_100000390 | Ga0070673_10000039021 | 121 |
| 81 | 3300005367 | Ga0070667_100001708 | Ga0070667_1000017085 | 121 |
| 82 | 3300005367 | Ga0070667_100435607 | Ga0070667_1004356072 | 121 |
| 83 | 3300005441 | Ga0070700_100755469 | Ga0070700_1007554691 | 121 |
| 84 | 3300005455 | Ga0070663_100150755 | Ga0070663_1001507552 | 121 |
| 85 | 3300005456 | Ga0070678_100518330 | Ga0070678_1005183302 | 121 |
| 86 | 3300005457 | Ga0070662_100017277 | Ga0070662_1000172773 | 121 |
| 87 | 3300005458 | Ga0070681_10072067 | Ga0070681_100720673 | 121 |
| 88 | 3300005459 | Ga0068867_100001161 | Ga0068867_10000116117 | 121 |
| 89 | 3300005471 | Ga0070698_100152422 | Ga0070698_1001524221 | 121 |
| 90 | 3300005518 | Ga0070699_100191566 | Ga0070699_1001915663 | 121 |
| 91 | 3300005530 | Ga0070679_100078720 | Ga0070679_1000787202 | 121 |
| 92 | 3300005539 | Ga0068853_100022315 | Ga0068853_1000223154 | 121 |
| 93 | 3300005539 | Ga0068853_100149686 | Ga0068853_1001496862 | 121 |
| 94 | 3300005543 | Ga0070672_100000454 | Ga0070672_10000045426 | 121 |
| 95 | 3300005543 | Ga0070672_100226070 | Ga0070672_1002260702 | 121 |
| 96 | 3300005547 | Ga0070693_100005951 | Ga0070693_1000059515 | 121 |
| 97 | 3300005548 | Ga0070665_100005379 | Ga0070665_1000053795 | 121 |
| 98 | 3300005563 | Ga0068855_100034556 | Ga0068855_1000345564 | 121 |
| 99 | 3300005563 | Ga0068855_100151652 | Ga0068855_1001516524 | 121 |
| 100 | 3300005563 | Ga0068855_100394795 | Ga0068855_1003947952 | 121 |
| 101 | 3300005563 | Ga0068855_100457460 | Ga0068855_1004574602 | 121 |
| 102 | 3300005564 | Ga0070664_100192340 | Ga0070664_1001923402 | 121 |
| 103 | 3300005577 | Ga0068857_100273355 | Ga0068857_1002733553 | 121 |
| 104 | 3300005614 | Ga0068856_100576248 | Ga0068856_1005762482 | 121 |
| 105 | 3300005616 | Ga0068852_100030072 | Ga0068852_1000300722 | 121 |
| 106 | 3300005616 | Ga0068852_100131197 | Ga0068852_1001311974 | 121 |
| 107 | 3300005616 | Ga0068852_100220565 | Ga0068852_1002205653 | 121 |
| 108 | 3300005617 | Ga0068859_100000083 | Ga0068859_10000008334 | 121 |
| 109 | 3300005617 | Ga0068859_100367347 | Ga0068859_1003673473 | 121 |
| 110 | 3300005617 | Ga0068859_101216626 | Ga0068859_1012166261 | 121 |
| 111 | 3300005618 | Ga0068864_100002317 | Ga0068864_10000231712 | 121 |
| 112 | 3300005618 | Ga0068864_100089637 | Ga0068864_1000896375 | 121 |
| 113 | 3300005618 | Ga0068864_100594760 | Ga0068864_1005947602 | 121 |
| 114 | 3300005718 | Ga0068866_10874106 | Ga0068866_108741062 | 121 |
| 115 | 3300005719 | Ga0068861_100004515 | Ga0068861_1000045157 | 121 |
| 116 | 3300005719 | Ga0068861_100542735 | Ga0068861_1005427352 | 121 |
| 117 | 3300005834 | Ga0068851_10001613 | Ga0068851_100016139 | 121 |
| 118 | 3300005834 | Ga0068851_10034061 | Ga0068851_100340611 | 121 |
| 119 | 3300005841 | Ga0068863_100001816 | Ga0068863_10000181619 | 121 |
| 120 | 3300005841 | Ga0068863_100002508 | Ga0068863_1000025086 | 121 |
| 121 | 3300005842 | Ga0068858_100005312 | Ga0068858_10000531210 | 121 |
| 122 | 3300005842 | Ga0068858_100017208 | Ga0068858_10001720810 | 121 |
| 123 | 3300005842 | Ga0068858_100097657 | Ga0068858_1000976572 | 121 |
| 124 | 3300005843 | Ga0068860_100002451 | Ga0068860_1000024515 | 121 |
| 125 | 3300005843 | Ga0068860_100006153 | Ga0068860_1000061535 | 121 |
| 126 | 3300005844 | Ga0068862_100040109 | Ga0068862_1000401095 | 121 |
| 127 | 3300005983 | Ga0081540_1010118 | Ga0081540_10101183 | 121 |
| 128 | 3300006195 | Ga0075366_10493456 | Ga0075366_104934562 | 121 |
| 129 | 3300006237 | Ga0097621_100000393 | Ga0097621_1000003935 | 121 |
| 130 | 3300006237 | Ga0097621_100387202 | Ga0097621_1003872022 | 121 |
| 131 | 3300006358 | Ga0068871_100019930 | Ga0068871_1000199302 | 121 |
| 132 | 3300006358 | Ga0068871_100292193 | Ga0068871_1002921932 | 121 |
| 133 | 3300006847 | Ga0075431_100278593 | Ga0075431_1002785932 | 121 |
| 134 | 3300006881 | Ga0068865_100001665 | Ga0068865_10000166515 | 121 |
| 135 | 3300006931 | Ga0097620_100000083 | Ga0097620_10000008334 | 121 |
| 136 | 3300006931 | Ga0097620_100367349 | Ga0097620_1003673493 | 121 |
| 137 | 3300006931 | Ga0097620_101216704 | Ga0097620_1012167041 | 121 |
| 138 | 3300009093 | Ga0105240_10012344 | Ga0105240_100123443 | 121 |
| 139 | 3300009093 | Ga0105240_10365656 | Ga0105240_103656562 | 121 |
| 140 | 3300009093 | Ga0105240_10458688 | Ga0105240_104586882 | 121 |
| 141 | 3300009093 | Ga0105240_11061460 | Ga0105240_110614601 | 121 |
| 142 | 3300009094 | Ga0111539_10199586 | Ga0111539_101995862 | 121 |
| 143 | 3300009098 | Ga0105245_10052404 | Ga0105245_100524045 | 121 |
| 144 | 3300009098 | Ga0105245_10159145 | Ga0105245_101591451 | 121 |
| 145 | 3300009098 | Ga0105245_11214138 | Ga0105245_112141381 | 121 |
| 146 | 3300009101 | Ga0105247_10009535 | Ga0105247_100095356 | 121 |
| 147 | 3300009101 | Ga0105247_10042667 | Ga0105247_100426674 | 121 |
| 148 | 3300009148 | Ga0105243_10650800 | Ga0105243_106508001 | 121 |
| 149 | 3300009174 | Ga0105241_10013985 | Ga0105241_100139855 | 121 |
| 150 | 3300009174 | Ga0105241_10375435 | Ga0105241_103754352 | 121 |
| 151 | 3300009176 | Ga0105242_10014804 | Ga0105242_100148045 | 121 |
| 152 | 3300009177 | Ga0105248_10373876 | Ga0105248_103738762 | 121 |
| 153 | 3300009545 | Ga0105237_10009157 | Ga0105237_1000915712 | 121 |
| 154 | 3300009545 | Ga0105237_10046277 | Ga0105237_100462774 | 121 |
| 155 | 3300009545 | Ga0105237_10821125 | Ga0105237_108211251 | 121 |
| 156 | 3300009551 | Ga0105238_10950071 | Ga0105238_109500711 | 121 |
| 157 | 3300009553 | Ga0105249_10006834 | Ga0105249_100068348 | 121 |
| 158 | 3300009553 | Ga0105249_10038863 | Ga0105249_100388634 | 121 |
| 159 | 3300009553 | Ga0105249_10202006 | Ga0105249_102020062 | 121 |
| 160 | 3300010375 | Ga0105239_10049235 | Ga0105239_100492354 | 121 |
| 161 | 3300010375 | Ga0105239_10091236 | Ga0105239_100912364 | 121 |
| 162 | 3300010375 | Ga0105239_10119777 | Ga0105239_101197774 | 121 |
| 163 | 3300011119 | Ga0105246_10002179 | Ga0105246_100021794 | 121 |
| 164 | 3300011119 | Ga0105246_10054486 | Ga0105246_100544863 | 121 |
| 165 | 3300013100 | Ga0157373_10093963 | Ga0157373_100939633 | 121 |
| 166 | 3300013100 | Ga0157373_10224382 | Ga0157373_102243822 | 121 |
| 167 | 3300013102 | Ga0157371_10347091 | Ga0157371_103470911 | 121 |
| 168 | 3300013102 | Ga0157371_10826852 | Ga0157371_108268522 | 121 |
| 169 | 3300013102 | Ga0157371_11450485 | Ga0157371_114504851 | 121 |
| 170 | 3300013104 | Ga0157370_10034585 | Ga0157370_100345853 | 121 |
| 171 | 3300013105 | Ga0157369_10086644 | Ga0157369_100866442 | 121 |
| 172 | 3300013105 | Ga0157369_11041195 | Ga0157369_110411951 | 121 |
| 173 | 3300013296 | Ga0157374_10001680 | Ga0157374_100016804 | 121 |
| 174 | 3300013296 | Ga0157374_10838946 | Ga0157374_108389462 | 121 |
| 175 | 3300013296 | Ga0157374_12811138 | Ga0157374_128111381 | 121 |
| 176 | 3300013297 | Ga0157378_10022959 | Ga0157378_100229592 | 121 |
| 177 | 3300013297 | Ga0157378_12778478 | Ga0157378_127784781 | 121 |
| 178 | 3300013306 | Ga0163162_10001349 | Ga0163162_100013495 | 121 |
| 179 | 3300013306 | Ga0163162_10001438 | Ga0163162_100014386 | 121 |
| 180 | 3300013306 | Ga0163162_10023631 | Ga0163162_100236312 | 121 |
| 181 | 3300013306 | Ga0163162_10296282 | Ga0163162_102962822 | 121 |
| 182 | 3300013306 | Ga0163162_11228761 | Ga0163162_112287612 | 121 |
| 183 | 3300013306 | Ga0163162_12778965 | Ga0163162_127789651 | 121 |
| 184 | 3300013307 | Ga0157372_10003268 | Ga0157372_1000326817 | 121 |
| 185 | 3300013307 | Ga0157372_10026537 | Ga0157372_100265378 | 121 |
| 186 | 3300013307 | Ga0157372_10804555 | Ga0157372_108045552 | 121 |
| 187 | 3300013307 | Ga0157372_11804638 | Ga0157372_118046381 | 121 |
| 188 | 3300013308 | Ga0157375_10001768 | Ga0157375_100017684 | 121 |
| 189 | 3300013308 | Ga0157375_10097261 | Ga0157375_100972614 | 121 |
| 190 | 3300013308 | Ga0157375_10920074 | Ga0157375_109200742 | 121 |
| 191 | 3300013308 | Ga0157375_13785043 | Ga0157375_137850431 | 121 |
| 192 | 3300014325 | Ga0163163_10001387 | Ga0163163_100013875 | 121 |
| 193 | 3300014325 | Ga0163163_11484495 | Ga0163163_114844952 | 121 |
| 194 | 3300014497 | Ga0182008_10032885 | Ga0182008_100328853 | 121 |
| 195 | 3300014968 | Ga0157379_10000812 | Ga0157379_100008126 | 121 |
| 196 | 3300014968 | Ga0157379_10035924 | Ga0157379_100359241 | 121 |
| 197 | 3300014969 | Ga0157376_10000939 | Ga0157376_1000093916 | 121 |
| 198 | 3300014969 | Ga0157376_10248566 | Ga0157376_102485662 | 121 |
| 199 | 3300014969 | Ga0157376_10430240 | Ga0157376_104302402 | 121 |
| 200 | 3300017792 | Ga0163161_10001125 | Ga0163161_100011256 | 121 |
| 201 | 3300017792 | Ga0163161_10001590 | Ga0163161_100015903 | 121 |
| 202 | 3300025272 | Ga0209455_1000882 | Ga0209455_100088215 | 121 |
| 203 | 3300025298 | Ga0209050_1009128 | Ga0209050_10091284 | 121 |
| 204 | 3300025315 | Ga0207697_10286650 | Ga0207697_102866502 | 121 |
| 205 | 3300025321 | Ga0207656_10020009 | Ga0207656_100200093 | 121 |
| 206 | 3300025321 | Ga0207656_10148995 | Ga0207656_101489952 | 121 |
| 207 | 3300025900 | Ga0207710_10021272 | Ga0207710_100212724 | 121 |
| 208 | 3300025900 | Ga0207710_10060049 | Ga0207710_100600494 | 121 |
| 209 | 3300025903 | Ga0207680_10000077 | Ga0207680_1000007721 | 121 |
| 210 | 3300025903 | Ga0207680_10000860 | Ga0207680_1000086010 | 121 |
| 211 | 3300025904 | Ga0207647_10119444 | Ga0207647_101194442 | 121 |
| 212 | 3300025907 | Ga0207645_10000332 | Ga0207645_1000033228 | 121 |
| 213 | 3300025909 | Ga0207705_10000937 | Ga0207705_100009376 | 121 |
| 214 | 3300025911 | Ga0207654_10008279 | Ga0207654_100082793 | 121 |
| 215 | 3300025912 | Ga0207707_10001291 | Ga0207707_1000129117 | 121 |
| 216 | 3300025912 | Ga0207707_10376632 | Ga0207707_103766323 | 121 |
| 217 | 3300025913 | Ga0207695_10054373 | Ga0207695_100543735 | 121 |
| 218 | 3300025913 | Ga0207695_10070884 | Ga0207695_100708842 | 121 |
| 219 | 3300025913 | Ga0207695_10213262 | Ga0207695_102132622 | 121 |
| 220 | 3300025913 | Ga0207695_10606594 | Ga0207695_106065942 | 121 |
| 221 | 3300025914 | Ga0207671_10001576 | Ga0207671_1000157626 | 121 |
| 222 | 3300025914 | Ga0207671_10194528 | Ga0207671_101945283 | 121 |
| 223 | 3300025914 | Ga0207671_10358029 | Ga0207671_103580291 | 121 |
| 224 | 3300025917 | Ga0207660_10011999 | Ga0207660_100119995 | 121 |
| 225 | 3300025917 | Ga0207660_10211629 | Ga0207660_102116292 | 121 |
| 226 | 3300025920 | Ga0207649_10776014 | Ga0207649_107760141 | 121 |
| 227 | 3300025921 | Ga0207652_10010964 | Ga0207652_100109644 | 121 |
| 228 | 3300025927 | Ga0207687_10396284 | Ga0207687_103962842 | 121 |
| 229 | 3300025931 | Ga0207644_10314380 | Ga0207644_103143802 | 121 |
| 230 | 3300025933 | Ga0207706_10004763 | Ga0207706_1000476310 | 121 |
| 231 | 3300025934 | Ga0207686_10012027 | Ga0207686_100120275 | 121 |
| 232 | 3300025935 | Ga0207709_10122292 | Ga0207709_101222923 | 121 |
| 233 | 3300025935 | Ga0207709_10217532 | Ga0207709_102175322 | 121 |
| 234 | 3300025935 | Ga0207709_10334825 | Ga0207709_103348252 | 121 |
| 235 | 3300025936 | Ga0207670_10251639 | Ga0207670_102516391 | 121 |
| 236 | 3300025938 | Ga0207704_10000639 | Ga0207704_100006394 | 121 |
| 237 | 3300025940 | Ga0207691_10000164 | Ga0207691_1000016428 | 121 |
| 238 | 3300025940 | Ga0207691_10011633 | Ga0207691_100116339 | 121 |
| 239 | 3300025941 | Ga0207711_10698694 | Ga0207711_106986941 | 121 |
| 240 | 3300025942 | Ga0207689_10002044 | Ga0207689_1000204418 | 121 |
| 241 | 3300025942 | Ga0207689_10143863 | Ga0207689_101438632 | 121 |
| 242 | 3300025944 | Ga0207661_10506511 | Ga0207661_105065112 | 121 |
| 243 | 3300025949 | Ga0207667_10028557 | Ga0207667_100285574 | 121 |
| 244 | 3300025949 | Ga0207667_10040505 | Ga0207667_100405056 | 121 |
| 245 | 3300025949 | Ga0207667_10270072 | Ga0207667_102700722 | 121 |
| 246 | 3300025960 | Ga0207651_10000648 | Ga0207651_100006486 | 121 |
| 247 | 3300025961 | Ga0207712_10015037 | Ga0207712_100150372 | 121 |
| 248 | 3300025961 | Ga0207712_10077612 | Ga0207712_100776122 | 121 |
| 249 | 3300025972 | Ga0207668_10000264 | Ga0207668_1000026421 | 121 |
| 250 | 3300025972 | Ga0207668_10348360 | Ga0207668_103483602 | 121 |
| 251 | 3300025986 | Ga0207658_10000445 | Ga0207658_1000044510 | 121 |
| 252 | 3300026023 | Ga0207677_10000570 | Ga0207677_100005704 | 121 |
| 253 | 3300026035 | Ga0207703_10002150 | Ga0207703_100021505 | 121 |
| 254 | 3300026035 | Ga0207703_10003481 | Ga0207703_100034812 | 121 |
| 255 | 3300026041 | Ga0207639_10008026 | Ga0207639_100080267 | 121 |
| 256 | 3300026075 | Ga0207708_11491594 | Ga0207708_114915941 | 121 |
| 257 | 3300026088 | Ga0207641_10000975 | Ga0207641_100009754 | 121 |
| 258 | 3300026088 | Ga0207641_10100982 | Ga0207641_101009823 | 121 |
| 259 | 3300026089 | Ga0207648_10007045 | Ga0207648_1000704513 | 121 |
| 260 | 3300026095 | Ga0207676_10004877 | Ga0207676_100048777 | 121 |
| 261 | 3300026095 | Ga0207676_10120405 | Ga0207676_101204051 | 121 |
| 262 | 3300026116 | Ga0207674_10419469 | Ga0207674_104194691 | 121 |
| 263 | 3300026116 | Ga0207674_10862187 | Ga0207674_108621871 | 121 |
| 264 | 3300026118 | Ga0207675_100008996 | Ga0207675_1000089967 | 121 |
| 265 | 3300026118 | Ga0207675_100429072 | Ga0207675_1004290724 | 121 |
| 266 | 3300026121 | Ga0207683_10096416 | Ga0207683_100964162 | 121 |
| 267 | 3300026142 | Ga0207698_10176557 | Ga0207698_101765573 | 121 |
| 268 | 3300026142 | Ga0207698_10273693 | Ga0207698_102736932 | 121 |
| 269 | 3300026142 | Ga0207698_10808386 | Ga0207698_108083862 | 121 |
| 270 | 3300028379 | Ga0268266_10001035 | Ga0268266_1000103532 | 121 |
| 271 | 3300028380 | Ga0268265_10266309 | Ga0268265_102663092 | 121 |
| 272 | 3300028380 | Ga0268265_10806397 | Ga0268265_108063971 | 121 |
| 273 | 3300028381 | Ga0268264_10000159 | Ga0268264_1000015917 | 121 |
| 274 | 3300028381 | Ga0268264_10000982 | Ga0268264_1000098218 | 121 |
| 275 | 3300028381 | Ga0268264_10010764 | Ga0268264_100107646 | 121 |
| 276 | 3300031251 | Ga0265327_10011262 | Ga0265327_100112626 | 121 |
| 277 | 3300031251 | Ga0265327_10015024 | Ga0265327_100150241 | 121 |
| 278 | 3300031456 | Ga0307513_10192051 | Ga0307513_101920512 | 121 |
| 279 | 3300031507 | Ga0307509_10227622 | Ga0307509_102276221 | 121 |
| 280 | 3300031901 | Ga0307406_10222033 | Ga0307406_102220332 | 121 |
| 281 | 3300035088 | Ga0373940_0307131 | Ga0373940_0307131_144_509 | 121 |
| 282 | 3300035695 | Ga0373927_0059974 | Ga0373927_0059974_712_1077 | 121 |
| 283 | 3300041486 | Ga0451807_2518234 | Ga0451807_2518234_348_713 | 121 |
| 284 | 3300041512 | Ga0451853_1120257 | Ga0451853_1120257_879_1244 | 121 |
| 285 | 3300042876 | Ga0451577_0147617 | Ga0451577_0147617_390_755 | 121 |
| 286 | 3300042876 | Ga0451577_0208473 | Ga0451577_0208473_971_1336 | 121 |
| 287 | 3300042876 | Ga0451577_1962430 | Ga0451577_1962430_133_498 | 121 |
| 288 | 3300044673 | Ga0453683_0295121 | Ga0453683_0295121_355_720 | 121 |
| 289 | 3300044673 | Ga0453683_0599666 | Ga0453683_0599666_29_394 | 121 |
| 290 | 3300044693 | Ga0466961_0536783 | Ga0466961_0536783_135_500 | 121 |
| 291 | 3300044712 | Ga0453684_0000920 | Ga0453684_0000920_75975_76340 | 121 |
| 292 | 3300044712 | Ga0453684_0087226 | Ga0453684_0087226_1901_2266 | 121 |
| 293 | 3300044712 | Ga0453684_0367015 | Ga0453684_0367015_366_731 | 121 |
| 294 | 3300044712 | Ga0453684_0877708 | Ga0453684_0877708_369_734 | 121 |
| 295 | 3300044712 | Ga0453684_1621230 | Ga0453684_1621230_66_431 | 121 |
| 296 | 3300045051 | Ga0451576_0705126 | Ga0451576_0705126_235_600 | 121 |
| 297 | 3300046454 | Ga0495592_0306469 | Ga0495592_0306469_647_1012 | 121 |
| 298 | 3300046460 | Ga0495638_0000020 | Ga0495638_0000020_305573_305938 | 121 |
| 299 | 3300046522 | Ga0495643_0126879 | Ga0495643_0126879_378_743 | 121 |
| 300 | 3300046524 | Ga0495648_0028894 | Ga0495648_0028894_1082_1447 | 121 |
| 301 | 3300046529 | Ga0495652_0132753 | Ga0495652_0132753_162_527 | 121 |
| 302 | 3300047320 | Ga0495672_0067674 | Ga0495672_0067674_1354_1719 | 121 |
| 303 | 3300048912 | Ga0496109_0054155 | Ga0496109_0054155_2200_2565 | 121 |
| 304 | 3300049571 | Ga0501034_1253691 | Ga0501034_1253691_229_594 | 121 |
| 305 | 3300049571 | Ga0501034_1348382 | Ga0501034_1348382_47_412 | 121 |
| 306 | 3300049667 | Ga0501230_087596 | Ga0501230_087596_270_635 | 121 |
| 307 | 3300049686 | Ga0501257_049000 | Ga0501257_049000_615_980 | 121 |
| 308 | 3300049758 | Ga0501241_006266 | Ga0501241_006266_743_1108 | 121 |
| 309 | 3300050509 | nmdc:mga0qj67_162119_c1 | nmdc:mga0qj67_162119_c1_590_955 | 121 |
| 310 | 3300050510 | nmdc:mga06r32_271829_c1 | nmdc:mga06r32_271829_c1_828_1193 | 121 |
| 311 | 3300053088 | Ga0500644_0129514 | Ga0500644_0129514_309_674 | 121 |
| 312 | 3300053092 | Ga0500583_0001253 | Ga0500583_0001253_6202_6567 | 121 |
| 313 | 3300053104 | Ga0500556_0361446 | Ga0500556_0361446_179_544 | 121 |
| 314 | 3300053130 | Ga0500642_0052801 | Ga0500642_0052801_993_1358 | 121 |
| 315 | 3300053133 | Ga0500655_025237 | Ga0500655_025237_248_613 | 121 |
| 316 | 3300053139 | Ga0500568_0068203 | Ga0500568_0068203_213_578 | 121 |
| 317 | 3300053146 | Ga0500588_0071346 | Ga0500588_0071346_398_763 | 121 |
| 318 | 3300053156 | Ga0500622_0002806 | Ga0500622_0002806_8669_9034 | 121 |
| 319 | 3300061719 | Ga0466962_0118421 | Ga0466962_0118421_879_1244 | 121 |
| 320 | 3300002741 | JGI25157J39369_1006390 | JGI25157J39369_10063902 | 122 |
| 321 | 3300003323 | rootH1_10168635 | rootH1_101686352 | 122 |
| 322 | 3300005335 | Ga0070666_10104576 | Ga0070666_101045762 | 122 |
| 323 | 3300005459 | Ga0068867_100569126 | Ga0068867_1005691262 | 122 |
| 324 | 3300005539 | Ga0068853_100478992 | Ga0068853_1004789921 | 122 |
| 325 | 3300005617 | Ga0068859_100301985 | Ga0068859_1003019853 | 122 |
| 326 | 3300006931 | Ga0097620_100302007 | Ga0097620_1003020073 | 122 |
| 327 | 3300009147 | Ga0114129_10082294 | Ga0114129_100822943 | 122 |
| 328 | 3300025246 | Ga0209646_1000006 | Ga0209646_1000006140 | 122 |
| 329 | 3300025250 | Ga0209026_1000185 | Ga0209026_100018523 | 122 |
| 330 | 3300028794 | Ga0307515_10000003 | Ga0307515_10000003260 | 122 |
| 331 | 3300031649 | Ga0307514_10186378 | Ga0307514_101863782 | 122 |
| 332 | 3300053156 | Ga0500622_0006047 | Ga0500622_0006047_3788_4162 | 122 |
| 333 | 3300053732 | Ga0500656_024083 | Ga0500656_024083_74_448 | 122 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3c9p-assembly1.cif.gz_A | crystal structure of uncharacterized protein sp1917 | 0.9356 | 9 | 119 |
| 5cd4-assembly2.cif.gz_P | the type ie crispr cascade complex from e. coli, with two assemblies in the asymmetric unit arranged back-to-back | 0.3623 | 7 | 119 |
| 6p0d-assembly1.cif.gz_A | human dna ligase 1 (e346a/e592a) bound to an adenylated, hydroxyl terminated dna nick | 0.361 | 30 | 119 |
| 4tvx-assembly1.cif.gz_P | crystal structure of the e. coli crispr rna-guided surveillance complex, cascade | 0.3605 | 7 | 119 |
| 4tvx-assembly1.cif.gz_O | crystal structure of the e. coli crispr rna-guided surveillance complex, cascade | 0.3356 | 3 | 119 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3c9pA00 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;uncharacterized protein sp1917 domain | 0.9226 | 9 | 119 | 1.10.8.290 |
| 3c9pA00 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;uncharacterized protein sp1917 domain | 0.8496 | 9 | 119 | 1.10.8.290 |
| af_Q2FWE1_2_83_1.10.8.10 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain | 0.7529 | 14 | 122 | 1.10.8.10 |
| af_P9WHV3_1_82_1.10.8.10 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain | 0.7383 | 14 | 122 | 1.10.8.10 |
| af_P0ACC1_1_83_1.10.8.10 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain | 0.7219 | 14 | 122 | 1.10.8.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4T0V573-F1-model_v4 | DUF2200 domain-containing protein | 1.001 | 10 | 120 |
|
| AF-A0A512HVD9-F1-model_v4 | DUF2200 domain-containing protein | 1.001 | 14 | 120 |
|
| AF-I4B552-F1-model_v4 | YdhG-like domain-containing protein | 0.9999 | 7 | 120 |
|
| AF-A0A4Q7M3Q8-F1-model_v4 | DUF2200 domain-containing protein | 0.9994 | 8 | 120 |
|
| AF-A0A1E8ZN79-F1-model_v4 | deleted | 0.9977 | 10 | 120 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar