F411169

General Info

Members Datasets Scaffolds Average Seq Length
332 228 664 139

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2954701450|2954707363
Length 155
Sequence PDDIKVGETRESVLVDDLKRTRIVQYAGASGDFNPLHTDERFAVEAAGYPGVFAHGMLTMGMTGRVLTDWVGTEALLRYGVRFKAQVWPGDTLTATVTVESIEDTPTGPVAHFTLRTVNQDGAEVVTGTRGGPPGALSRWPPRRKACRRPPGPPW

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
62 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
88 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
89 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
90 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
91 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
92 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
93 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
94 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
95 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
98 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
99 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
105 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
106 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
107 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
108 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
109 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
110 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
111 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
112 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
113 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
114 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
115 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
116 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
117 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
118 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
119 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
120 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
121 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
122 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
123 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
126 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
127 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
128 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
129 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
130 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
131 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
132 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
133 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
134 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
135 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
136 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
137 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
138 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
139 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
140 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
141 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
142 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
145 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
146 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
157 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
158 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
159 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
160 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
161 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
162 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
163 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
164 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
184 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
185 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
186 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
187 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
192 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
195 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
199 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
200 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
201 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
202 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
203 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
204 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
205 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
206 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
207 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
208 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
209 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
210 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
211 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
212 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
213 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
214 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
215 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
216 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
217 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
219 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
220 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
221 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
222 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
223 2643221647 Streptomyces sp. Root369 Isolate Unclassified
224 2643221714 Streptomyces sp. Root264 Isolate Unclassified
225 2671180195 Frankia sp. CcI49 Isolate Nodule
226 2773857922 Frankia sp. CcI49 Isolate Nodule
227 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
228 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.69
Metatranscriptomes 0.6
Isolates 2.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.73
Nodule 1.2
Rhizoplane 5.42
Rhizosphere 74.4
Stem 0
Stem Tuber 0
Unclassified 3.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10008986 3300003203 Bacteria 4493
2 JGI25407J50210_10001592 3300003373 Bacteria 5177
3 JGI25407J50210_10055861 3300003373 Unclassified 996
4 Ga0070690_100692006 3300005330 Bacteria 782
5 Ga0070680_100740999 3300005336 Bacteria 846
6 Ga0070682_100244860 3300005337 Unclassified 1289
7 Ga0070660_100163950 3300005339 Bacteria 1792
8 Ga0070714_100847786 3300005435 Bacteria 886
9 Ga0070700_101831029 3300005441 Bacteria 523
10 Ga0070708_100337454 3300005445 Unclassified 1420
11 Ga0070662_101141045 3300005457 Bacteria 669
12 Ga0070681_10705401 3300005458 Bacteria 925
13 Ga0070698_101131998 3300005471 Bacteria 731
14 Ga0068853_100941816 3300005539 Bacteria 830
15 Ga0070672_100538524 3300005543 Bacteria 1013
16 Ga0070696_101016784 3300005546 Bacteria 693
17 Ga0068855_100013728 3300005563 Bacteria 9765
18 Ga0068855_100061218 3300005563 Bacteria 4398
19 Ga0068857_100834816 3300005577 Bacteria 881
20 Ga0068856_100152538 3300005614 Bacteria 2320
21 Ga0068856_100259949 3300005614 Bacteria 1751
22 Ga0068856_101727392 3300005614 Bacteria 638
23 Ga0068852_100634573 3300005616 Unclassified 1075
24 Ga0068852_101297512 3300005616 Bacteria 750
25 Ga0068859_100003518 3300005617 Bacteria 15946
26 Ga0068859_100198952 3300005617 Bacteria 2088
27 Ga0068858_100007140 3300005842 Bacteria 10847
28 Ga0068858_100766136 3300005842 Bacteria 941
29 Ga0068860_100015653 3300005843 Bacteria 7405
30 Ga0068862_100000517 3300005844 Bacteria 40807
31 Ga0081455_10000732 3300005937 Bacteria 42630
32 Ga0081538_10001413 3300005981 Bacteria 24685
33 Ga0081538_10009938 3300005981 Bacteria 7862
34 Ga0081540_1066759 3300005983 Bacteria 1683
35 Ga0081539_10005830 3300005985 Bacteria 12233
36 Ga0081539_10007916 3300005985 Bacteria 9467
37 Ga0081539_10080503 3300005985 Bacteria 1713
38 Ga0075365_10132272 3300006038 Bacteria 1727
39 Ga0075368_10006886 3300006042 Bacteria 3996
40 Ga0075368_10568357 3300006042 Bacteria 511
41 Ga0075363_100365163 3300006048 Bacteria 845
42 Ga0075367_10014955 3300006178 Bacteria 4206
43 Ga0075367_10353868 3300006178 Bacteria 927
44 Ga0075370_10232577 3300006353 Bacteria 1091
45 Ga0075428_100055620 3300006844 Bacteria 4335
46 Ga0075430_100095412 3300006846 Bacteria 2486
47 Ga0075431_100110614 3300006847 Bacteria 2835
48 Ga0075431_101054042 3300006847 Bacteria 779
49 Ga0075433_10096151 3300006852 Bacteria 2621
50 Ga0075433_10633610 3300006852 Bacteria 938
51 Ga0075429_100581714 3300006880 Unclassified 981
52 Ga0068865_100711265 3300006881 Bacteria 859
53 Ga0097620_100003518 3300006931 Bacteria 15946
54 Ga0097620_100198946 3300006931 Bacteria 2088
55 Ga0075435_100458478 3300007076 Bacteria 1100
56 Ga0105240_10006202 3300009093 Bacteria 17597
57 Ga0105240_10082706 3300009093 Bacteria 3942
58 Ga0105240_10668602 3300009093 Bacteria 1137
59 Ga0105245_10634478 3300009098 Bacteria 1097
60 Ga0105247_10000224 3300009101 Bacteria 54257
61 Ga0105247_10008369 3300009101 Bacteria 6306
62 Ga0105247_10397914 3300009101 Bacteria 981
63 Ga0114129_10216079 3300009147 Bacteria 2589
64 Ga0105243_11691347 3300009148 Bacteria 661
65 Ga0105241_10126321 3300009174 Bacteria 2066
66 Ga0105248_10001521 3300009177 Bacteria 25803
67 Ga0105248_10002282 3300009177 Bacteria 21224
68 Ga0105248_12037484 3300009177 Bacteria 652
69 Ga0105237_10035151 3300009545 Bacteria 5072
70 Ga0105237_10200970 3300009545 Bacteria 1993
71 Ga0105238_10613927 3300009551 Bacteria 1096
72 Ga0105238_10833710 3300009551 Bacteria 939
73 Ga0105238_11604940 3300009551 Bacteria 680
74 Ga0105249_10016246 3300009553 Bacteria 6601
75 Ga0105249_11429680 3300009553 Bacteria 764
76 Ga0105239_10075828 3300010375 Bacteria 3698
77 Ga0105239_10270824 3300010375 Bacteria 1910
78 Ga0105239_10276087 3300010375 Bacteria 1891
79 Ga0105239_11863541 3300010375 Unclassified 697
80 Ga0105239_12658978 3300010375 Bacteria 584
81 Ga0105246_10223834 3300011119 Bacteria 1476
82 Ga0157370_11660113 3300013104 Bacteria 574
83 Ga0157369_10089831 3300013105 Bacteria 3280
84 Ga0157369_11377253 3300013105 Bacteria 718
85 Ga0157375_10132768 3300013308 Bacteria 2611
86 Ga0163163_10003533 3300014325 Bacteria 13281
87 Ga0163163_10026940 3300014325 Bacteria 5499
88 Ga0157377_10490014 3300014745 Bacteria 857
89 Ga0157379_10008972 3300014968 Bacteria 8715
90 Ga0206356_10641644 3300020070 Bacteria 1471
91 Ga0206353_10718145 3300020082 Bacteria 694
92 Ga0213875_10031774 3300021388 Bacteria 2496
93 Ga0213875_10175381 3300021388 Unclassified 1007
94 Ga0207710_10000008 3300025900 Bacteria 485312
95 Ga0207710_10000065 3300025900 Bacteria 154842
96 Ga0207647_10045148 3300025904 Bacteria 2750
97 Ga0207647_10091359 3300025904 Bacteria 1815
98 Ga0207654_10082996 3300025911 Bacteria 1934
99 Ga0207695_10004000 3300025913 Bacteria 20321
100 Ga0207695_10086174 3300025913 Bacteria 3169
101 Ga0207695_10708890 3300025913 Bacteria 887
102 Ga0207671_10061844 3300025914 Bacteria 2779
103 Ga0207671_10615019 3300025914 Bacteria 866
104 Ga0207660_10730704 3300025917 Bacteria 808
105 Ga0207694_10095611 3300025924 Bacteria 2349
106 Ga0207694_10287531 3300025924 Bacteria 1351
107 Ga0207694_11097567 3300025924 Bacteria 673
108 Ga0207664_10276403 3300025929 Bacteria 1473
109 Ga0207664_10323017 3300025929 Bacteria 1362
110 Ga0207664_10465109 3300025929 Bacteria 1130
111 Ga0207664_10720951 3300025929 Bacteria 897
112 Ga0207709_11566191 3300025935 Bacteria 547
113 Ga0207669_11191966 3300025937 Bacteria 645
114 Ga0207691_10612954 3300025940 Bacteria 921
115 Ga0207711_10000329 3300025941 Bacteria 50547
116 Ga0207711_11182651 3300025941 Bacteria 706
117 Ga0207667_10003569 3300025949 Bacteria 19224
118 Ga0207667_10165386 3300025949 Bacteria 2274
119 Ga0207667_10478222 3300025949 Unclassified 1265
120 Ga0207712_10014388 3300025961 Bacteria 5089
121 Ga0207658_10411304 3300025986 Bacteria 1191
122 Ga0207703_10000280 3300026035 Bacteria 56569
123 Ga0207703_10060258 3300026035 Bacteria 3103
124 Ga0207639_10234963 3300026041 Bacteria 1591
125 Ga0207639_10437971 3300026041 Bacteria 1184
126 Ga0207678_10323959 3300026067 Bacteria 1326
127 Ga0207708_11006301 3300026075 Bacteria 724
128 Ga0207702_10114032 3300026078 Bacteria 2408
129 Ga0207702_10276707 3300026078 Bacteria 1585
130 Ga0207702_11636352 3300026078 Bacteria 637
131 Ga0207641_11575109 3300026088 Bacteria 659
132 Ga0209813_10017563 3300027866 Bacteria 1965
133 Ga0268266_10243691 3300028379 Bacteria 1660
134 Ga0268265_10001402 3300028380 Bacteria 20422
135 Ga0268264_10053249 3300028381 Bacteria 3376
136 Ga0307517_10014950 3300028786 Bacteria 10360
137 Ga0307515_10094036 3300028794 Bacteria 3708
138 Ga0307515_10160026 3300028794 Bacteria 2302
139 Ga0307511_10080159 3300030521 Bacteria 2302
140 Ga0307513_10009846 3300031456 Bacteria 12069
141 Ga0307513_10080487 3300031456 Bacteria 3360
142 Ga0307509_10156028 3300031507 Bacteria 2189
143 Ga0307508_10079762 3300031616 Bacteria 2854
144 Ga0307514_10004554 3300031649 Bacteria 12733
145 Ga0307514_10433017 3300031649 Bacteria 655
146 Ga0307516_10219733 3300031730 Bacteria 1610
147 Ga0307516_10234706 3300031730 Bacteria 1536
148 Ga0307518_10112580 3300031838 Bacteria 1937
149 Ga0307415_101460211 3300032126 Bacteria 653
150 Ga0307510_10000524 3300033180 Bacteria 38226
151 Ga0373952_0224669 3300035092 Bacteria 559
152 Ga0373931_0086549 3300035691 Bacteria 1739
153 Ga0373931_0168378 3300035691 Bacteria 1289
154 Ga0395898_0257914 3300037466 Bacteria 1663
155 Ga0395898_1118328 3300037466 Bacteria 721
156 Ga0395905_1232958 3300037471 Bacteria 652
157 Ga0436364_0330134 3300037853 Bacteria 7501
158 Ga0436364_0428250 3300037853 Bacteria 2246
159 Ga0395901_1009250 3300038443 Bacteria 808
160 Ga0451853_1745357 3300041512 Bacteria 5912
161 Ga0451853_2864261 3300041512 Bacteria 790
162 Ga0451853_3100441 3300041512 Bacteria 6908
163 Ga0451853_3887997 3300041512 Bacteria 603
164 Ga0439448_0028262 3300042005 Bacteria 1770
165 Ga0439450_001409 3300042008 Bacteria 3510
166 Ga0439454_003876 3300042011 Bacteria 1693
167 Ga0439463_014998 3300042016 Bacteria 1914
168 Ga0439464_0007905 3300042439 Bacteria 2785
169 Ga0439460_0004549 3300042461 Bacteria 3384
170 Ga0439440_0001872 3300042993 Bacteria 3901
171 Ga0466969_0005848 3300044656 Bacteria 6537
172 Ga0466965_0002452 3300044683 Bacteria 7879
173 Ga0466965_0027673 3300044683 Bacteria 2753
174 Ga0466966_0001238 3300044684 Bacteria 16360
175 Ga0466966_0146666 3300044684 Bacteria 1440
176 Ga0466966_0663799 3300044684 Bacteria 628
177 Ga0466961_0000516 3300044693 Bacteria 24570
178 Ga0466961_0033673 3300044693 Bacteria 3291
179 Ga0466961_0119405 3300044693 Bacteria 1656
180 Ga0466963_0001605 3300044694 Bacteria 12298
181 Ga0466963_0199849 3300044694 Bacteria 1398
182 Ga0466963_0295332 3300044694 Bacteria 1139
183 Ga0466964_0050004 3300044706 Bacteria 1713
184 Ga0466964_0074857 3300044706 Bacteria 1440
185 Ga0466971_0000816 3300044719 Bacteria 12573
186 Ga0466971_0002475 3300044719 Bacteria 7803
187 Ga0466971_0186944 3300044719 Bacteria 975
188 Ga0466970_0000312 3300044765 Bacteria 23664
189 Ga0466957_0001088 3300044842 Bacteria 14024
190 Ga0466957_0112339 3300044842 Bacteria 1729
191 Ga0466960_0475875 3300044901 Bacteria 729
192 Ga0466959_0000567 3300045049 Bacteria 21529
193 Ga0466959_0049562 3300045049 Bacteria 3085
194 Ga0466958_0000357 3300045836 Bacteria 18437
195 Ga0466958_0006599 3300045836 Bacteria 6327
196 Ga0466967_0059532 3300045976 Bacteria 3381
197 Ga0466967_0122384 3300045976 Bacteria 2406
198 Ga0466967_0378974 3300045976 Bacteria 1373
199 Ga0466967_0629531 3300045976 Bacteria 1060
200 Ga0495627_015115 3300046453 Bacteria 2672
201 Ga0495603_0626986 3300046455 Bacteria 615
202 Ga0495638_0137818 3300046460 Bacteria 1427
203 Ga0495607_0128186 3300046501 Bacteria 1324
204 Ga0495628_0001147 3300046516 Bacteria 24158
205 Ga0495632_0048207 3300046519 Bacteria 2110
206 Ga0495643_0042017 3300046522 Bacteria 2491
207 Ga0495644_0388932 3300046523 Bacteria 551
208 Ga0495645_0011884 3300046543 Bacteria 6136
209 Ga0495633_0299921 3300046558 Bacteria 730
210 Ga0495656_0431213 3300046615 Bacteria 693
211 Ga0495668_0234601 3300046616 Bacteria 1005
212 Ga0495625_0368020 3300046660 Bacteria 905
213 Ga0495599_0029355 3300046678 Bacteria 3448
214 Ga0495646_0110722 3300046680 Bacteria 1564
215 Ga0495649_0345159 3300046694 Bacteria 753
216 Ga0495660_0027323 3300046810 Bacteria 3230
217 Ga0495636_0350515 3300047318 Bacteria 697
218 Ga0495674_0081064 3300047319 Bacteria 2784
219 Ga0495687_007552 3300047443 Bacteria 6382
220 Ga0495685_002473 3300047447 Bacteria 5789
221 Ga0495685_014616 3300047447 Bacteria 2669
222 Ga0495681_0017849 3300047470 Bacteria 3928
223 Ga0496101_0724832 3300048904 Bacteria 785
224 Ga0496101_1167164 3300048904 Bacteria 604
225 Ga0496103_0077243 3300048906 Bacteria 2090
226 Ga0496103_0808512 3300048906 Bacteria 591
227 Ga0496104_0123537 3300048907 Bacteria 2485
228 Ga0496108_0088671 3300048911 Bacteria 2629
229 Ga0496109_0153213 3300048912 Bacteria 2159
230 Ga0496109_1400119 3300048912 Bacteria 635
231 Ga0496110_0014565 3300048913 Bacteria 6534
232 Ga0496110_0296410 3300048913 Bacteria 1473
233 Ga0496110_0302342 3300048913 Bacteria 1457
234 Ga0496110_0483302 3300048913 Bacteria 1128
235 Ga0496111_0112258 3300048914 Bacteria 2008
236 Ga0496111_1112267 3300048914 Bacteria 563
237 Ga0496114_0089314 3300048917 Bacteria 2615
238 Ga0496114_0467348 3300048917 Bacteria 1116
239 Ga0496114_1075335 3300048917 Bacteria 689
240 Ga0496115_0169518 3300048918 Bacteria 1805
241 Ga0496116_0002289 3300048919 Bacteria 20317
242 Ga0496117_0142399 3300048920 Bacteria 1433
243 Ga0496118_0358779 3300048921 Bacteria 773
244 Ga0496119_0002099 3300048922 Bacteria 22482
245 Ga0496120_0001007 3300048923 Bacteria 37893
246 Ga0496120_0121352 3300048923 Bacteria 1351
247 Ga0496121_0036827 3300048924 Bacteria 4354
248 Ga0496125_0021440 3300048928 Bacteria 6027
249 Ga0496126_0000037 3300048929 Bacteria 353425
250 Ga0496126_0609389 3300048929 Bacteria 859
251 Ga0501032_0106024 3300049569 Bacteria 1862
252 Ga0501033_0920725 3300049570 Archaea 587
253 Ga0501036_0273680 3300049572 Bacteria 1413
254 Ga0501036_1129147 3300049572 Bacteria 640
255 Ga0501037_0582936 3300049573 Bacteria 752
256 Ga0501038_0859484 3300049574 Bacteria 671
257 Ga0501039_0098354 3300049575 Bacteria 2283
258 Ga0501040_0006140 3300049576 Bacteria 7792
259 Ga0501040_0256801 3300049576 Bacteria 1247
260 Ga0501041_0011428 3300049577 Bacteria 5246
261 Ga0501041_0078424 3300049577 Bacteria 2033
262 Ga0501042_0051154 3300049578 Bacteria 2947
263 Ga0501043_0229329 3300049579 Bacteria 1435
264 Ga0501043_0537310 3300049579 Bacteria 870
265 Ga0501046_0000096 3300049580 Bacteria 94786
266 Ga0501046_0029824 3300049580 Bacteria 4432
267 Ga0501047_0005312 3300049581 Bacteria 12101
268 Ga0501048_0120805 3300049582 Bacteria 1851
269 Ga0501068_0200734 3300049584 Bacteria 1265
270 Ga0501070_1339153 3300049586 Bacteria 546
271 Ga0501071_0178237 3300049587 Bacteria 1592
272 Ga0501072_0220262 3300049588 Bacteria 1512
273 Ga0501072_0666619 3300049588 Bacteria 818
274 Ga0501073_0457795 3300049589 Bacteria 882
275 Ga0501074_0225157 3300049590 Bacteria 1335
276 Ga0501075_0002729 3300049591 Bacteria 11818
277 Ga0501076_0022730 3300049592 Bacteria 4822
278 Ga0501076_0279657 3300049592 Bacteria 1367
279 Ga0501077_0182491 3300049593 Bacteria 1333
280 Ga0501077_0371221 3300049593 Bacteria 914
281 Ga0501079_0014160 3300049741 Bacteria 6079
282 Ga0501079_0014960 3300049741 Bacteria 5915
283 Ga0501079_0504814 3300049741 Bacteria 951
284 Ga0501081_0021269 3300049743 Bacteria 4330
285 Ga0501035_0002380 3300049822 Bacteria 18477
286 Ga0501044_0008356 3300049823 Bacteria 11349
287 Ga0501044_0111428 3300049823 Bacteria 2744
288 Ga0501045_0068020 3300049824 Bacteria 2616
289 nmdc:mga06z11_29104_c1 3300050494 Bacteria 2657
290 nmdc:mga04h51_38888_c1 3300050495 Bacteria 1543
291 nmdc:mga05p37_310684_c1 3300050507 Bacteria 1868
292 nmdc:mga09592_383341_c1 3300050508 Bacteria 1215
293 nmdc:mga0qj67_488976_c1 3300050509 Unclassified 990
294 nmdc:mga0n895_1087592_c1 3300050512 Bacteria 777
295 nmdc:mga0n895_28937_c1 3300050512 Bacteria 5277
296 nmdc:mga0a205_217492_c1 3300050515 Bacteria 1797
297 Ga0500578_0116870 3300053086 Bacteria 1678
298 Ga0500644_0028292 3300053088 Bacteria 1752
299 Ga0500583_0470606 3300053092 Bacteria 594
300 Ga0500654_060953 3300053099 Bacteria 1932
301 Ga0500558_151991 3300053106 Bacteria 859
302 Ga0500560_012710 3300053107 Bacteria 2192
303 Ga0500569_001446 3300053109 Bacteria 4488
304 Ga0500628_013149 3300053129 Bacteria 1540
305 Ga0500658_0006064 3300053134 Bacteria 4493
306 Ga0500561_0039883 3300053137 Bacteria 1234
307 Ga0500573_0029414 3300053140 Bacteria 3166
308 Ga0500579_258991 3300053143 Bacteria 555
309 Ga0500600_0081084 3300053149 Bacteria 1754
310 Ga0500616_0114338 3300053153 Bacteria 1298
311 Ga0500633_0047703 3300053160 Bacteria 1466
312 Ga0500634_0028990 3300053161 Bacteria 3016
313 Ga0500636_0144545 3300053177 Bacteria 1313
314 Ga0500656_002366 3300053732 Bacteria 1703
315 Ga0500587_004707 3300053739 Bacteria 1863
316 Ga0501084_0019553 3300054114 Bacteria 5643
317 Ga0501084_0512830 3300054114 Bacteria 1014
318 Ga0501082_0074834 3300060353 Bacteria 2917
319 Ga0466962_0000459 3300061719 Bacteria 17670
320 Ga0466962_0010850 3300061719 Bacteria 4381
321 Ga0466962_0019642 3300061719 Bacteria 3247
322 Ga0530510_0038347 3300061734 Bacteria 3460
323 Ga0530510_0562318 3300061734 Unclassified 866
324 2954707363 2954701450 Bacteria 10834262
325 2585309560 2582581313 Bacteria 10042643
326 2644266540 2643221647 Bacteria 10741251
327 2644631496 2643221714 Bacteria 9015452
328 2671838357 2671180195 Bacteria 9757215
329 2774856513 2773857922 Bacteria 9757215
330 2954692297 2954691527 Bacteria 10720516
331 8055159742 8055157932 Bacteria 6429399
332 8055159922 8055157932 Bacteria 6429399
333 JGI25406J46586_10008986
334 JGI25407J50210_10001592
335 JGI25407J50210_10055861
336 Ga0070690_100692006
337 Ga0070680_100740999
338 Ga0070682_100244860
339 Ga0070660_100163950
340 Ga0070714_100847786
341 Ga0070700_101831029
342 Ga0070708_100337454
343 Ga0070662_101141045
344 Ga0070681_10705401
345 Ga0070698_101131998
346 Ga0068853_100941816
347 Ga0070672_100538524
348 Ga0070696_101016784
349 Ga0068855_100013728
350 Ga0068855_100061218
351 Ga0068857_100834816
352 Ga0068856_100152538
353 Ga0068856_100259949
354 Ga0068856_101727392
355 Ga0068852_100634573
356 Ga0068852_101297512
357 Ga0068859_100003518
358 Ga0068859_100198952
359 Ga0068858_100007140
360 Ga0068858_100766136
361 Ga0068860_100015653
362 Ga0068862_100000517
363 Ga0081455_10000732
364 Ga0081538_10001413
365 Ga0081538_10009938
366 Ga0081540_1066759
367 Ga0081539_10005830
368 Ga0081539_10007916
369 Ga0081539_10080503
370 Ga0075365_10132272
371 Ga0075368_10006886
372 Ga0075368_10568357
373 Ga0075363_100365163
374 Ga0075367_10014955
375 Ga0075367_10353868
376 Ga0075370_10232577
377 Ga0075428_100055620
378 Ga0075430_100095412
379 Ga0075431_100110614
380 Ga0075431_101054042
381 Ga0075433_10096151
382 Ga0075433_10633610
383 Ga0075429_100581714
384 Ga0068865_100711265
385 Ga0097620_100003518
386 Ga0097620_100198946
387 Ga0075435_100458478
388 Ga0105240_10006202
389 Ga0105240_10082706
390 Ga0105240_10668602
391 Ga0105245_10634478
392 Ga0105247_10000224
393 Ga0105247_10008369
394 Ga0105247_10397914
395 Ga0114129_10216079
396 Ga0105243_11691347
397 Ga0105241_10126321
398 Ga0105248_10001521
399 Ga0105248_10002282
400 Ga0105248_12037484
401 Ga0105237_10035151
402 Ga0105237_10200970
403 Ga0105238_10613927
404 Ga0105238_10833710
405 Ga0105238_11604940
406 Ga0105249_10016246
407 Ga0105249_11429680
408 Ga0105239_10075828
409 Ga0105239_10270824
410 Ga0105239_10276087
411 Ga0105239_11863541
412 Ga0105239_12658978
413 Ga0105246_10223834
414 Ga0157370_11660113
415 Ga0157369_10089831
416 Ga0157369_11377253
417 Ga0157375_10132768
418 Ga0163163_10003533
419 Ga0163163_10026940
420 Ga0157377_10490014
421 Ga0157379_10008972
422 Ga0206356_10641644
423 Ga0206353_10718145
424 Ga0213875_10031774
425 Ga0213875_10175381
426 Ga0207710_10000008
427 Ga0207710_10000065
428 Ga0207647_10045148
429 Ga0207647_10091359
430 Ga0207654_10082996
431 Ga0207695_10004000
432 Ga0207695_10086174
433 Ga0207695_10708890
434 Ga0207671_10061844
435 Ga0207671_10615019
436 Ga0207660_10730704
437 Ga0207694_10095611
438 Ga0207694_10287531
439 Ga0207694_11097567
440 Ga0207664_10276403
441 Ga0207664_10323017
442 Ga0207664_10465109
443 Ga0207664_10720951
444 Ga0207709_11566191
445 Ga0207669_11191966
446 Ga0207691_10612954
447 Ga0207711_10000329
448 Ga0207711_11182651
449 Ga0207667_10003569
450 Ga0207667_10165386
451 Ga0207667_10478222
452 Ga0207712_10014388
453 Ga0207658_10411304
454 Ga0207703_10000280
455 Ga0207703_10060258
456 Ga0207639_10234963
457 Ga0207639_10437971
458 Ga0207678_10323959
459 Ga0207708_11006301
460 Ga0207702_10114032
461 Ga0207702_10276707
462 Ga0207702_11636352
463 Ga0207641_11575109
464 Ga0209813_10017563
465 Ga0268266_10243691
466 Ga0268265_10001402
467 Ga0268264_10053249
468 Ga0307517_10014950
469 Ga0307515_10094036
470 Ga0307515_10160026
471 Ga0307511_10080159
472 Ga0307513_10009846
473 Ga0307513_10080487
474 Ga0307509_10156028
475 Ga0307508_10079762
476 Ga0307514_10004554
477 Ga0307514_10433017
478 Ga0307516_10219733
479 Ga0307516_10234706
480 Ga0307518_10112580
481 Ga0307415_101460211
482 Ga0307510_10000524
483 Ga0373952_0224669
484 Ga0373931_0086549
485 Ga0373931_0168378
486 Ga0395898_0257914
487 Ga0395898_1118328
488 Ga0395905_1232958
489 Ga0436364_0330134
490 Ga0436364_0428250
491 Ga0395901_1009250
492 Ga0451853_1745357
493 Ga0451853_2864261
494 Ga0451853_3100441
495 Ga0451853_3887997
496 Ga0439448_0028262
497 Ga0439450_001409
498 Ga0439454_003876
499 Ga0439463_014998
500 Ga0439464_0007905
501 Ga0439460_0004549
502 Ga0439440_0001872
503 Ga0466969_0005848
504 Ga0466965_0002452
505 Ga0466965_0027673
506 Ga0466966_0001238
507 Ga0466966_0146666
508 Ga0466966_0663799
509 Ga0466961_0000516
510 Ga0466961_0033673
511 Ga0466961_0119405
512 Ga0466963_0001605
513 Ga0466963_0199849
514 Ga0466963_0295332
515 Ga0466964_0050004
516 Ga0466964_0074857
517 Ga0466971_0000816
518 Ga0466971_0002475
519 Ga0466971_0186944
520 Ga0466970_0000312
521 Ga0466957_0001088
522 Ga0466957_0112339
523 Ga0466960_0475875
524 Ga0466959_0000567
525 Ga0466959_0049562
526 Ga0466958_0000357
527 Ga0466958_0006599
528 Ga0466967_0059532
529 Ga0466967_0122384
530 Ga0466967_0378974
531 Ga0466967_0629531
532 Ga0495627_015115
533 Ga0495603_0626986
534 Ga0495638_0137818
535 Ga0495607_0128186
536 Ga0495628_0001147
537 Ga0495632_0048207
538 Ga0495643_0042017
539 Ga0495644_0388932
540 Ga0495645_0011884
541 Ga0495633_0299921
542 Ga0495656_0431213
543 Ga0495668_0234601
544 Ga0495625_0368020
545 Ga0495599_0029355
546 Ga0495646_0110722
547 Ga0495649_0345159
548 Ga0495660_0027323
549 Ga0495636_0350515
550 Ga0495674_0081064
551 Ga0495687_007552
552 Ga0495685_002473
553 Ga0495685_014616
554 Ga0495681_0017849
555 Ga0496101_0724832
556 Ga0496101_1167164
557 Ga0496103_0077243
558 Ga0496103_0808512
559 Ga0496104_0123537
560 Ga0496108_0088671
561 Ga0496109_0153213
562 Ga0496109_1400119
563 Ga0496110_0014565
564 Ga0496110_0296410
565 Ga0496110_0302342
566 Ga0496110_0483302
567 Ga0496111_0112258
568 Ga0496111_1112267
569 Ga0496114_0089314
570 Ga0496114_0467348
571 Ga0496114_1075335
572 Ga0496115_0169518
573 Ga0496116_0002289
574 Ga0496117_0142399
575 Ga0496118_0358779
576 Ga0496119_0002099
577 Ga0496120_0001007
578 Ga0496120_0121352
579 Ga0496121_0036827
580 Ga0496125_0021440
581 Ga0496126_0000037
582 Ga0496126_0609389
583 Ga0501032_0106024
584 Ga0501033_0920725
585 Ga0501036_0273680
586 Ga0501036_1129147
587 Ga0501037_0582936
588 Ga0501038_0859484
589 Ga0501039_0098354
590 Ga0501040_0006140
591 Ga0501040_0256801
592 Ga0501041_0011428
593 Ga0501041_0078424
594 Ga0501042_0051154
595 Ga0501043_0229329
596 Ga0501043_0537310
597 Ga0501046_0000096
598 Ga0501046_0029824
599 Ga0501047_0005312
600 Ga0501048_0120805
601 Ga0501068_0200734
602 Ga0501070_1339153
603 Ga0501071_0178237
604 Ga0501072_0220262
605 Ga0501072_0666619
606 Ga0501073_0457795
607 Ga0501074_0225157
608 Ga0501075_0002729
609 Ga0501076_0022730
610 Ga0501076_0279657
611 Ga0501077_0182491
612 Ga0501077_0371221
613 Ga0501079_0014160
614 Ga0501079_0014960
615 Ga0501079_0504814
616 Ga0501081_0021269
617 Ga0501035_0002380
618 Ga0501044_0008356
619 Ga0501044_0111428
620 Ga0501045_0068020
621 nmdc:mga06z11_29104_c1
622 nmdc:mga04h51_38888_c1
623 nmdc:mga05p37_310684_c1
624 nmdc:mga09592_383341_c1
625 nmdc:mga0qj67_488976_c1
626 nmdc:mga0n895_1087592_c1
627 nmdc:mga0n895_28937_c1
628 nmdc:mga0a205_217492_c1
629 Ga0500578_0116870
630 Ga0500644_0028292
631 Ga0500583_0470606
632 Ga0500654_060953
633 Ga0500558_151991
634 Ga0500560_012710
635 Ga0500569_001446
636 Ga0500628_013149
637 Ga0500658_0006064
638 Ga0500561_0039883
639 Ga0500573_0029414
640 Ga0500579_258991
641 Ga0500600_0081084
642 Ga0500616_0114338
643 Ga0500633_0047703
644 Ga0500634_0028990
645 Ga0500636_0144545
646 Ga0500656_002366
647 Ga0500587_004707
648 Ga0501084_0019553
649 Ga0501084_0512830
650 Ga0501082_0074834
651 Ga0466962_0000459
652 Ga0466962_0010850
653 Ga0466962_0019642
654 Ga0530510_0038347
655 Ga0530510_0562318
656 2954707363
657 2585309560
658 2644266540
659 2644631496
660 2671838357
661 2774856513
662 2954692297
663 8055159742
664 8055159922

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01575

MaoC_dehydratas

MaoC like domain

3

119

0.88

PF13452

MaoC_dehydrat_N

N-terminal half of MaoC dehydratase

6

128

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rlj-assembly1.cif.gz_B crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium tuberculosis 0.8947 16 146
4rv2-assembly1.cif.gz_B-2 crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium smegmatis 0.8779 16 146
4qfw-assembly1.cif.gz_A crystal structure of acyl-coa thioesterase tesb from yersinia pestis 0.8752 92 146
5i7n-assembly1.cif.gz_A-2 maoc-like dehydratase 0.8716 12 146
4w78-assembly1.cif.gz_F crystal structure of the chsh1-chsh2 complex from mycobacterium tuberculosis 0.8625 14 146
ID Description Score Start End Superfamily
af_Q5A0N4_66_202_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8952 87 142 3.10.129.10
af_Q2FXM2_325_429_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8914 86 146 3.10.129.10
af_Q556W3_248_405_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8897 87 146 3.10.129.10
4rltB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8873 16 146 3.10.129.10
4w78F00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8625 14 146 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A381TUT8-F1-model_v4 MaoC-like domain-containing protein 0.9753 16 147
AF-A0A2S2C6K6-F1-model_v4 Acyl dehydratase 0.9736 16 146
AF-A0A351ENF3-F1-model_v4 Acyl dehydratase 0.9694 44 146
AF-A0A2E8KUA5-F1-model_v4 Acyl dehydratase (MaoC-like dehydratase) 0.9689 16 147
AF-A0A1V2KCQ3-F1-model_v4 Acyl dehydratase 0.9662 12 147

Map