F411049
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 332 | 201 | 332 | 221 |
Family's Representative Sequence
| Representative Sequence | 3300045836|Ga0466958_0005233|Ga0466958_0005233_2426_3208 |
| Length | 260 |
| Sequence | MPELRRALDDGADVEHRHPGLQSLPRQHAAGGLVDPALLRERRVAPSILSADFSRLADQLDIVLSAGARVIHFDVMDGHFVPPITIGALVLRSIAERVHDAGAIIDVHLMVERPERHIDAFAGAGADAITVHAEATPHLQYALAMIRDAGCTAGAAVNPGTPASALDEVAEDSLDLALCMSVNPGWGGQSFLPASVAKLARMRKALPDHVALEVDGGIHVDTAGTAAGAGANLLVAGSAVFGSSDPADTYRRIAAAAWES |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 2 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 51 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 53 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 54 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 56 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 57 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 58 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 59 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 79 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 121 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 124 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 125 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 126 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 127 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 128 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 129 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 130 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 131 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 132 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 133 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 134 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 135 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 136 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 137 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 138 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 139 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 140 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 141 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 142 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 143 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 144 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 145 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 146 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 147 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 148 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 149 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 150 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 151 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 152 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 153 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 154 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 155 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 172 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 173 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 174 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 175 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 176 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 177 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 178 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 179 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 180 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 181 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 182 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 183 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 184 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 185 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 186 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 193 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 194 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 195 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 196 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 197 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 198 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 200 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.7 |
| Metatranscriptomes | 0.3 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.51 |
| Nodule | 0 |
| Rhizoplane | 9.94 |
| Rhizosphere | 87.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.9 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10004425 | 3300001991 | Bacteria | 2291 |
| 2 | JGI24738J21930_10030308 | 3300002075 | Bacteria | 1105 |
| 3 | Ga0070683_100008934 | 3300005329 | Bacteria | 8538 |
| 4 | Ga0070683_100124864 | 3300005329 | Bacteria | 2433 |
| 5 | Ga0070683_100797032 | 3300005329 | Bacteria | 905 |
| 6 | Ga0068869_100155674 | 3300005334 | Bacteria | 1775 |
| 7 | Ga0068869_100204109 | 3300005334 | Bacteria | 1560 |
| 8 | Ga0070682_100000708 | 3300005337 | Bacteria | 19980 |
| 9 | Ga0070682_100053771 | 3300005337 | Bacteria | 2525 |
| 10 | Ga0070682_100065405 | 3300005337 | Bacteria | 2310 |
| 11 | Ga0070682_100096577 | 3300005337 | Bacteria | 1943 |
| 12 | Ga0068868_100025876 | 3300005338 | Bacteria | 4467 |
| 13 | Ga0068868_100310477 | 3300005338 | Bacteria | 1341 |
| 14 | Ga0068868_100724704 | 3300005338 | Bacteria | 891 |
| 15 | Ga0070660_100443373 | 3300005339 | Bacteria | 1077 |
| 16 | Ga0070689_100060629 | 3300005340 | Bacteria | 2942 |
| 17 | Ga0070689_100214962 | 3300005340 | Bacteria | 1575 |
| 18 | Ga0070689_100283215 | 3300005340 | Bacteria | 1375 |
| 19 | Ga0070687_100177326 | 3300005343 | Bacteria | 1273 |
| 20 | Ga0070687_100216002 | 3300005343 | Bacteria | 1171 |
| 21 | Ga0070661_100000223 | 3300005344 | Bacteria | 46956 |
| 22 | Ga0070661_100239049 | 3300005344 | Bacteria | 1398 |
| 23 | Ga0070661_100253833 | 3300005344 | Bacteria | 1358 |
| 24 | Ga0070692_10007716 | 3300005345 | Bacteria | 4760 |
| 25 | Ga0070692_10080300 | 3300005345 | Bacteria | 1755 |
| 26 | Ga0070668_100769440 | 3300005347 | Bacteria | 853 |
| 27 | Ga0070669_100003124 | 3300005353 | Bacteria | 11913 |
| 28 | Ga0070669_100079964 | 3300005353 | Bacteria | 2432 |
| 29 | Ga0070669_101139181 | 3300005353 | Bacteria | 673 |
| 30 | Ga0070675_100083284 | 3300005354 | Bacteria | 2670 |
| 31 | Ga0070659_100000013 | 3300005366 | Bacteria | 178795 |
| 32 | Ga0070659_100030241 | 3300005366 | Bacteria | 4190 |
| 33 | Ga0070659_100198603 | 3300005366 | Bacteria | 1650 |
| 34 | Ga0070659_100439379 | 3300005366 | Bacteria | 1105 |
| 35 | Ga0070714_100018985 | 3300005435 | Bacteria | 5595 |
| 36 | Ga0070714_100024224 | 3300005435 | Bacteria | 4994 |
| 37 | Ga0070713_100082335 | 3300005436 | Bacteria | 2747 |
| 38 | Ga0070713_100252899 | 3300005436 | Bacteria | 1608 |
| 39 | Ga0070710_10000005 | 3300005437 | Bacteria | 238049 |
| 40 | Ga0070710_10045510 | 3300005437 | Bacteria | 2440 |
| 41 | Ga0070710_10234598 | 3300005437 | Bacteria | 1173 |
| 42 | Ga0070701_10016821 | 3300005438 | Bacteria | 3407 |
| 43 | Ga0070705_100001368 | 3300005440 | Bacteria | 13011 |
| 44 | Ga0070705_100064714 | 3300005440 | Bacteria | 2186 |
| 45 | Ga0070705_100095881 | 3300005440 | Bacteria | 1861 |
| 46 | Ga0070700_100076202 | 3300005441 | Bacteria | 2153 |
| 47 | Ga0070700_100203627 | 3300005441 | Bacteria | 1392 |
| 48 | Ga0070694_100098527 | 3300005444 | Bacteria | 2064 |
| 49 | Ga0070708_100248494 | 3300005445 | Bacteria | 1671 |
| 50 | Ga0070663_100004117 | 3300005455 | Bacteria | 8494 |
| 51 | Ga0070663_100049231 | 3300005455 | Bacteria | 2991 |
| 52 | Ga0070663_100193833 | 3300005455 | Bacteria | 1583 |
| 53 | Ga0070662_100535599 | 3300005457 | Bacteria | 980 |
| 54 | Ga0070681_10030984 | 3300005458 | Bacteria | 5369 |
| 55 | Ga0068867_100314369 | 3300005459 | Bacteria | 1295 |
| 56 | Ga0070706_100112518 | 3300005467 | Bacteria | 2534 |
| 57 | Ga0070707_100099642 | 3300005468 | Unclassified | 2815 |
| 58 | Ga0070698_100124374 | 3300005471 | Bacteria | 2536 |
| 59 | Ga0070699_100058294 | 3300005518 | Bacteria | 3345 |
| 60 | Ga0070699_100137477 | 3300005518 | Bacteria | 2156 |
| 61 | Ga0070699_100266763 | 3300005518 | Bacteria | 1532 |
| 62 | Ga0070684_100164692 | 3300005535 | Bacteria | 2012 |
| 63 | Ga0070684_100567283 | 3300005535 | Bacteria | 1054 |
| 64 | Ga0070693_100000643 | 3300005547 | Bacteria | 15385 |
| 65 | Ga0070704_100009053 | 3300005549 | Bacteria | 6005 |
| 66 | Ga0070664_100057277 | 3300005564 | Bacteria | 3313 |
| 67 | Ga0068857_100099600 | 3300005577 | Bacteria | 2607 |
| 68 | Ga0068854_100149559 | 3300005578 | Bacteria | 1799 |
| 69 | Ga0068856_100000889 | 3300005614 | Bacteria | 32019 |
| 70 | Ga0070702_100010243 | 3300005615 | Bacteria | 4611 |
| 71 | Ga0070702_100065912 | 3300005615 | Bacteria | 2122 |
| 72 | Ga0070702_100134596 | 3300005615 | Bacteria | 1566 |
| 73 | Ga0070702_100236020 | 3300005615 | Bacteria | 1232 |
| 74 | Ga0068852_100105917 | 3300005616 | Bacteria | 2548 |
| 75 | Ga0068859_100127840 | 3300005617 | Bacteria | 2611 |
| 76 | Ga0068864_100299982 | 3300005618 | Bacteria | 1504 |
| 77 | Ga0068866_10018488 | 3300005718 | Bacteria | 3153 |
| 78 | Ga0068861_100044546 | 3300005719 | Bacteria | 3337 |
| 79 | Ga0068861_100167119 | 3300005719 | Bacteria | 1820 |
| 80 | Ga0068861_100474352 | 3300005719 | Bacteria | 1126 |
| 81 | Ga0068851_10000355 | 3300005834 | Bacteria | 20703 |
| 82 | Ga0068863_100228148 | 3300005841 | Bacteria | 1796 |
| 83 | Ga0068863_100400756 | 3300005841 | Bacteria | 1342 |
| 84 | Ga0068863_100461670 | 3300005841 | Bacteria | 1247 |
| 85 | Ga0068858_100432060 | 3300005842 | Bacteria | 1267 |
| 86 | Ga0068860_100006538 | 3300005843 | Bacteria | 11699 |
| 87 | Ga0068862_100096728 | 3300005844 | Bacteria | 2577 |
| 88 | Ga0068862_100768606 | 3300005844 | Bacteria | 938 |
| 89 | Ga0081455_10066896 | 3300005937 | Bacteria | 2997 |
| 90 | Ga0070717_10000004 | 3300006028 | Bacteria | 365525 |
| 91 | Ga0075365_10169163 | 3300006038 | Bacteria | 1525 |
| 92 | Ga0075365_10229761 | 3300006038 | Bacteria | 1302 |
| 93 | Ga0075432_10040636 | 3300006058 | Bacteria | 1624 |
| 94 | Ga0070712_100000002 | 3300006175 | Bacteria | 288475 |
| 95 | Ga0070712_100112281 | 3300006175 | Bacteria | 2036 |
| 96 | Ga0070712_100138418 | 3300006175 | Bacteria | 1854 |
| 97 | Ga0070712_100188130 | 3300006175 | Bacteria | 1613 |
| 98 | Ga0068871_100619176 | 3300006358 | Bacteria | 986 |
| 99 | Ga0075433_10185290 | 3300006852 | Bacteria | 1852 |
| 100 | Ga0075433_10373204 | 3300006852 | Bacteria | 1260 |
| 101 | Ga0075429_100007783 | 3300006880 | Bacteria | 9305 |
| 102 | Ga0068865_100118785 | 3300006881 | Bacteria | 1962 |
| 103 | Ga0068865_100223118 | 3300006881 | Bacteria | 1474 |
| 104 | Ga0097620_100127843 | 3300006931 | Bacteria | 2611 |
| 105 | Ga0111539_10311544 | 3300009094 | Bacteria | 1832 |
| 106 | Ga0105245_10040845 | 3300009098 | Bacteria | 4134 |
| 107 | Ga0105245_10045363 | 3300009098 | Bacteria | 3926 |
| 108 | Ga0105245_10193319 | 3300009098 | Bacteria | 1950 |
| 109 | Ga0105245_10587742 | 3300009098 | Bacteria | 1139 |
| 110 | Ga0105245_10892431 | 3300009098 | Bacteria | 930 |
| 111 | Ga0105247_10013548 | 3300009101 | Bacteria | 4890 |
| 112 | Ga0105247_10482714 | 3300009101 | Bacteria | 900 |
| 113 | Ga0114129_10001714 | 3300009147 | Bacteria | 29925 |
| 114 | Ga0105243_10039263 | 3300009148 | Bacteria | 3689 |
| 115 | Ga0105243_10111682 | 3300009148 | Bacteria | 2288 |
| 116 | Ga0105243_10241364 | 3300009148 | Bacteria | 1608 |
| 117 | Ga0105238_10637092 | 3300009551 | Bacteria | 1075 |
| 118 | Ga0105249_10039194 | 3300009553 | Bacteria | 4301 |
| 119 | Ga0105249_10185205 | 3300009553 | Bacteria | 2028 |
| 120 | Ga0105239_10063476 | 3300010375 | Bacteria | 4056 |
| 121 | Ga0105239_10383943 | 3300010375 | Bacteria | 1588 |
| 122 | Ga0105246_10169834 | 3300011119 | Bacteria | 1669 |
| 123 | Ga0105246_10573901 | 3300011119 | Bacteria | 970 |
| 124 | Ga0105246_10693281 | 3300011119 | Bacteria | 892 |
| 125 | Ga0157374_11410933 | 3300013296 | Bacteria | 719 |
| 126 | Ga0157378_10097975 | 3300013297 | Bacteria | 2673 |
| 127 | Ga0163162_10423655 | 3300013306 | Bacteria | 1463 |
| 128 | Ga0163162_10466022 | 3300013306 | Unclassified | 1395 |
| 129 | Ga0157372_10000610 | 3300013307 | Bacteria | 39073 |
| 130 | Ga0157372_10327606 | 3300013307 | Bacteria | 1783 |
| 131 | Ga0163163_10041285 | 3300014325 | Bacteria | 4510 |
| 132 | Ga0163163_10350404 | 3300014325 | Bacteria | 1533 |
| 133 | Ga0163163_10808318 | 3300014325 | Bacteria | 1001 |
| 134 | Ga0157380_10241427 | 3300014326 | Bacteria | 1629 |
| 135 | Ga0157377_10019123 | 3300014745 | Bacteria | 3575 |
| 136 | Ga0157379_10123326 | 3300014968 | Bacteria | 2332 |
| 137 | Ga0157376_10057464 | 3300014969 | Bacteria | 3254 |
| 138 | Ga0157376_10132927 | 3300014969 | Bacteria | 2223 |
| 139 | Ga0157376_10140793 | 3300014969 | Bacteria | 2164 |
| 140 | Ga0206356_10446832 | 3300020070 | Bacteria | 2535 |
| 141 | Ga0207692_10000009 | 3300025898 | Bacteria | 159859 |
| 142 | Ga0207692_10266928 | 3300025898 | Bacteria | 1031 |
| 143 | Ga0207642_10006046 | 3300025899 | Bacteria | 3999 |
| 144 | Ga0207688_10041543 | 3300025901 | Bacteria | 2559 |
| 145 | Ga0207647_10057483 | 3300025904 | Bacteria | 2385 |
| 146 | Ga0207685_10221183 | 3300025905 | Bacteria | 900 |
| 147 | Ga0207699_10053418 | 3300025906 | Bacteria | 2395 |
| 148 | Ga0207643_10029871 | 3300025908 | Bacteria | 3032 |
| 149 | Ga0207684_10017754 | 3300025910 | Bacteria | 6104 |
| 150 | Ga0207684_10027942 | 3300025910 | Bacteria | 4805 |
| 151 | Ga0207707_10031723 | 3300025912 | Bacteria | 4625 |
| 152 | Ga0207693_10001761 | 3300025915 | Bacteria | 18999 |
| 153 | Ga0207693_10033646 | 3300025915 | Bacteria | 4044 |
| 154 | Ga0207693_10058643 | 3300025915 | Bacteria | 3015 |
| 155 | Ga0207693_10125584 | 3300025915 | Bacteria | 2017 |
| 156 | Ga0207663_10575578 | 3300025916 | Bacteria | 883 |
| 157 | Ga0207662_10023408 | 3300025918 | Bacteria | 3548 |
| 158 | Ga0207662_10190323 | 3300025918 | Bacteria | 1324 |
| 159 | Ga0207657_10041030 | 3300025919 | Bacteria | 4095 |
| 160 | Ga0207657_10067420 | 3300025919 | Bacteria | 3043 |
| 161 | Ga0207649_10373456 | 3300025920 | Bacteria | 1061 |
| 162 | Ga0207646_10010873 | 3300025922 | Bacteria | 8847 |
| 163 | Ga0207681_10344490 | 3300025923 | Bacteria | 1191 |
| 164 | Ga0207681_10471178 | 3300025923 | Bacteria | 1024 |
| 165 | Ga0207659_10040429 | 3300025926 | Bacteria | 3261 |
| 166 | Ga0207687_10051003 | 3300025927 | Bacteria | 2883 |
| 167 | Ga0207687_10072897 | 3300025927 | Bacteria | 2458 |
| 168 | Ga0207687_10138621 | 3300025927 | Bacteria | 1843 |
| 169 | Ga0207700_10050428 | 3300025928 | Bacteria | 3102 |
| 170 | Ga0207700_10179909 | 3300025928 | Bacteria | 1770 |
| 171 | Ga0207664_10001425 | 3300025929 | Bacteria | 15730 |
| 172 | Ga0207664_10366770 | 3300025929 | Bacteria | 1277 |
| 173 | Ga0207690_10000017 | 3300025932 | Bacteria | 243513 |
| 174 | Ga0207690_10215978 | 3300025932 | Bacteria | 1465 |
| 175 | Ga0207706_10242227 | 3300025933 | Bacteria | 1576 |
| 176 | Ga0207686_10154723 | 3300025934 | Bacteria | 1600 |
| 177 | Ga0207670_10228936 | 3300025936 | Bacteria | 1426 |
| 178 | Ga0207704_10028448 | 3300025938 | Bacteria | 3101 |
| 179 | Ga0207711_10257185 | 3300025941 | Bacteria | 1604 |
| 180 | Ga0207689_10020265 | 3300025942 | Bacteria | 5600 |
| 181 | Ga0207689_10060407 | 3300025942 | Bacteria | 3117 |
| 182 | Ga0207661_10027579 | 3300025944 | Bacteria | 4339 |
| 183 | Ga0207661_10109221 | 3300025944 | Bacteria | 2336 |
| 184 | Ga0207679_10371750 | 3300025945 | Bacteria | 1251 |
| 185 | Ga0207679_10435473 | 3300025945 | Bacteria | 1160 |
| 186 | Ga0207712_10058002 | 3300025961 | Bacteria | 2734 |
| 187 | Ga0207668_10422120 | 3300025972 | Bacteria | 1132 |
| 188 | Ga0207640_10324456 | 3300025981 | Bacteria | 1227 |
| 189 | Ga0207677_10032538 | 3300026023 | Bacteria | 3354 |
| 190 | Ga0207677_10190609 | 3300026023 | Bacteria | 1621 |
| 191 | Ga0207678_10013196 | 3300026067 | Bacteria | 7249 |
| 192 | Ga0207678_10499339 | 3300026067 | Bacteria | 1060 |
| 193 | Ga0207708_10065923 | 3300026075 | Bacteria | 2768 |
| 194 | Ga0207708_10322445 | 3300026075 | Bacteria | 1261 |
| 195 | Ga0207702_10001782 | 3300026078 | Bacteria | 21206 |
| 196 | Ga0207641_10062400 | 3300026088 | Bacteria | 3180 |
| 197 | Ga0207641_10651462 | 3300026088 | Bacteria | 1034 |
| 198 | Ga0207648_10403709 | 3300026089 | Bacteria | 1239 |
| 199 | Ga0207674_10023509 | 3300026116 | Bacteria | 6599 |
| 200 | Ga0207674_10359153 | 3300026116 | Bacteria | 1408 |
| 201 | Ga0207675_100037327 | 3300026118 | Bacteria | 4532 |
| 202 | Ga0207675_100564134 | 3300026118 | Bacteria | 1139 |
| 203 | Ga0207675_100881169 | 3300026118 | Bacteria | 911 |
| 204 | Ga0207698_10192808 | 3300026142 | Bacteria | 1817 |
| 205 | Ga0207698_10393301 | 3300026142 | Bacteria | 1322 |
| 206 | Ga0207698_11177282 | 3300026142 | Bacteria | 780 |
| 207 | Ga0207428_10243867 | 3300027907 | Bacteria | 1342 |
| 208 | Ga0268265_10164628 | 3300028380 | Bacteria | 1888 |
| 209 | Ga0268264_10019943 | 3300028381 | Bacteria | 5477 |
| 210 | Ga0268264_10026624 | 3300028381 | Bacteria | 4726 |
| 211 | Ga0265326_10000045 | 3300028558 | Bacteria | 79810 |
| 212 | Ga0265326_10050232 | 3300028558 | Bacteria | 1181 |
| 213 | Ga0265319_1000073 | 3300028563 | Bacteria | 81138 |
| 214 | Ga0265319_1000118 | 3300028563 | Bacteria | 60393 |
| 215 | Ga0265319_1003066 | 3300028563 | Bacteria | 8843 |
| 216 | Ga0265334_10000012 | 3300028573 | Bacteria | 174358 |
| 217 | Ga0265318_10052193 | 3300028577 | Bacteria | 1535 |
| 218 | Ga0265322_10080857 | 3300028654 | Bacteria | 922 |
| 219 | Ga0265338_10000464 | 3300028800 | Bacteria | 72259 |
| 220 | Ga0265338_10007079 | 3300028800 | Bacteria | 14059 |
| 221 | Ga0265338_10071271 | 3300028800 | Bacteria | 2974 |
| 222 | Ga0265338_10154509 | 3300028800 | Bacteria | 1779 |
| 223 | Ga0265324_10007445 | 3300029957 | Bacteria | 4432 |
| 224 | Ga0265330_10106191 | 3300031235 | Bacteria | 1201 |
| 225 | Ga0265332_10069480 | 3300031238 | Bacteria | 1501 |
| 226 | Ga0265320_10038599 | 3300031240 | Bacteria | 2394 |
| 227 | Ga0265331_10138755 | 3300031250 | Bacteria | 1106 |
| 228 | Ga0265327_10023687 | 3300031251 | Bacteria | 3629 |
| 229 | Ga0265327_10054170 | 3300031251 | Bacteria | 2077 |
| 230 | Ga0307409_100251208 | 3300031995 | Bacteria | 1617 |
| 231 | Ga0307416_100345713 | 3300032002 | Bacteria | 1503 |
| 232 | Ga0307415_100512938 | 3300032126 | Bacteria | 1051 |
| 233 | Ga0373929_0049816 | 3300035085 | Bacteria | 955 |
| 234 | Ga0373962_0028642 | 3300035242 | Bacteria | 1513 |
| 235 | Ga0436364_0737248 | 3300037853 | Bacteria | 154680 |
| 236 | Ga0395901_0528008 | 3300038443 | Bacteria | 1198 |
| 237 | Ga0242420_029355 | 3300038996 | Bacteria | 1015 |
| 238 | Ga0436365_0674096 | 3300039437 | Bacteria | 3880 |
| 239 | Ga0436362_0314321 | 3300039453 | Bacteria | 4025 |
| 240 | Ga0451577_0196988 | 3300042876 | Bacteria | 1818 |
| 241 | Ga0466961_0121255 | 3300044693 | Bacteria | 1642 |
| 242 | Ga0466964_0150203 | 3300044706 | Bacteria | 1079 |
| 243 | Ga0466970_0276773 | 3300044765 | Bacteria | 943 |
| 244 | Ga0466957_0083399 | 3300044842 | Bacteria | 1994 |
| 245 | Ga0466960_0013930 | 3300044901 | Bacteria | 3427 |
| 246 | Ga0466960_0034840 | 3300044901 | Bacteria | 2349 |
| 247 | Ga0466960_0058529 | 3300044901 | Bacteria | 1882 |
| 248 | Ga0466960_0111586 | 3300044901 | Bacteria | 1421 |
| 249 | Ga0466959_0024122 | 3300045049 | Bacteria | 4503 |
| 250 | Ga0466959_0063927 | 3300045049 | Bacteria | 2672 |
| 251 | Ga0451576_0146124 | 3300045051 | Bacteria | 2465 |
| 252 | Ga0466958_0005233 | 3300045836 | Bacteria | 6952 |
| 253 | Ga0466958_0219890 | 3300045836 | Bacteria | 1212 |
| 254 | Ga0466958_0294571 | 3300045836 | Bacteria | 1041 |
| 255 | Ga0466967_0000019 | 3300045976 | Bacteria | 79629 |
| 256 | Ga0466967_0035295 | 3300045976 | Bacteria | 4254 |
| 257 | Ga0466967_0048329 | 3300045976 | Bacteria | 3714 |
| 258 | Ga0466967_0058619 | 3300045976 | Bacteria | 3404 |
| 259 | Ga0466967_0222522 | 3300045976 | Bacteria | 1794 |
| 260 | Ga0466967_0247097 | 3300045976 | Bacteria | 1703 |
| 261 | Ga0466967_0552445 | 3300045976 | Bacteria | 1133 |
| 262 | Ga0466967_0609885 | 3300045976 | Bacteria | 1078 |
| 263 | Ga0495603_0006955 | 3300046455 | Bacteria | 6786 |
| 264 | Ga0495664_0000025 | 3300046477 | Bacteria | 120941 |
| 265 | Ga0495608_0065050 | 3300046511 | Bacteria | 2389 |
| 266 | Ga0495652_0088765 | 3300046529 | Bacteria | 2533 |
| 267 | Ga0495587_0187803 | 3300046536 | Bacteria | 1171 |
| 268 | Ga0495645_0000463 | 3300046543 | Bacteria | 28033 |
| 269 | Ga0495625_0181707 | 3300046660 | Bacteria | 1398 |
| 270 | Ga0495647_0188440 | 3300046681 | Bacteria | 900 |
| 271 | Ga0495600_0007859 | 3300046809 | Bacteria | 6531 |
| 272 | Ga0495581_0276323 | 3300047315 | Bacteria | 982 |
| 273 | Ga0495604_0003881 | 3300047317 | Bacteria | 11900 |
| 274 | Ga0495604_0212774 | 3300047317 | Bacteria | 1335 |
| 275 | Ga0495674_0205894 | 3300047319 | Bacteria | 1631 |
| 276 | Ga0495672_0007449 | 3300047320 | Bacteria | 8233 |
| 277 | Ga0495672_0047954 | 3300047320 | Bacteria | 2537 |
| 278 | Ga0495684_0001866 | 3300047471 | Bacteria | 16862 |
| 279 | Ga0495686_0025251 | 3300047472 | Unclassified | 3897 |
| 280 | Ga0496100_0177281 | 3300048903 | Bacteria | 1539 |
| 281 | Ga0496100_0304654 | 3300048903 | Unclassified | 1193 |
| 282 | Ga0496100_0444110 | 3300048903 | Bacteria | 994 |
| 283 | Ga0496101_0100296 | 3300048904 | Unclassified | 2166 |
| 284 | Ga0496102_0000002 | 3300048905 | Bacteria | 814588 |
| 285 | Ga0496102_0036676 | 3300048905 | Bacteria | 4418 |
| 286 | Ga0496102_0253727 | 3300048905 | Bacteria | 1658 |
| 287 | Ga0496102_0833374 | 3300048905 | Bacteria | 844 |
| 288 | Ga0496103_0000047 | 3300048906 | Bacteria | 161130 |
| 289 | Ga0496103_0175082 | 3300048906 | Bacteria | 1378 |
| 290 | Ga0496104_0501035 | 3300048907 | Bacteria | 1125 |
| 291 | Ga0496106_0184203 | 3300048909 | Bacteria | 1658 |
| 292 | Ga0496106_0185946 | 3300048909 | Bacteria | 1650 |
| 293 | Ga0496106_1138296 | 3300048909 | Bacteria | 610 |
| 294 | Ga0496107_0148032 | 3300048910 | Bacteria | 1736 |
| 295 | Ga0496108_0087514 | 3300048911 | Bacteria | 2646 |
| 296 | Ga0496108_0192610 | 3300048911 | Bacteria | 1767 |
| 297 | Ga0496109_0000318 | 3300048912 | Bacteria | 45292 |
| 298 | Ga0496109_0047152 | 3300048912 | Bacteria | 3916 |
| 299 | Ga0496109_0349273 | 3300048912 | Bacteria | 1397 |
| 300 | Ga0496110_0063284 | 3300048913 | Bacteria | 3268 |
| 301 | Ga0496110_0109245 | 3300048913 | Bacteria | 2484 |
| 302 | Ga0496110_0114284 | 3300048913 | Bacteria | 2429 |
| 303 | Ga0496110_0538613 | 3300048913 | Bacteria | 1061 |
| 304 | Ga0496110_0807586 | 3300048913 | Bacteria | 842 |
| 305 | Ga0496111_0098190 | 3300048914 | Bacteria | 2150 |
| 306 | Ga0496112_0005877 | 3300048915 | Bacteria | 10690 |
| 307 | Ga0496113_0067862 | 3300048916 | Bacteria | 2705 |
| 308 | Ga0496113_0107298 | 3300048916 | Bacteria | 2170 |
| 309 | Ga0496113_0269341 | 3300048916 | Bacteria | 1361 |
| 310 | Ga0496114_0000133 | 3300048917 | Bacteria | 53994 |
| 311 | Ga0496115_0000506 | 3300048918 | Bacteria | 30541 |
| 312 | Ga0496115_0239615 | 3300048918 | Bacteria | 1495 |
| 313 | Ga0496124_0122853 | 3300048927 | Bacteria | 2072 |
| 314 | Ga0501042_0167794 | 3300049578 | Bacteria | 1584 |
| 315 | Ga0501067_0142027 | 3300049583 | Bacteria | 1337 |
| 316 | Ga0501067_0297517 | 3300049583 | Bacteria | 898 |
| 317 | Ga0501069_0142789 | 3300049585 | Bacteria | 1374 |
| 318 | Ga0501071_0299761 | 3300049587 | Bacteria | 1218 |
| 319 | Ga0501079_0709576 | 3300049741 | Bacteria | 792 |
| 320 | Ga0501044_0126309 | 3300049823 | Bacteria | 2555 |
| 321 | nmdc:mga00v17_249864_c1 | 3300050491 | Bacteria | 1150 |
| 322 | nmdc:mga0yw44_253513_c1 | 3300050492 | Bacteria | 1172 |
| 323 | nmdc:mga0yw44_616781_c1 | 3300050492 | Bacteria | 737 |
| 324 | nmdc:mga05p37_9493_c1 | 3300050507 | Bacteria | 11517 |
| 325 | nmdc:mga09592_3784_c1 | 3300050508 | Bacteria | 12177 |
| 326 | nmdc:mga08y16_71613_c1 | 3300050511 | Bacteria | 3612 |
| 327 | nmdc:mga0n895_241549_c1 | 3300050512 | Bacteria | 1833 |
| 328 | nmdc:mga0rr50_263531_c1 | 3300050513 | Bacteria | 1434 |
| 329 | nmdc:mga0rr50_50667_c1 | 3300050513 | Bacteria | 3077 |
| 330 | nmdc:mga0a205_420314_c1 | 3300050515 | Bacteria | 1199 |
| 331 | Ga0495601_0017961 | 3300053077 | Bacteria | 4300 |
| 332 | Ga0466962_0148770 | 3300061719 | Bacteria | 1136 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300038996 | Ga0242420_029355 | Ga0242420_029355_13_549 | 178 |
| 2 | 3300045049 | Ga0466959_0063927 | Ga0466959_0063927_14_568 | 178 |
| 3 | 3300048907 | Ga0496104_0501035 | Ga0496104_0501035_570_1106 | 178 |
| 4 | 3300048909 | Ga0496106_1138296 | Ga0496106_1138296_55_591 | 178 |
| 5 | 3300026067 | Ga0207678_10499339 | Ga0207678_104993392 | 186 |
| 6 | 3300050492 | nmdc:mga0yw44_616781_c1 | nmdc:mga0yw44_616781_c1_126_713 | 188 |
| 7 | 3300025944 | Ga0207661_10109221 | Ga0207661_101092211 | 191 |
| 8 | 3300044706 | Ga0466964_0150203 | Ga0466964_0150203_426_1001 | 191 |
| 9 | 3300028654 | Ga0265322_10080857 | Ga0265322_100808571 | 192 |
| 10 | 3300046660 | Ga0495625_0181707 | Ga0495625_0181707_652_1338 | 192 |
| 11 | 3300028558 | Ga0265326_10000045 | Ga0265326_100000457 | 195 |
| 12 | 3300028573 | Ga0265334_10000012 | Ga0265334_1000001284 | 195 |
| 13 | 3300028577 | Ga0265318_10052193 | Ga0265318_100521931 | 195 |
| 14 | 3300028800 | Ga0265338_10007079 | Ga0265338_100070793 | 195 |
| 15 | 3300029957 | Ga0265324_10007445 | Ga0265324_100074453 | 195 |
| 16 | 3300005337 | Ga0070682_100096577 | Ga0070682_1000965771 | 196 |
| 17 | 3300028800 | Ga0265338_10071271 | Ga0265338_100712714 | 196 |
| 18 | 3300031251 | Ga0265327_10023687 | Ga0265327_100236874 | 196 |
| 19 | 3300050513 | nmdc:mga0rr50_263531_c1 | nmdc:mga0rr50_263531_c1_722_1411 | 196 |
| 20 | 3300005547 | Ga0070693_100000643 | Ga0070693_10000064312 | 198 |
| 21 | 3300049587 | Ga0501071_0299761 | Ga0501071_0299761_125_811 | 198 |
| 22 | 3300048917 | Ga0496114_0000133 | Ga0496114_0000133_6255_6941 | 199 |
| 23 | 3300048918 | Ga0496115_0000506 | Ga0496115_0000506_24987_25673 | 199 |
| 24 | 3300044901 | Ga0466960_0058529 | Ga0466960_0058529_1081_1725 | 202 |
| 25 | 3300045976 | Ga0466967_0000019 | Ga0466967_0000019_32090_32764 | 202 |
| 26 | 3300005436 | Ga0070713_100252899 | Ga0070713_1002528992 | 209 |
| 27 | 3300005614 | Ga0068856_100000889 | Ga0068856_10000088916 | 209 |
| 28 | 3300005937 | Ga0081455_10066896 | Ga0081455_100668963 | 209 |
| 29 | 3300025928 | Ga0207700_10179909 | Ga0207700_101799092 | 209 |
| 30 | 3300026078 | Ga0207702_10001782 | Ga0207702_1000178211 | 209 |
| 31 | 3300039437 | Ga0436365_0674096 | Ga0436365_0674096_1963_2616 | 210 |
| 32 | 3300039453 | Ga0436362_0314321 | Ga0436362_0314321_2063_2716 | 210 |
| 33 | 3300046511 | Ga0495608_0065050 | Ga0495608_0065050_717_1367 | 210 |
| 34 | 3300046809 | Ga0495600_0007859 | Ga0495600_0007859_1774_2424 | 210 |
| 35 | 3300061719 | Ga0466962_0148770 | Ga0466962_0148770_22_675 | 210 |
| 36 | 3300005334 | Ga0068869_100204109 | Ga0068869_1002041092 | 211 |
| 37 | 3300005345 | Ga0070692_10007716 | Ga0070692_100077167 | 211 |
| 38 | 3300005353 | Ga0070669_100079964 | Ga0070669_1000799643 | 211 |
| 39 | 3300005366 | Ga0070659_100198603 | Ga0070659_1001986032 | 211 |
| 40 | 3300005436 | Ga0070713_100082335 | Ga0070713_1000823353 | 211 |
| 41 | 3300005444 | Ga0070694_100098527 | Ga0070694_1000985273 | 211 |
| 42 | 3300005445 | Ga0070708_100248494 | Ga0070708_1002484942 | 211 |
| 43 | 3300005455 | Ga0070663_100004117 | Ga0070663_1000041179 | 211 |
| 44 | 3300005467 | Ga0070706_100112518 | Ga0070706_1001125183 | 211 |
| 45 | 3300005468 | Ga0070707_100099642 | Ga0070707_1000996422 | 211 |
| 46 | 3300005471 | Ga0070698_100124374 | Ga0070698_1001243742 | 211 |
| 47 | 3300005518 | Ga0070699_100058294 | Ga0070699_1000582942 | 211 |
| 48 | 3300005518 | Ga0070699_100137477 | Ga0070699_1001374772 | 211 |
| 49 | 3300005518 | Ga0070699_100266763 | Ga0070699_1002667632 | 211 |
| 50 | 3300005549 | Ga0070704_100009053 | Ga0070704_1000090533 | 211 |
| 51 | 3300005719 | Ga0068861_100167119 | Ga0068861_1001671192 | 211 |
| 52 | 3300005841 | Ga0068863_100228148 | Ga0068863_1002281483 | 211 |
| 53 | 3300005841 | Ga0068863_100461670 | Ga0068863_1004616702 | 211 |
| 54 | 3300005842 | Ga0068858_100432060 | Ga0068858_1004320602 | 211 |
| 55 | 3300005843 | Ga0068860_100006538 | Ga0068860_10000653814 | 211 |
| 56 | 3300005844 | Ga0068862_100096728 | Ga0068862_1000967283 | 211 |
| 57 | 3300006038 | Ga0075365_10169163 | Ga0075365_101691632 | 211 |
| 58 | 3300006038 | Ga0075365_10229761 | Ga0075365_102297612 | 211 |
| 59 | 3300006852 | Ga0075433_10185290 | Ga0075433_101852902 | 211 |
| 60 | 3300009098 | Ga0105245_10587742 | Ga0105245_105877422 | 211 |
| 61 | 3300009147 | Ga0114129_10001714 | Ga0114129_1000171415 | 211 |
| 62 | 3300009553 | Ga0105249_10039194 | Ga0105249_100391943 | 211 |
| 63 | 3300014325 | Ga0163163_10808318 | Ga0163163_108083182 | 211 |
| 64 | 3300014968 | Ga0157379_10123326 | Ga0157379_101233263 | 211 |
| 65 | 3300014969 | Ga0157376_10140793 | Ga0157376_101407933 | 211 |
| 66 | 3300025905 | Ga0207685_10221183 | Ga0207685_102211832 | 211 |
| 67 | 3300025910 | Ga0207684_10017754 | Ga0207684_100177548 | 211 |
| 68 | 3300025910 | Ga0207684_10027942 | Ga0207684_100279426 | 211 |
| 69 | 3300025922 | Ga0207646_10010873 | Ga0207646_100108733 | 211 |
| 70 | 3300025923 | Ga0207681_10471178 | Ga0207681_104711782 | 211 |
| 71 | 3300025927 | Ga0207687_10138621 | Ga0207687_101386212 | 211 |
| 72 | 3300025928 | Ga0207700_10050428 | Ga0207700_100504283 | 211 |
| 73 | 3300026067 | Ga0207678_10013196 | Ga0207678_100131967 | 211 |
| 74 | 3300026088 | Ga0207641_10062400 | Ga0207641_100624002 | 211 |
| 75 | 3300026088 | Ga0207641_10651462 | Ga0207641_106514622 | 211 |
| 76 | 3300026118 | Ga0207675_100037327 | Ga0207675_1000373274 | 211 |
| 77 | 3300028380 | Ga0268265_10164628 | Ga0268265_101646283 | 211 |
| 78 | 3300028381 | Ga0268264_10019943 | Ga0268264_100199431 | 211 |
| 79 | 3300035085 | Ga0373929_0049816 | Ga0373929_0049816_146_817 | 211 |
| 80 | 3300035242 | Ga0373962_0028642 | Ga0373962_0028642_733_1404 | 211 |
| 81 | 3300042876 | Ga0451577_0196988 | Ga0451577_0196988_337_1008 | 211 |
| 82 | 3300045051 | Ga0451576_0146124 | Ga0451576_0146124_625_1296 | 211 |
| 83 | 3300045976 | Ga0466967_0247097 | Ga0466967_0247097_875_1558 | 211 |
| 84 | 3300047319 | Ga0495674_0205894 | Ga0495674_0205894_615_1286 | 211 |
| 85 | 3300048905 | Ga0496102_0036676 | Ga0496102_0036676_2587_3258 | 211 |
| 86 | 3300048910 | Ga0496107_0148032 | Ga0496107_0148032_626_1297 | 211 |
| 87 | 3300048913 | Ga0496110_0538613 | Ga0496110_0538613_202_873 | 211 |
| 88 | 3300048918 | Ga0496115_0239615 | Ga0496115_0239615_700_1368 | 211 |
| 89 | 3300050491 | nmdc:mga00v17_249864_c1 | nmdc:mga00v17_249864_c1_101_790 | 211 |
| 90 | 3300050492 | nmdc:mga0yw44_253513_c1 | nmdc:mga0yw44_253513_c1_206_895 | 211 |
| 91 | 3300050507 | nmdc:mga05p37_9493_c1 | nmdc:mga05p37_9493_c1_9054_9725 | 211 |
| 92 | 3300050512 | nmdc:mga0n895_241549_c1 | nmdc:mga0n895_241549_c1_473_1144 | 211 |
| 93 | 3300050513 | nmdc:mga0rr50_50667_c1 | nmdc:mga0rr50_50667_c1_1299_1970 | 211 |
| 94 | 3300050515 | nmdc:mga0a205_420314_c1 | nmdc:mga0a205_420314_c1_117_788 | 211 |
| 95 | 3300005337 | Ga0070682_100000708 | Ga0070682_1000007084 | 212 |
| 96 | 3300005340 | Ga0070689_100214962 | Ga0070689_1002149622 | 212 |
| 97 | 3300005344 | Ga0070661_100000223 | Ga0070661_1000002238 | 212 |
| 98 | 3300005366 | Ga0070659_100030241 | Ga0070659_1000302413 | 212 |
| 99 | 3300005535 | Ga0070684_100567283 | Ga0070684_1005672831 | 212 |
| 100 | 3300005718 | Ga0068866_10018488 | Ga0068866_100184882 | 212 |
| 101 | 3300005834 | Ga0068851_10000355 | Ga0068851_1000035517 | 212 |
| 102 | 3300013307 | Ga0157372_10000610 | Ga0157372_1000061036 | 212 |
| 103 | 3300014325 | Ga0163163_10350404 | Ga0163163_103504043 | 212 |
| 104 | 3300014326 | Ga0157380_10241427 | Ga0157380_102414272 | 212 |
| 105 | 3300028563 | Ga0265319_1000073 | Ga0265319_100007340 | 212 |
| 106 | 3300028800 | Ga0265338_10000464 | Ga0265338_1000046418 | 212 |
| 107 | 3300031238 | Ga0265332_10069480 | Ga0265332_100694801 | 212 |
| 108 | 3300031250 | Ga0265331_10138755 | Ga0265331_101387552 | 212 |
| 109 | 3300046455 | Ga0495603_0006955 | Ga0495603_0006955_47_733 | 212 |
| 110 | 3300047317 | Ga0495604_0003881 | Ga0495604_0003881_6286_6972 | 212 |
| 111 | 3300047472 | Ga0495686_0025251 | Ga0495686_0025251_1276_1965 | 212 |
| 112 | 3300048911 | Ga0496108_0192610 | Ga0496108_0192610_208_909 | 212 |
| 113 | 3300048912 | Ga0496109_0000318 | Ga0496109_0000318_13007_13705 | 212 |
| 114 | 3300048913 | Ga0496110_0109245 | Ga0496110_0109245_1438_2139 | 212 |
| 115 | 3300048913 | Ga0496110_0807586 | Ga0496110_0807586_21_722 | 212 |
| 116 | 3300048916 | Ga0496113_0107298 | Ga0496113_0107298_1152_1853 | 212 |
| 117 | 3300049741 | Ga0501079_0709576 | Ga0501079_0709576_38_727 | 212 |
| 118 | 3300049823 | Ga0501044_0126309 | Ga0501044_0126309_1263_1949 | 212 |
| 119 | 3300053077 | Ga0495601_0017961 | Ga0495601_0017961_2688_3398 | 212 |
| 120 | 3300005457 | Ga0070662_100535599 | Ga0070662_1005355992 | 213 |
| 121 | 3300005719 | Ga0068861_100044546 | Ga0068861_1000445462 | 213 |
| 122 | 3300009553 | Ga0105249_10185205 | Ga0105249_101852052 | 213 |
| 123 | 3300013306 | Ga0163162_10423655 | Ga0163162_104236553 | 213 |
| 124 | 3300025933 | Ga0207706_10242227 | Ga0207706_102422273 | 213 |
| 125 | 3300025961 | Ga0207712_10058002 | Ga0207712_100580022 | 213 |
| 126 | 3300044842 | Ga0466957_0083399 | Ga0466957_0083399_391_1032 | 213 |
| 127 | 3300045049 | Ga0466959_0024122 | Ga0466959_0024122_2864_3529 | 213 |
| 128 | 3300045836 | Ga0466958_0294571 | Ga0466958_0294571_325_990 | 213 |
| 129 | 3300045976 | Ga0466967_0035295 | Ga0466967_0035295_2219_2887 | 213 |
| 130 | 3300045976 | Ga0466967_0552445 | Ga0466967_0552445_281_949 | 213 |
| 131 | 3300001991 | JGI24743J22301_10004425 | JGI24743J22301_100044253 | 214 |
| 132 | 3300002075 | JGI24738J21930_10030308 | JGI24738J21930_100303081 | 214 |
| 133 | 3300005329 | Ga0070683_100008934 | Ga0070683_1000089346 | 214 |
| 134 | 3300005329 | Ga0070683_100124864 | Ga0070683_1001248644 | 214 |
| 135 | 3300005329 | Ga0070683_100797032 | Ga0070683_1007970321 | 214 |
| 136 | 3300005334 | Ga0068869_100155674 | Ga0068869_1001556742 | 214 |
| 137 | 3300005337 | Ga0070682_100053771 | Ga0070682_1000537713 | 214 |
| 138 | 3300005337 | Ga0070682_100065405 | Ga0070682_1000654053 | 214 |
| 139 | 3300005338 | Ga0068868_100025876 | Ga0068868_1000258764 | 214 |
| 140 | 3300005338 | Ga0068868_100310477 | Ga0068868_1003104772 | 214 |
| 141 | 3300005338 | Ga0068868_100724704 | Ga0068868_1007247042 | 214 |
| 142 | 3300005339 | Ga0070660_100443373 | Ga0070660_1004433733 | 214 |
| 143 | 3300005340 | Ga0070689_100060629 | Ga0070689_1000606293 | 214 |
| 144 | 3300005340 | Ga0070689_100283215 | Ga0070689_1002832151 | 214 |
| 145 | 3300005343 | Ga0070687_100177326 | Ga0070687_1001773262 | 214 |
| 146 | 3300005343 | Ga0070687_100216002 | Ga0070687_1002160022 | 214 |
| 147 | 3300005344 | Ga0070661_100239049 | Ga0070661_1002390493 | 214 |
| 148 | 3300005344 | Ga0070661_100253833 | Ga0070661_1002538333 | 214 |
| 149 | 3300005345 | Ga0070692_10080300 | Ga0070692_100803002 | 214 |
| 150 | 3300005347 | Ga0070668_100769440 | Ga0070668_1007694402 | 214 |
| 151 | 3300005353 | Ga0070669_100003124 | Ga0070669_10000312410 | 214 |
| 152 | 3300005353 | Ga0070669_101139181 | Ga0070669_1011391811 | 214 |
| 153 | 3300005354 | Ga0070675_100083284 | Ga0070675_1000832842 | 214 |
| 154 | 3300005366 | Ga0070659_100000013 | Ga0070659_100000013108 | 214 |
| 155 | 3300005366 | Ga0070659_100439379 | Ga0070659_1004393791 | 214 |
| 156 | 3300005435 | Ga0070714_100018985 | Ga0070714_1000189853 | 214 |
| 157 | 3300005435 | Ga0070714_100024224 | Ga0070714_1000242245 | 214 |
| 158 | 3300005437 | Ga0070710_10000005 | Ga0070710_10000005198 | 214 |
| 159 | 3300005437 | Ga0070710_10045510 | Ga0070710_100455102 | 214 |
| 160 | 3300005437 | Ga0070710_10234598 | Ga0070710_102345982 | 214 |
| 161 | 3300005438 | Ga0070701_10016821 | Ga0070701_100168214 | 214 |
| 162 | 3300005440 | Ga0070705_100001368 | Ga0070705_1000013686 | 214 |
| 163 | 3300005440 | Ga0070705_100064714 | Ga0070705_1000647143 | 214 |
| 164 | 3300005440 | Ga0070705_100095881 | Ga0070705_1000958812 | 214 |
| 165 | 3300005441 | Ga0070700_100076202 | Ga0070700_1000762023 | 214 |
| 166 | 3300005441 | Ga0070700_100203627 | Ga0070700_1002036272 | 214 |
| 167 | 3300005455 | Ga0070663_100049231 | Ga0070663_1000492313 | 214 |
| 168 | 3300005455 | Ga0070663_100193833 | Ga0070663_1001938333 | 214 |
| 169 | 3300005458 | Ga0070681_10030984 | Ga0070681_100309842 | 214 |
| 170 | 3300005459 | Ga0068867_100314369 | Ga0068867_1003143692 | 214 |
| 171 | 3300005535 | Ga0070684_100164692 | Ga0070684_1001646923 | 214 |
| 172 | 3300005564 | Ga0070664_100057277 | Ga0070664_1000572774 | 214 |
| 173 | 3300005577 | Ga0068857_100099600 | Ga0068857_1000996003 | 214 |
| 174 | 3300005578 | Ga0068854_100149559 | Ga0068854_1001495593 | 214 |
| 175 | 3300005615 | Ga0070702_100010243 | Ga0070702_1000102435 | 214 |
| 176 | 3300005615 | Ga0070702_100065912 | Ga0070702_1000659122 | 214 |
| 177 | 3300005615 | Ga0070702_100134596 | Ga0070702_1001345963 | 214 |
| 178 | 3300005615 | Ga0070702_100236020 | Ga0070702_1002360201 | 214 |
| 179 | 3300005616 | Ga0068852_100105917 | Ga0068852_1001059173 | 214 |
| 180 | 3300005617 | Ga0068859_100127840 | Ga0068859_1001278403 | 214 |
| 181 | 3300005618 | Ga0068864_100299982 | Ga0068864_1002999822 | 214 |
| 182 | 3300005719 | Ga0068861_100474352 | Ga0068861_1004743521 | 214 |
| 183 | 3300005841 | Ga0068863_100400756 | Ga0068863_1004007562 | 214 |
| 184 | 3300005844 | Ga0068862_100768606 | Ga0068862_1007686061 | 214 |
| 185 | 3300006028 | Ga0070717_10000004 | Ga0070717_10000004303 | 214 |
| 186 | 3300006058 | Ga0075432_10040636 | Ga0075432_100406363 | 214 |
| 187 | 3300006175 | Ga0070712_100000002 | Ga0070712_100000002145 | 214 |
| 188 | 3300006175 | Ga0070712_100112281 | Ga0070712_1001122812 | 214 |
| 189 | 3300006175 | Ga0070712_100138418 | Ga0070712_1001384183 | 214 |
| 190 | 3300006175 | Ga0070712_100188130 | Ga0070712_1001881302 | 214 |
| 191 | 3300006358 | Ga0068871_100619176 | Ga0068871_1006191761 | 214 |
| 192 | 3300006852 | Ga0075433_10373204 | Ga0075433_103732042 | 214 |
| 193 | 3300006880 | Ga0075429_100007783 | Ga0075429_1000077838 | 214 |
| 194 | 3300006881 | Ga0068865_100118785 | Ga0068865_1001187853 | 214 |
| 195 | 3300006881 | Ga0068865_100223118 | Ga0068865_1002231181 | 214 |
| 196 | 3300006931 | Ga0097620_100127843 | Ga0097620_1001278433 | 214 |
| 197 | 3300009094 | Ga0111539_10311544 | Ga0111539_103115442 | 214 |
| 198 | 3300009098 | Ga0105245_10040845 | Ga0105245_100408453 | 214 |
| 199 | 3300009098 | Ga0105245_10045363 | Ga0105245_100453633 | 214 |
| 200 | 3300009098 | Ga0105245_10193319 | Ga0105245_101933193 | 214 |
| 201 | 3300009098 | Ga0105245_10892431 | Ga0105245_108924312 | 214 |
| 202 | 3300009101 | Ga0105247_10013548 | Ga0105247_100135483 | 214 |
| 203 | 3300009101 | Ga0105247_10482714 | Ga0105247_104827141 | 214 |
| 204 | 3300009148 | Ga0105243_10039263 | Ga0105243_100392633 | 214 |
| 205 | 3300009148 | Ga0105243_10111682 | Ga0105243_101116823 | 214 |
| 206 | 3300009148 | Ga0105243_10241364 | Ga0105243_102413642 | 214 |
| 207 | 3300009551 | Ga0105238_10637092 | Ga0105238_106370921 | 214 |
| 208 | 3300010375 | Ga0105239_10063476 | Ga0105239_100634763 | 214 |
| 209 | 3300010375 | Ga0105239_10383943 | Ga0105239_103839432 | 214 |
| 210 | 3300011119 | Ga0105246_10169834 | Ga0105246_101698341 | 214 |
| 211 | 3300011119 | Ga0105246_10573901 | Ga0105246_105739012 | 214 |
| 212 | 3300011119 | Ga0105246_10693281 | Ga0105246_106932812 | 214 |
| 213 | 3300013296 | Ga0157374_11410933 | Ga0157374_114109331 | 214 |
| 214 | 3300013297 | Ga0157378_10097975 | Ga0157378_100979753 | 214 |
| 215 | 3300013306 | Ga0163162_10466022 | Ga0163162_104660223 | 214 |
| 216 | 3300013307 | Ga0157372_10327606 | Ga0157372_103276062 | 214 |
| 217 | 3300014325 | Ga0163163_10041285 | Ga0163163_100412853 | 214 |
| 218 | 3300014745 | Ga0157377_10019123 | Ga0157377_100191233 | 214 |
| 219 | 3300014969 | Ga0157376_10057464 | Ga0157376_100574641 | 214 |
| 220 | 3300014969 | Ga0157376_10132927 | Ga0157376_101329273 | 214 |
| 221 | 3300020070 | Ga0206356_10446832 | Ga0206356_104468323 | 214 |
| 222 | 3300025898 | Ga0207692_10000009 | Ga0207692_10000009108 | 214 |
| 223 | 3300025898 | Ga0207692_10266928 | Ga0207692_102669282 | 214 |
| 224 | 3300025899 | Ga0207642_10006046 | Ga0207642_100060463 | 214 |
| 225 | 3300025901 | Ga0207688_10041543 | Ga0207688_100415431 | 214 |
| 226 | 3300025904 | Ga0207647_10057483 | Ga0207647_100574832 | 214 |
| 227 | 3300025906 | Ga0207699_10053418 | Ga0207699_100534182 | 214 |
| 228 | 3300025908 | Ga0207643_10029871 | Ga0207643_100298712 | 214 |
| 229 | 3300025912 | Ga0207707_10031723 | Ga0207707_100317232 | 214 |
| 230 | 3300025915 | Ga0207693_10001761 | Ga0207693_1000176117 | 214 |
| 231 | 3300025915 | Ga0207693_10033646 | Ga0207693_100336464 | 214 |
| 232 | 3300025915 | Ga0207693_10058643 | Ga0207693_100586433 | 214 |
| 233 | 3300025915 | Ga0207693_10125584 | Ga0207693_101255843 | 214 |
| 234 | 3300025916 | Ga0207663_10575578 | Ga0207663_105755781 | 214 |
| 235 | 3300025918 | Ga0207662_10023408 | Ga0207662_100234083 | 214 |
| 236 | 3300025918 | Ga0207662_10190323 | Ga0207662_101903233 | 214 |
| 237 | 3300025919 | Ga0207657_10041030 | Ga0207657_100410303 | 214 |
| 238 | 3300025919 | Ga0207657_10067420 | Ga0207657_100674202 | 214 |
| 239 | 3300025920 | Ga0207649_10373456 | Ga0207649_103734563 | 214 |
| 240 | 3300025923 | Ga0207681_10344490 | Ga0207681_103444903 | 214 |
| 241 | 3300025926 | Ga0207659_10040429 | Ga0207659_100404293 | 214 |
| 242 | 3300025927 | Ga0207687_10051003 | Ga0207687_100510033 | 214 |
| 243 | 3300025927 | Ga0207687_10072897 | Ga0207687_100728973 | 214 |
| 244 | 3300025929 | Ga0207664_10001425 | Ga0207664_1000142510 | 214 |
| 245 | 3300025929 | Ga0207664_10366770 | Ga0207664_103667702 | 214 |
| 246 | 3300025932 | Ga0207690_10000017 | Ga0207690_10000017200 | 214 |
| 247 | 3300025932 | Ga0207690_10215978 | Ga0207690_102159782 | 214 |
| 248 | 3300025934 | Ga0207686_10154723 | Ga0207686_101547233 | 214 |
| 249 | 3300025936 | Ga0207670_10228936 | Ga0207670_102289362 | 214 |
| 250 | 3300025938 | Ga0207704_10028448 | Ga0207704_100284483 | 214 |
| 251 | 3300025941 | Ga0207711_10257185 | Ga0207711_102571853 | 214 |
| 252 | 3300025942 | Ga0207689_10020265 | Ga0207689_100202656 | 214 |
| 253 | 3300025942 | Ga0207689_10060407 | Ga0207689_100604073 | 214 |
| 254 | 3300025944 | Ga0207661_10027579 | Ga0207661_100275794 | 214 |
| 255 | 3300025945 | Ga0207679_10371750 | Ga0207679_103717503 | 214 |
| 256 | 3300025945 | Ga0207679_10435473 | Ga0207679_104354732 | 214 |
| 257 | 3300025972 | Ga0207668_10422120 | Ga0207668_104221203 | 214 |
| 258 | 3300025981 | Ga0207640_10324456 | Ga0207640_103244562 | 214 |
| 259 | 3300026023 | Ga0207677_10032538 | Ga0207677_100325383 | 214 |
| 260 | 3300026023 | Ga0207677_10190609 | Ga0207677_101906093 | 214 |
| 261 | 3300026075 | Ga0207708_10065923 | Ga0207708_100659233 | 214 |
| 262 | 3300026075 | Ga0207708_10322445 | Ga0207708_103224452 | 214 |
| 263 | 3300026089 | Ga0207648_10403709 | Ga0207648_104037092 | 214 |
| 264 | 3300026116 | Ga0207674_10023509 | Ga0207674_100235098 | 214 |
| 265 | 3300026116 | Ga0207674_10359153 | Ga0207674_103591533 | 214 |
| 266 | 3300026118 | Ga0207675_100564134 | Ga0207675_1005641343 | 214 |
| 267 | 3300026118 | Ga0207675_100881169 | Ga0207675_1008811692 | 214 |
| 268 | 3300026142 | Ga0207698_10192808 | Ga0207698_101928083 | 214 |
| 269 | 3300026142 | Ga0207698_10393301 | Ga0207698_103933013 | 214 |
| 270 | 3300026142 | Ga0207698_11177282 | Ga0207698_111772821 | 214 |
| 271 | 3300027907 | Ga0207428_10243867 | Ga0207428_102438673 | 214 |
| 272 | 3300028381 | Ga0268264_10026624 | Ga0268264_100266242 | 214 |
| 273 | 3300028558 | Ga0265326_10050232 | Ga0265326_100502322 | 214 |
| 274 | 3300028563 | Ga0265319_1000118 | Ga0265319_100011850 | 214 |
| 275 | 3300028563 | Ga0265319_1003066 | Ga0265319_10030663 | 214 |
| 276 | 3300028800 | Ga0265338_10154509 | Ga0265338_101545092 | 214 |
| 277 | 3300031235 | Ga0265330_10106191 | Ga0265330_101061912 | 214 |
| 278 | 3300031240 | Ga0265320_10038599 | Ga0265320_100385993 | 214 |
| 279 | 3300031251 | Ga0265327_10054170 | Ga0265327_100541702 | 214 |
| 280 | 3300031995 | Ga0307409_100251208 | Ga0307409_1002512083 | 214 |
| 281 | 3300032002 | Ga0307416_100345713 | Ga0307416_1003457133 | 214 |
| 282 | 3300032126 | Ga0307415_100512938 | Ga0307415_1005129382 | 214 |
| 283 | 3300037853 | Ga0436364_0737248 | Ga0436364_0737248_8255_8950 | 214 |
| 284 | 3300038443 | Ga0395901_0528008 | Ga0395901_0528008_329_1012 | 214 |
| 285 | 3300044693 | Ga0466961_0121255 | Ga0466961_0121255_375_1070 | 214 |
| 286 | 3300044765 | Ga0466970_0276773 | Ga0466970_0276773_155_850 | 214 |
| 287 | 3300044901 | Ga0466960_0013930 | Ga0466960_0013930_2063_2707 | 214 |
| 288 | 3300044901 | Ga0466960_0034840 | Ga0466960_0034840_1025_1669 | 214 |
| 289 | 3300044901 | Ga0466960_0111586 | Ga0466960_0111586_261_905 | 214 |
| 290 | 3300045836 | Ga0466958_0005233 | Ga0466958_0005233_2426_3208 | 214 |
| 291 | 3300045836 | Ga0466958_0219890 | Ga0466958_0219890_111_797 | 214 |
| 292 | 3300045976 | Ga0466967_0048329 | Ga0466967_0048329_2641_3285 | 214 |
| 293 | 3300045976 | Ga0466967_0058619 | Ga0466967_0058619_1461_2105 | 214 |
| 294 | 3300045976 | Ga0466967_0222522 | Ga0466967_0222522_148_792 | 214 |
| 295 | 3300045976 | Ga0466967_0609885 | Ga0466967_0609885_326_1033 | 214 |
| 296 | 3300046477 | Ga0495664_0000025 | Ga0495664_0000025_7531_8214 | 214 |
| 297 | 3300046529 | Ga0495652_0088765 | Ga0495652_0088765_12_695 | 214 |
| 298 | 3300046536 | Ga0495587_0187803 | Ga0495587_0187803_46_732 | 214 |
| 299 | 3300046543 | Ga0495645_0000463 | Ga0495645_0000463_24644_25366 | 214 |
| 300 | 3300046681 | Ga0495647_0188440 | Ga0495647_0188440_132_821 | 214 |
| 301 | 3300047315 | Ga0495581_0276323 | Ga0495581_0276323_190_879 | 214 |
| 302 | 3300047317 | Ga0495604_0212774 | Ga0495604_0212774_154_861 | 214 |
| 303 | 3300047320 | Ga0495672_0007449 | Ga0495672_0007449_6055_6747 | 214 |
| 304 | 3300047320 | Ga0495672_0047954 | Ga0495672_0047954_354_1037 | 214 |
| 305 | 3300047471 | Ga0495684_0001866 | Ga0495684_0001866_13576_14265 | 214 |
| 306 | 3300048903 | Ga0496100_0177281 | Ga0496100_0177281_89_733 | 214 |
| 307 | 3300048903 | Ga0496100_0304654 | Ga0496100_0304654_455_1180 | 214 |
| 308 | 3300048903 | Ga0496100_0444110 | Ga0496100_0444110_19_663 | 214 |
| 309 | 3300048904 | Ga0496101_0100296 | Ga0496101_0100296_235_960 | 214 |
| 310 | 3300048905 | Ga0496102_0000002 | Ga0496102_0000002_124451_125134 | 214 |
| 311 | 3300048905 | Ga0496102_0253727 | Ga0496102_0253727_967_1611 | 214 |
| 312 | 3300048905 | Ga0496102_0833374 | Ga0496102_0833374_31_675 | 214 |
| 313 | 3300048906 | Ga0496103_0000047 | Ga0496103_0000047_24868_25551 | 214 |
| 314 | 3300048906 | Ga0496103_0175082 | Ga0496103_0175082_86_730 | 214 |
| 315 | 3300048909 | Ga0496106_0184203 | Ga0496106_0184203_586_1311 | 214 |
| 316 | 3300048909 | Ga0496106_0185946 | Ga0496106_0185946_767_1411 | 214 |
| 317 | 3300048911 | Ga0496108_0087514 | Ga0496108_0087514_1361_2047 | 214 |
| 318 | 3300048912 | Ga0496109_0047152 | Ga0496109_0047152_344_1030 | 214 |
| 319 | 3300048912 | Ga0496109_0349273 | Ga0496109_0349273_211_936 | 214 |
| 320 | 3300048913 | Ga0496110_0063284 | Ga0496110_0063284_1487_2131 | 214 |
| 321 | 3300048913 | Ga0496110_0114284 | Ga0496110_0114284_1296_2021 | 214 |
| 322 | 3300048914 | Ga0496111_0098190 | Ga0496111_0098190_773_1417 | 214 |
| 323 | 3300048915 | Ga0496112_0005877 | Ga0496112_0005877_8754_9446 | 214 |
| 324 | 3300048916 | Ga0496113_0067862 | Ga0496113_0067862_373_1017 | 214 |
| 325 | 3300048916 | Ga0496113_0269341 | Ga0496113_0269341_338_1018 | 214 |
| 326 | 3300048927 | Ga0496124_0122853 | Ga0496124_0122853_18_710 | 214 |
| 327 | 3300049578 | Ga0501042_0167794 | Ga0501042_0167794_14_694 | 214 |
| 328 | 3300049583 | Ga0501067_0142027 | Ga0501067_0142027_672_1319 | 214 |
| 329 | 3300049583 | Ga0501067_0297517 | Ga0501067_0297517_79_723 | 214 |
| 330 | 3300049585 | Ga0501069_0142789 | Ga0501069_0142789_37_681 | 214 |
| 331 | 3300050508 | nmdc:mga09592_3784_c1 | nmdc:mga09592_3784_c1_9469_10164 | 214 |
| 332 | 3300050511 | nmdc:mga08y16_71613_c1 | nmdc:mga08y16_71613_c1_1777_2421 | 214 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5umf-assembly1.cif.gz_C | crystal structure of a ribulose-phosphate 3-epimerase from neisseria gonorrhoeae with bound phosphate | 0.9766 | 3 | 212 |
| 7sbj-assembly1.cif.gz_C | crystal structure of ribulose-phosphate 3-epimerase from stenotrophomonas maltophilia k279a | 0.9626 | 4 | 212 |
| 7b1w-assembly2.cif.gz_K-3 | crystal structure of plastidial ribulose epimerase rpe1 from the model alga chlamydomonas reinhardtii | 0.957 | 2 | 207 |
| 5umf-assembly1.cif.gz_C | crystal structure of a ribulose-phosphate 3-epimerase from neisseria gonorrhoeae with bound phosphate | 0.9543 | 3 | 212 |
| 1rpx-assembly1.cif.gz_A | d-ribulose-5-phosphate 3-epimerase from solanum tuberosum chloroplasts | 0.9542 | 2 | 210 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AG07_1_223_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9699 | 1 | 212 | 3.20.20.70 |
| af_A0A1D6PJ99_41_293_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9596 | 2 | 203 | 3.20.20.70 |
| af_Q58093_1_217_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9587 | 3 | 211 | 3.20.20.70 |
| af_P0AG07_1_223_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9566 | 1 | 212 | 3.20.20.70 |
| 2fliC00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9508 | 1 | 212 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7K0RIV7-F1-model_v4 | Ribulose-phosphate 3-epimerase (EC 5.1.3.1) | 0.9927 | 1 | 211 |
GO:0004750
GO:0006098 GO:0019323 GO:0046872 |
| AF-H0E3V1-F1-model_v4 | Ribulose-phosphate 3-epimerase (EC 5.1.3.1) | 0.9876 | 2 | 212 |
GO:0004750
GO:0006098 GO:0019323 GO:0046872 |
| AF-A0A2W6CAP4-F1-model_v4 | Ribulose-phosphate 3-epimerase (EC 5.1.3.1) | 0.9863 | 6 | 214 |
GO:0004750
GO:0006098 GO:0019323 GO:0046872 |
| AF-A0A7W0US68-F1-model_v4 | Ribulose-phosphate 3-epimerase (EC 5.1.3.1) | 0.9846 | 2 | 213 |
GO:0004750
GO:0006098 GO:0019323 GO:0046872 |
| AF-A0A2T4UD53-F1-model_v4 | Ribulose-phosphate 3-epimerase (EC 5.1.3.1) | 0.9825 | 1 | 214 |
GO:0004750
GO:0006098 GO:0019323 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar