F411049

General Info

Members Datasets Scaffolds Average Seq Length
332 201 332 221

Family's Representative Sequence

Representative Sequence 3300045836|Ga0466958_0005233|Ga0466958_0005233_2426_3208
Length 260
Sequence MPELRRALDDGADVEHRHPGLQSLPRQHAAGGLVDPALLRERRVAPSILSADFSRLADQLDIVLSAGARVIHFDVMDGHFVPPITIGALVLRSIAERVHDAGAIIDVHLMVERPERHIDAFAGAGADAITVHAEATPHLQYALAMIRDAGCTAGAAVNPGTPASALDEVAEDSLDLALCMSVNPGWGGQSFLPASVAKLARMRKALPDHVALEVDGGIHVDTAGTAAGAGANLLVAGSAVFGSSDPADTYRRIAAAAWES

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
124 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
125 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
126 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
127 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
130 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
131 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
132 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
133 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
134 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
139 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
140 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
148 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
149 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
150 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
156 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
157 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
160 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
161 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
162 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
163 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
164 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
165 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
168 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
169 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
186 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
188 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
189 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
190 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
193 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
201 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.51
Nodule 0
Rhizoplane 9.94
Rhizosphere 87.65
Stem 0
Stem Tuber 0
Unclassified 0.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10004425 3300001991 Bacteria 2291
2 JGI24738J21930_10030308 3300002075 Bacteria 1105
3 Ga0070683_100008934 3300005329 Bacteria 8538
4 Ga0070683_100124864 3300005329 Bacteria 2433
5 Ga0070683_100797032 3300005329 Bacteria 905
6 Ga0068869_100155674 3300005334 Bacteria 1775
7 Ga0068869_100204109 3300005334 Bacteria 1560
8 Ga0070682_100000708 3300005337 Bacteria 19980
9 Ga0070682_100053771 3300005337 Bacteria 2525
10 Ga0070682_100065405 3300005337 Bacteria 2310
11 Ga0070682_100096577 3300005337 Bacteria 1943
12 Ga0068868_100025876 3300005338 Bacteria 4467
13 Ga0068868_100310477 3300005338 Bacteria 1341
14 Ga0068868_100724704 3300005338 Bacteria 891
15 Ga0070660_100443373 3300005339 Bacteria 1077
16 Ga0070689_100060629 3300005340 Bacteria 2942
17 Ga0070689_100214962 3300005340 Bacteria 1575
18 Ga0070689_100283215 3300005340 Bacteria 1375
19 Ga0070687_100177326 3300005343 Bacteria 1273
20 Ga0070687_100216002 3300005343 Bacteria 1171
21 Ga0070661_100000223 3300005344 Bacteria 46956
22 Ga0070661_100239049 3300005344 Bacteria 1398
23 Ga0070661_100253833 3300005344 Bacteria 1358
24 Ga0070692_10007716 3300005345 Bacteria 4760
25 Ga0070692_10080300 3300005345 Bacteria 1755
26 Ga0070668_100769440 3300005347 Bacteria 853
27 Ga0070669_100003124 3300005353 Bacteria 11913
28 Ga0070669_100079964 3300005353 Bacteria 2432
29 Ga0070669_101139181 3300005353 Bacteria 673
30 Ga0070675_100083284 3300005354 Bacteria 2670
31 Ga0070659_100000013 3300005366 Bacteria 178795
32 Ga0070659_100030241 3300005366 Bacteria 4190
33 Ga0070659_100198603 3300005366 Bacteria 1650
34 Ga0070659_100439379 3300005366 Bacteria 1105
35 Ga0070714_100018985 3300005435 Bacteria 5595
36 Ga0070714_100024224 3300005435 Bacteria 4994
37 Ga0070713_100082335 3300005436 Bacteria 2747
38 Ga0070713_100252899 3300005436 Bacteria 1608
39 Ga0070710_10000005 3300005437 Bacteria 238049
40 Ga0070710_10045510 3300005437 Bacteria 2440
41 Ga0070710_10234598 3300005437 Bacteria 1173
42 Ga0070701_10016821 3300005438 Bacteria 3407
43 Ga0070705_100001368 3300005440 Bacteria 13011
44 Ga0070705_100064714 3300005440 Bacteria 2186
45 Ga0070705_100095881 3300005440 Bacteria 1861
46 Ga0070700_100076202 3300005441 Bacteria 2153
47 Ga0070700_100203627 3300005441 Bacteria 1392
48 Ga0070694_100098527 3300005444 Bacteria 2064
49 Ga0070708_100248494 3300005445 Bacteria 1671
50 Ga0070663_100004117 3300005455 Bacteria 8494
51 Ga0070663_100049231 3300005455 Bacteria 2991
52 Ga0070663_100193833 3300005455 Bacteria 1583
53 Ga0070662_100535599 3300005457 Bacteria 980
54 Ga0070681_10030984 3300005458 Bacteria 5369
55 Ga0068867_100314369 3300005459 Bacteria 1295
56 Ga0070706_100112518 3300005467 Bacteria 2534
57 Ga0070707_100099642 3300005468 Unclassified 2815
58 Ga0070698_100124374 3300005471 Bacteria 2536
59 Ga0070699_100058294 3300005518 Bacteria 3345
60 Ga0070699_100137477 3300005518 Bacteria 2156
61 Ga0070699_100266763 3300005518 Bacteria 1532
62 Ga0070684_100164692 3300005535 Bacteria 2012
63 Ga0070684_100567283 3300005535 Bacteria 1054
64 Ga0070693_100000643 3300005547 Bacteria 15385
65 Ga0070704_100009053 3300005549 Bacteria 6005
66 Ga0070664_100057277 3300005564 Bacteria 3313
67 Ga0068857_100099600 3300005577 Bacteria 2607
68 Ga0068854_100149559 3300005578 Bacteria 1799
69 Ga0068856_100000889 3300005614 Bacteria 32019
70 Ga0070702_100010243 3300005615 Bacteria 4611
71 Ga0070702_100065912 3300005615 Bacteria 2122
72 Ga0070702_100134596 3300005615 Bacteria 1566
73 Ga0070702_100236020 3300005615 Bacteria 1232
74 Ga0068852_100105917 3300005616 Bacteria 2548
75 Ga0068859_100127840 3300005617 Bacteria 2611
76 Ga0068864_100299982 3300005618 Bacteria 1504
77 Ga0068866_10018488 3300005718 Bacteria 3153
78 Ga0068861_100044546 3300005719 Bacteria 3337
79 Ga0068861_100167119 3300005719 Bacteria 1820
80 Ga0068861_100474352 3300005719 Bacteria 1126
81 Ga0068851_10000355 3300005834 Bacteria 20703
82 Ga0068863_100228148 3300005841 Bacteria 1796
83 Ga0068863_100400756 3300005841 Bacteria 1342
84 Ga0068863_100461670 3300005841 Bacteria 1247
85 Ga0068858_100432060 3300005842 Bacteria 1267
86 Ga0068860_100006538 3300005843 Bacteria 11699
87 Ga0068862_100096728 3300005844 Bacteria 2577
88 Ga0068862_100768606 3300005844 Bacteria 938
89 Ga0081455_10066896 3300005937 Bacteria 2997
90 Ga0070717_10000004 3300006028 Bacteria 365525
91 Ga0075365_10169163 3300006038 Bacteria 1525
92 Ga0075365_10229761 3300006038 Bacteria 1302
93 Ga0075432_10040636 3300006058 Bacteria 1624
94 Ga0070712_100000002 3300006175 Bacteria 288475
95 Ga0070712_100112281 3300006175 Bacteria 2036
96 Ga0070712_100138418 3300006175 Bacteria 1854
97 Ga0070712_100188130 3300006175 Bacteria 1613
98 Ga0068871_100619176 3300006358 Bacteria 986
99 Ga0075433_10185290 3300006852 Bacteria 1852
100 Ga0075433_10373204 3300006852 Bacteria 1260
101 Ga0075429_100007783 3300006880 Bacteria 9305
102 Ga0068865_100118785 3300006881 Bacteria 1962
103 Ga0068865_100223118 3300006881 Bacteria 1474
104 Ga0097620_100127843 3300006931 Bacteria 2611
105 Ga0111539_10311544 3300009094 Bacteria 1832
106 Ga0105245_10040845 3300009098 Bacteria 4134
107 Ga0105245_10045363 3300009098 Bacteria 3926
108 Ga0105245_10193319 3300009098 Bacteria 1950
109 Ga0105245_10587742 3300009098 Bacteria 1139
110 Ga0105245_10892431 3300009098 Bacteria 930
111 Ga0105247_10013548 3300009101 Bacteria 4890
112 Ga0105247_10482714 3300009101 Bacteria 900
113 Ga0114129_10001714 3300009147 Bacteria 29925
114 Ga0105243_10039263 3300009148 Bacteria 3689
115 Ga0105243_10111682 3300009148 Bacteria 2288
116 Ga0105243_10241364 3300009148 Bacteria 1608
117 Ga0105238_10637092 3300009551 Bacteria 1075
118 Ga0105249_10039194 3300009553 Bacteria 4301
119 Ga0105249_10185205 3300009553 Bacteria 2028
120 Ga0105239_10063476 3300010375 Bacteria 4056
121 Ga0105239_10383943 3300010375 Bacteria 1588
122 Ga0105246_10169834 3300011119 Bacteria 1669
123 Ga0105246_10573901 3300011119 Bacteria 970
124 Ga0105246_10693281 3300011119 Bacteria 892
125 Ga0157374_11410933 3300013296 Bacteria 719
126 Ga0157378_10097975 3300013297 Bacteria 2673
127 Ga0163162_10423655 3300013306 Bacteria 1463
128 Ga0163162_10466022 3300013306 Unclassified 1395
129 Ga0157372_10000610 3300013307 Bacteria 39073
130 Ga0157372_10327606 3300013307 Bacteria 1783
131 Ga0163163_10041285 3300014325 Bacteria 4510
132 Ga0163163_10350404 3300014325 Bacteria 1533
133 Ga0163163_10808318 3300014325 Bacteria 1001
134 Ga0157380_10241427 3300014326 Bacteria 1629
135 Ga0157377_10019123 3300014745 Bacteria 3575
136 Ga0157379_10123326 3300014968 Bacteria 2332
137 Ga0157376_10057464 3300014969 Bacteria 3254
138 Ga0157376_10132927 3300014969 Bacteria 2223
139 Ga0157376_10140793 3300014969 Bacteria 2164
140 Ga0206356_10446832 3300020070 Bacteria 2535
141 Ga0207692_10000009 3300025898 Bacteria 159859
142 Ga0207692_10266928 3300025898 Bacteria 1031
143 Ga0207642_10006046 3300025899 Bacteria 3999
144 Ga0207688_10041543 3300025901 Bacteria 2559
145 Ga0207647_10057483 3300025904 Bacteria 2385
146 Ga0207685_10221183 3300025905 Bacteria 900
147 Ga0207699_10053418 3300025906 Bacteria 2395
148 Ga0207643_10029871 3300025908 Bacteria 3032
149 Ga0207684_10017754 3300025910 Bacteria 6104
150 Ga0207684_10027942 3300025910 Bacteria 4805
151 Ga0207707_10031723 3300025912 Bacteria 4625
152 Ga0207693_10001761 3300025915 Bacteria 18999
153 Ga0207693_10033646 3300025915 Bacteria 4044
154 Ga0207693_10058643 3300025915 Bacteria 3015
155 Ga0207693_10125584 3300025915 Bacteria 2017
156 Ga0207663_10575578 3300025916 Bacteria 883
157 Ga0207662_10023408 3300025918 Bacteria 3548
158 Ga0207662_10190323 3300025918 Bacteria 1324
159 Ga0207657_10041030 3300025919 Bacteria 4095
160 Ga0207657_10067420 3300025919 Bacteria 3043
161 Ga0207649_10373456 3300025920 Bacteria 1061
162 Ga0207646_10010873 3300025922 Bacteria 8847
163 Ga0207681_10344490 3300025923 Bacteria 1191
164 Ga0207681_10471178 3300025923 Bacteria 1024
165 Ga0207659_10040429 3300025926 Bacteria 3261
166 Ga0207687_10051003 3300025927 Bacteria 2883
167 Ga0207687_10072897 3300025927 Bacteria 2458
168 Ga0207687_10138621 3300025927 Bacteria 1843
169 Ga0207700_10050428 3300025928 Bacteria 3102
170 Ga0207700_10179909 3300025928 Bacteria 1770
171 Ga0207664_10001425 3300025929 Bacteria 15730
172 Ga0207664_10366770 3300025929 Bacteria 1277
173 Ga0207690_10000017 3300025932 Bacteria 243513
174 Ga0207690_10215978 3300025932 Bacteria 1465
175 Ga0207706_10242227 3300025933 Bacteria 1576
176 Ga0207686_10154723 3300025934 Bacteria 1600
177 Ga0207670_10228936 3300025936 Bacteria 1426
178 Ga0207704_10028448 3300025938 Bacteria 3101
179 Ga0207711_10257185 3300025941 Bacteria 1604
180 Ga0207689_10020265 3300025942 Bacteria 5600
181 Ga0207689_10060407 3300025942 Bacteria 3117
182 Ga0207661_10027579 3300025944 Bacteria 4339
183 Ga0207661_10109221 3300025944 Bacteria 2336
184 Ga0207679_10371750 3300025945 Bacteria 1251
185 Ga0207679_10435473 3300025945 Bacteria 1160
186 Ga0207712_10058002 3300025961 Bacteria 2734
187 Ga0207668_10422120 3300025972 Bacteria 1132
188 Ga0207640_10324456 3300025981 Bacteria 1227
189 Ga0207677_10032538 3300026023 Bacteria 3354
190 Ga0207677_10190609 3300026023 Bacteria 1621
191 Ga0207678_10013196 3300026067 Bacteria 7249
192 Ga0207678_10499339 3300026067 Bacteria 1060
193 Ga0207708_10065923 3300026075 Bacteria 2768
194 Ga0207708_10322445 3300026075 Bacteria 1261
195 Ga0207702_10001782 3300026078 Bacteria 21206
196 Ga0207641_10062400 3300026088 Bacteria 3180
197 Ga0207641_10651462 3300026088 Bacteria 1034
198 Ga0207648_10403709 3300026089 Bacteria 1239
199 Ga0207674_10023509 3300026116 Bacteria 6599
200 Ga0207674_10359153 3300026116 Bacteria 1408
201 Ga0207675_100037327 3300026118 Bacteria 4532
202 Ga0207675_100564134 3300026118 Bacteria 1139
203 Ga0207675_100881169 3300026118 Bacteria 911
204 Ga0207698_10192808 3300026142 Bacteria 1817
205 Ga0207698_10393301 3300026142 Bacteria 1322
206 Ga0207698_11177282 3300026142 Bacteria 780
207 Ga0207428_10243867 3300027907 Bacteria 1342
208 Ga0268265_10164628 3300028380 Bacteria 1888
209 Ga0268264_10019943 3300028381 Bacteria 5477
210 Ga0268264_10026624 3300028381 Bacteria 4726
211 Ga0265326_10000045 3300028558 Bacteria 79810
212 Ga0265326_10050232 3300028558 Bacteria 1181
213 Ga0265319_1000073 3300028563 Bacteria 81138
214 Ga0265319_1000118 3300028563 Bacteria 60393
215 Ga0265319_1003066 3300028563 Bacteria 8843
216 Ga0265334_10000012 3300028573 Bacteria 174358
217 Ga0265318_10052193 3300028577 Bacteria 1535
218 Ga0265322_10080857 3300028654 Bacteria 922
219 Ga0265338_10000464 3300028800 Bacteria 72259
220 Ga0265338_10007079 3300028800 Bacteria 14059
221 Ga0265338_10071271 3300028800 Bacteria 2974
222 Ga0265338_10154509 3300028800 Bacteria 1779
223 Ga0265324_10007445 3300029957 Bacteria 4432
224 Ga0265330_10106191 3300031235 Bacteria 1201
225 Ga0265332_10069480 3300031238 Bacteria 1501
226 Ga0265320_10038599 3300031240 Bacteria 2394
227 Ga0265331_10138755 3300031250 Bacteria 1106
228 Ga0265327_10023687 3300031251 Bacteria 3629
229 Ga0265327_10054170 3300031251 Bacteria 2077
230 Ga0307409_100251208 3300031995 Bacteria 1617
231 Ga0307416_100345713 3300032002 Bacteria 1503
232 Ga0307415_100512938 3300032126 Bacteria 1051
233 Ga0373929_0049816 3300035085 Bacteria 955
234 Ga0373962_0028642 3300035242 Bacteria 1513
235 Ga0436364_0737248 3300037853 Bacteria 154680
236 Ga0395901_0528008 3300038443 Bacteria 1198
237 Ga0242420_029355 3300038996 Bacteria 1015
238 Ga0436365_0674096 3300039437 Bacteria 3880
239 Ga0436362_0314321 3300039453 Bacteria 4025
240 Ga0451577_0196988 3300042876 Bacteria 1818
241 Ga0466961_0121255 3300044693 Bacteria 1642
242 Ga0466964_0150203 3300044706 Bacteria 1079
243 Ga0466970_0276773 3300044765 Bacteria 943
244 Ga0466957_0083399 3300044842 Bacteria 1994
245 Ga0466960_0013930 3300044901 Bacteria 3427
246 Ga0466960_0034840 3300044901 Bacteria 2349
247 Ga0466960_0058529 3300044901 Bacteria 1882
248 Ga0466960_0111586 3300044901 Bacteria 1421
249 Ga0466959_0024122 3300045049 Bacteria 4503
250 Ga0466959_0063927 3300045049 Bacteria 2672
251 Ga0451576_0146124 3300045051 Bacteria 2465
252 Ga0466958_0005233 3300045836 Bacteria 6952
253 Ga0466958_0219890 3300045836 Bacteria 1212
254 Ga0466958_0294571 3300045836 Bacteria 1041
255 Ga0466967_0000019 3300045976 Bacteria 79629
256 Ga0466967_0035295 3300045976 Bacteria 4254
257 Ga0466967_0048329 3300045976 Bacteria 3714
258 Ga0466967_0058619 3300045976 Bacteria 3404
259 Ga0466967_0222522 3300045976 Bacteria 1794
260 Ga0466967_0247097 3300045976 Bacteria 1703
261 Ga0466967_0552445 3300045976 Bacteria 1133
262 Ga0466967_0609885 3300045976 Bacteria 1078
263 Ga0495603_0006955 3300046455 Bacteria 6786
264 Ga0495664_0000025 3300046477 Bacteria 120941
265 Ga0495608_0065050 3300046511 Bacteria 2389
266 Ga0495652_0088765 3300046529 Bacteria 2533
267 Ga0495587_0187803 3300046536 Bacteria 1171
268 Ga0495645_0000463 3300046543 Bacteria 28033
269 Ga0495625_0181707 3300046660 Bacteria 1398
270 Ga0495647_0188440 3300046681 Bacteria 900
271 Ga0495600_0007859 3300046809 Bacteria 6531
272 Ga0495581_0276323 3300047315 Bacteria 982
273 Ga0495604_0003881 3300047317 Bacteria 11900
274 Ga0495604_0212774 3300047317 Bacteria 1335
275 Ga0495674_0205894 3300047319 Bacteria 1631
276 Ga0495672_0007449 3300047320 Bacteria 8233
277 Ga0495672_0047954 3300047320 Bacteria 2537
278 Ga0495684_0001866 3300047471 Bacteria 16862
279 Ga0495686_0025251 3300047472 Unclassified 3897
280 Ga0496100_0177281 3300048903 Bacteria 1539
281 Ga0496100_0304654 3300048903 Unclassified 1193
282 Ga0496100_0444110 3300048903 Bacteria 994
283 Ga0496101_0100296 3300048904 Unclassified 2166
284 Ga0496102_0000002 3300048905 Bacteria 814588
285 Ga0496102_0036676 3300048905 Bacteria 4418
286 Ga0496102_0253727 3300048905 Bacteria 1658
287 Ga0496102_0833374 3300048905 Bacteria 844
288 Ga0496103_0000047 3300048906 Bacteria 161130
289 Ga0496103_0175082 3300048906 Bacteria 1378
290 Ga0496104_0501035 3300048907 Bacteria 1125
291 Ga0496106_0184203 3300048909 Bacteria 1658
292 Ga0496106_0185946 3300048909 Bacteria 1650
293 Ga0496106_1138296 3300048909 Bacteria 610
294 Ga0496107_0148032 3300048910 Bacteria 1736
295 Ga0496108_0087514 3300048911 Bacteria 2646
296 Ga0496108_0192610 3300048911 Bacteria 1767
297 Ga0496109_0000318 3300048912 Bacteria 45292
298 Ga0496109_0047152 3300048912 Bacteria 3916
299 Ga0496109_0349273 3300048912 Bacteria 1397
300 Ga0496110_0063284 3300048913 Bacteria 3268
301 Ga0496110_0109245 3300048913 Bacteria 2484
302 Ga0496110_0114284 3300048913 Bacteria 2429
303 Ga0496110_0538613 3300048913 Bacteria 1061
304 Ga0496110_0807586 3300048913 Bacteria 842
305 Ga0496111_0098190 3300048914 Bacteria 2150
306 Ga0496112_0005877 3300048915 Bacteria 10690
307 Ga0496113_0067862 3300048916 Bacteria 2705
308 Ga0496113_0107298 3300048916 Bacteria 2170
309 Ga0496113_0269341 3300048916 Bacteria 1361
310 Ga0496114_0000133 3300048917 Bacteria 53994
311 Ga0496115_0000506 3300048918 Bacteria 30541
312 Ga0496115_0239615 3300048918 Bacteria 1495
313 Ga0496124_0122853 3300048927 Bacteria 2072
314 Ga0501042_0167794 3300049578 Bacteria 1584
315 Ga0501067_0142027 3300049583 Bacteria 1337
316 Ga0501067_0297517 3300049583 Bacteria 898
317 Ga0501069_0142789 3300049585 Bacteria 1374
318 Ga0501071_0299761 3300049587 Bacteria 1218
319 Ga0501079_0709576 3300049741 Bacteria 792
320 Ga0501044_0126309 3300049823 Bacteria 2555
321 nmdc:mga00v17_249864_c1 3300050491 Bacteria 1150
322 nmdc:mga0yw44_253513_c1 3300050492 Bacteria 1172
323 nmdc:mga0yw44_616781_c1 3300050492 Bacteria 737
324 nmdc:mga05p37_9493_c1 3300050507 Bacteria 11517
325 nmdc:mga09592_3784_c1 3300050508 Bacteria 12177
326 nmdc:mga08y16_71613_c1 3300050511 Bacteria 3612
327 nmdc:mga0n895_241549_c1 3300050512 Bacteria 1833
328 nmdc:mga0rr50_263531_c1 3300050513 Bacteria 1434
329 nmdc:mga0rr50_50667_c1 3300050513 Bacteria 3077
330 nmdc:mga0a205_420314_c1 3300050515 Bacteria 1199
331 Ga0495601_0017961 3300053077 Bacteria 4300
332 Ga0466962_0148770 3300061719 Bacteria 1136

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038996 Ga0242420_029355 Ga0242420_029355_13_549 178
2 3300045049 Ga0466959_0063927 Ga0466959_0063927_14_568 178
3 3300048907 Ga0496104_0501035 Ga0496104_0501035_570_1106 178
4 3300048909 Ga0496106_1138296 Ga0496106_1138296_55_591 178
5 3300026067 Ga0207678_10499339 Ga0207678_104993392 186
6 3300050492 nmdc:mga0yw44_616781_c1 nmdc:mga0yw44_616781_c1_126_713 188
7 3300025944 Ga0207661_10109221 Ga0207661_101092211 191
8 3300044706 Ga0466964_0150203 Ga0466964_0150203_426_1001 191
9 3300028654 Ga0265322_10080857 Ga0265322_100808571 192
10 3300046660 Ga0495625_0181707 Ga0495625_0181707_652_1338 192
11 3300028558 Ga0265326_10000045 Ga0265326_100000457 195
12 3300028573 Ga0265334_10000012 Ga0265334_1000001284 195
13 3300028577 Ga0265318_10052193 Ga0265318_100521931 195
14 3300028800 Ga0265338_10007079 Ga0265338_100070793 195
15 3300029957 Ga0265324_10007445 Ga0265324_100074453 195
16 3300005337 Ga0070682_100096577 Ga0070682_1000965771 196
17 3300028800 Ga0265338_10071271 Ga0265338_100712714 196
18 3300031251 Ga0265327_10023687 Ga0265327_100236874 196
19 3300050513 nmdc:mga0rr50_263531_c1 nmdc:mga0rr50_263531_c1_722_1411 196
20 3300005547 Ga0070693_100000643 Ga0070693_10000064312 198
21 3300049587 Ga0501071_0299761 Ga0501071_0299761_125_811 198
22 3300048917 Ga0496114_0000133 Ga0496114_0000133_6255_6941 199
23 3300048918 Ga0496115_0000506 Ga0496115_0000506_24987_25673 199
24 3300044901 Ga0466960_0058529 Ga0466960_0058529_1081_1725 202
25 3300045976 Ga0466967_0000019 Ga0466967_0000019_32090_32764 202
26 3300005436 Ga0070713_100252899 Ga0070713_1002528992 209
27 3300005614 Ga0068856_100000889 Ga0068856_10000088916 209
28 3300005937 Ga0081455_10066896 Ga0081455_100668963 209
29 3300025928 Ga0207700_10179909 Ga0207700_101799092 209
30 3300026078 Ga0207702_10001782 Ga0207702_1000178211 209
31 3300039437 Ga0436365_0674096 Ga0436365_0674096_1963_2616 210
32 3300039453 Ga0436362_0314321 Ga0436362_0314321_2063_2716 210
33 3300046511 Ga0495608_0065050 Ga0495608_0065050_717_1367 210
34 3300046809 Ga0495600_0007859 Ga0495600_0007859_1774_2424 210
35 3300061719 Ga0466962_0148770 Ga0466962_0148770_22_675 210
36 3300005334 Ga0068869_100204109 Ga0068869_1002041092 211
37 3300005345 Ga0070692_10007716 Ga0070692_100077167 211
38 3300005353 Ga0070669_100079964 Ga0070669_1000799643 211
39 3300005366 Ga0070659_100198603 Ga0070659_1001986032 211
40 3300005436 Ga0070713_100082335 Ga0070713_1000823353 211
41 3300005444 Ga0070694_100098527 Ga0070694_1000985273 211
42 3300005445 Ga0070708_100248494 Ga0070708_1002484942 211
43 3300005455 Ga0070663_100004117 Ga0070663_1000041179 211
44 3300005467 Ga0070706_100112518 Ga0070706_1001125183 211
45 3300005468 Ga0070707_100099642 Ga0070707_1000996422 211
46 3300005471 Ga0070698_100124374 Ga0070698_1001243742 211
47 3300005518 Ga0070699_100058294 Ga0070699_1000582942 211
48 3300005518 Ga0070699_100137477 Ga0070699_1001374772 211
49 3300005518 Ga0070699_100266763 Ga0070699_1002667632 211
50 3300005549 Ga0070704_100009053 Ga0070704_1000090533 211
51 3300005719 Ga0068861_100167119 Ga0068861_1001671192 211
52 3300005841 Ga0068863_100228148 Ga0068863_1002281483 211
53 3300005841 Ga0068863_100461670 Ga0068863_1004616702 211
54 3300005842 Ga0068858_100432060 Ga0068858_1004320602 211
55 3300005843 Ga0068860_100006538 Ga0068860_10000653814 211
56 3300005844 Ga0068862_100096728 Ga0068862_1000967283 211
57 3300006038 Ga0075365_10169163 Ga0075365_101691632 211
58 3300006038 Ga0075365_10229761 Ga0075365_102297612 211
59 3300006852 Ga0075433_10185290 Ga0075433_101852902 211
60 3300009098 Ga0105245_10587742 Ga0105245_105877422 211
61 3300009147 Ga0114129_10001714 Ga0114129_1000171415 211
62 3300009553 Ga0105249_10039194 Ga0105249_100391943 211
63 3300014325 Ga0163163_10808318 Ga0163163_108083182 211
64 3300014968 Ga0157379_10123326 Ga0157379_101233263 211
65 3300014969 Ga0157376_10140793 Ga0157376_101407933 211
66 3300025905 Ga0207685_10221183 Ga0207685_102211832 211
67 3300025910 Ga0207684_10017754 Ga0207684_100177548 211
68 3300025910 Ga0207684_10027942 Ga0207684_100279426 211
69 3300025922 Ga0207646_10010873 Ga0207646_100108733 211
70 3300025923 Ga0207681_10471178 Ga0207681_104711782 211
71 3300025927 Ga0207687_10138621 Ga0207687_101386212 211
72 3300025928 Ga0207700_10050428 Ga0207700_100504283 211
73 3300026067 Ga0207678_10013196 Ga0207678_100131967 211
74 3300026088 Ga0207641_10062400 Ga0207641_100624002 211
75 3300026088 Ga0207641_10651462 Ga0207641_106514622 211
76 3300026118 Ga0207675_100037327 Ga0207675_1000373274 211
77 3300028380 Ga0268265_10164628 Ga0268265_101646283 211
78 3300028381 Ga0268264_10019943 Ga0268264_100199431 211
79 3300035085 Ga0373929_0049816 Ga0373929_0049816_146_817 211
80 3300035242 Ga0373962_0028642 Ga0373962_0028642_733_1404 211
81 3300042876 Ga0451577_0196988 Ga0451577_0196988_337_1008 211
82 3300045051 Ga0451576_0146124 Ga0451576_0146124_625_1296 211
83 3300045976 Ga0466967_0247097 Ga0466967_0247097_875_1558 211
84 3300047319 Ga0495674_0205894 Ga0495674_0205894_615_1286 211
85 3300048905 Ga0496102_0036676 Ga0496102_0036676_2587_3258 211
86 3300048910 Ga0496107_0148032 Ga0496107_0148032_626_1297 211
87 3300048913 Ga0496110_0538613 Ga0496110_0538613_202_873 211
88 3300048918 Ga0496115_0239615 Ga0496115_0239615_700_1368 211
89 3300050491 nmdc:mga00v17_249864_c1 nmdc:mga00v17_249864_c1_101_790 211
90 3300050492 nmdc:mga0yw44_253513_c1 nmdc:mga0yw44_253513_c1_206_895 211
91 3300050507 nmdc:mga05p37_9493_c1 nmdc:mga05p37_9493_c1_9054_9725 211
92 3300050512 nmdc:mga0n895_241549_c1 nmdc:mga0n895_241549_c1_473_1144 211
93 3300050513 nmdc:mga0rr50_50667_c1 nmdc:mga0rr50_50667_c1_1299_1970 211
94 3300050515 nmdc:mga0a205_420314_c1 nmdc:mga0a205_420314_c1_117_788 211
95 3300005337 Ga0070682_100000708 Ga0070682_1000007084 212
96 3300005340 Ga0070689_100214962 Ga0070689_1002149622 212
97 3300005344 Ga0070661_100000223 Ga0070661_1000002238 212
98 3300005366 Ga0070659_100030241 Ga0070659_1000302413 212
99 3300005535 Ga0070684_100567283 Ga0070684_1005672831 212
100 3300005718 Ga0068866_10018488 Ga0068866_100184882 212
101 3300005834 Ga0068851_10000355 Ga0068851_1000035517 212
102 3300013307 Ga0157372_10000610 Ga0157372_1000061036 212
103 3300014325 Ga0163163_10350404 Ga0163163_103504043 212
104 3300014326 Ga0157380_10241427 Ga0157380_102414272 212
105 3300028563 Ga0265319_1000073 Ga0265319_100007340 212
106 3300028800 Ga0265338_10000464 Ga0265338_1000046418 212
107 3300031238 Ga0265332_10069480 Ga0265332_100694801 212
108 3300031250 Ga0265331_10138755 Ga0265331_101387552 212
109 3300046455 Ga0495603_0006955 Ga0495603_0006955_47_733 212
110 3300047317 Ga0495604_0003881 Ga0495604_0003881_6286_6972 212
111 3300047472 Ga0495686_0025251 Ga0495686_0025251_1276_1965 212
112 3300048911 Ga0496108_0192610 Ga0496108_0192610_208_909 212
113 3300048912 Ga0496109_0000318 Ga0496109_0000318_13007_13705 212
114 3300048913 Ga0496110_0109245 Ga0496110_0109245_1438_2139 212
115 3300048913 Ga0496110_0807586 Ga0496110_0807586_21_722 212
116 3300048916 Ga0496113_0107298 Ga0496113_0107298_1152_1853 212
117 3300049741 Ga0501079_0709576 Ga0501079_0709576_38_727 212
118 3300049823 Ga0501044_0126309 Ga0501044_0126309_1263_1949 212
119 3300053077 Ga0495601_0017961 Ga0495601_0017961_2688_3398 212
120 3300005457 Ga0070662_100535599 Ga0070662_1005355992 213
121 3300005719 Ga0068861_100044546 Ga0068861_1000445462 213
122 3300009553 Ga0105249_10185205 Ga0105249_101852052 213
123 3300013306 Ga0163162_10423655 Ga0163162_104236553 213
124 3300025933 Ga0207706_10242227 Ga0207706_102422273 213
125 3300025961 Ga0207712_10058002 Ga0207712_100580022 213
126 3300044842 Ga0466957_0083399 Ga0466957_0083399_391_1032 213
127 3300045049 Ga0466959_0024122 Ga0466959_0024122_2864_3529 213
128 3300045836 Ga0466958_0294571 Ga0466958_0294571_325_990 213
129 3300045976 Ga0466967_0035295 Ga0466967_0035295_2219_2887 213
130 3300045976 Ga0466967_0552445 Ga0466967_0552445_281_949 213
131 3300001991 JGI24743J22301_10004425 JGI24743J22301_100044253 214
132 3300002075 JGI24738J21930_10030308 JGI24738J21930_100303081 214
133 3300005329 Ga0070683_100008934 Ga0070683_1000089346 214
134 3300005329 Ga0070683_100124864 Ga0070683_1001248644 214
135 3300005329 Ga0070683_100797032 Ga0070683_1007970321 214
136 3300005334 Ga0068869_100155674 Ga0068869_1001556742 214
137 3300005337 Ga0070682_100053771 Ga0070682_1000537713 214
138 3300005337 Ga0070682_100065405 Ga0070682_1000654053 214
139 3300005338 Ga0068868_100025876 Ga0068868_1000258764 214
140 3300005338 Ga0068868_100310477 Ga0068868_1003104772 214
141 3300005338 Ga0068868_100724704 Ga0068868_1007247042 214
142 3300005339 Ga0070660_100443373 Ga0070660_1004433733 214
143 3300005340 Ga0070689_100060629 Ga0070689_1000606293 214
144 3300005340 Ga0070689_100283215 Ga0070689_1002832151 214
145 3300005343 Ga0070687_100177326 Ga0070687_1001773262 214
146 3300005343 Ga0070687_100216002 Ga0070687_1002160022 214
147 3300005344 Ga0070661_100239049 Ga0070661_1002390493 214
148 3300005344 Ga0070661_100253833 Ga0070661_1002538333 214
149 3300005345 Ga0070692_10080300 Ga0070692_100803002 214
150 3300005347 Ga0070668_100769440 Ga0070668_1007694402 214
151 3300005353 Ga0070669_100003124 Ga0070669_10000312410 214
152 3300005353 Ga0070669_101139181 Ga0070669_1011391811 214
153 3300005354 Ga0070675_100083284 Ga0070675_1000832842 214
154 3300005366 Ga0070659_100000013 Ga0070659_100000013108 214
155 3300005366 Ga0070659_100439379 Ga0070659_1004393791 214
156 3300005435 Ga0070714_100018985 Ga0070714_1000189853 214
157 3300005435 Ga0070714_100024224 Ga0070714_1000242245 214
158 3300005437 Ga0070710_10000005 Ga0070710_10000005198 214
159 3300005437 Ga0070710_10045510 Ga0070710_100455102 214
160 3300005437 Ga0070710_10234598 Ga0070710_102345982 214
161 3300005438 Ga0070701_10016821 Ga0070701_100168214 214
162 3300005440 Ga0070705_100001368 Ga0070705_1000013686 214
163 3300005440 Ga0070705_100064714 Ga0070705_1000647143 214
164 3300005440 Ga0070705_100095881 Ga0070705_1000958812 214
165 3300005441 Ga0070700_100076202 Ga0070700_1000762023 214
166 3300005441 Ga0070700_100203627 Ga0070700_1002036272 214
167 3300005455 Ga0070663_100049231 Ga0070663_1000492313 214
168 3300005455 Ga0070663_100193833 Ga0070663_1001938333 214
169 3300005458 Ga0070681_10030984 Ga0070681_100309842 214
170 3300005459 Ga0068867_100314369 Ga0068867_1003143692 214
171 3300005535 Ga0070684_100164692 Ga0070684_1001646923 214
172 3300005564 Ga0070664_100057277 Ga0070664_1000572774 214
173 3300005577 Ga0068857_100099600 Ga0068857_1000996003 214
174 3300005578 Ga0068854_100149559 Ga0068854_1001495593 214
175 3300005615 Ga0070702_100010243 Ga0070702_1000102435 214
176 3300005615 Ga0070702_100065912 Ga0070702_1000659122 214
177 3300005615 Ga0070702_100134596 Ga0070702_1001345963 214
178 3300005615 Ga0070702_100236020 Ga0070702_1002360201 214
179 3300005616 Ga0068852_100105917 Ga0068852_1001059173 214
180 3300005617 Ga0068859_100127840 Ga0068859_1001278403 214
181 3300005618 Ga0068864_100299982 Ga0068864_1002999822 214
182 3300005719 Ga0068861_100474352 Ga0068861_1004743521 214
183 3300005841 Ga0068863_100400756 Ga0068863_1004007562 214
184 3300005844 Ga0068862_100768606 Ga0068862_1007686061 214
185 3300006028 Ga0070717_10000004 Ga0070717_10000004303 214
186 3300006058 Ga0075432_10040636 Ga0075432_100406363 214
187 3300006175 Ga0070712_100000002 Ga0070712_100000002145 214
188 3300006175 Ga0070712_100112281 Ga0070712_1001122812 214
189 3300006175 Ga0070712_100138418 Ga0070712_1001384183 214
190 3300006175 Ga0070712_100188130 Ga0070712_1001881302 214
191 3300006358 Ga0068871_100619176 Ga0068871_1006191761 214
192 3300006852 Ga0075433_10373204 Ga0075433_103732042 214
193 3300006880 Ga0075429_100007783 Ga0075429_1000077838 214
194 3300006881 Ga0068865_100118785 Ga0068865_1001187853 214
195 3300006881 Ga0068865_100223118 Ga0068865_1002231181 214
196 3300006931 Ga0097620_100127843 Ga0097620_1001278433 214
197 3300009094 Ga0111539_10311544 Ga0111539_103115442 214
198 3300009098 Ga0105245_10040845 Ga0105245_100408453 214
199 3300009098 Ga0105245_10045363 Ga0105245_100453633 214
200 3300009098 Ga0105245_10193319 Ga0105245_101933193 214
201 3300009098 Ga0105245_10892431 Ga0105245_108924312 214
202 3300009101 Ga0105247_10013548 Ga0105247_100135483 214
203 3300009101 Ga0105247_10482714 Ga0105247_104827141 214
204 3300009148 Ga0105243_10039263 Ga0105243_100392633 214
205 3300009148 Ga0105243_10111682 Ga0105243_101116823 214
206 3300009148 Ga0105243_10241364 Ga0105243_102413642 214
207 3300009551 Ga0105238_10637092 Ga0105238_106370921 214
208 3300010375 Ga0105239_10063476 Ga0105239_100634763 214
209 3300010375 Ga0105239_10383943 Ga0105239_103839432 214
210 3300011119 Ga0105246_10169834 Ga0105246_101698341 214
211 3300011119 Ga0105246_10573901 Ga0105246_105739012 214
212 3300011119 Ga0105246_10693281 Ga0105246_106932812 214
213 3300013296 Ga0157374_11410933 Ga0157374_114109331 214
214 3300013297 Ga0157378_10097975 Ga0157378_100979753 214
215 3300013306 Ga0163162_10466022 Ga0163162_104660223 214
216 3300013307 Ga0157372_10327606 Ga0157372_103276062 214
217 3300014325 Ga0163163_10041285 Ga0163163_100412853 214
218 3300014745 Ga0157377_10019123 Ga0157377_100191233 214
219 3300014969 Ga0157376_10057464 Ga0157376_100574641 214
220 3300014969 Ga0157376_10132927 Ga0157376_101329273 214
221 3300020070 Ga0206356_10446832 Ga0206356_104468323 214
222 3300025898 Ga0207692_10000009 Ga0207692_10000009108 214
223 3300025898 Ga0207692_10266928 Ga0207692_102669282 214
224 3300025899 Ga0207642_10006046 Ga0207642_100060463 214
225 3300025901 Ga0207688_10041543 Ga0207688_100415431 214
226 3300025904 Ga0207647_10057483 Ga0207647_100574832 214
227 3300025906 Ga0207699_10053418 Ga0207699_100534182 214
228 3300025908 Ga0207643_10029871 Ga0207643_100298712 214
229 3300025912 Ga0207707_10031723 Ga0207707_100317232 214
230 3300025915 Ga0207693_10001761 Ga0207693_1000176117 214
231 3300025915 Ga0207693_10033646 Ga0207693_100336464 214
232 3300025915 Ga0207693_10058643 Ga0207693_100586433 214
233 3300025915 Ga0207693_10125584 Ga0207693_101255843 214
234 3300025916 Ga0207663_10575578 Ga0207663_105755781 214
235 3300025918 Ga0207662_10023408 Ga0207662_100234083 214
236 3300025918 Ga0207662_10190323 Ga0207662_101903233 214
237 3300025919 Ga0207657_10041030 Ga0207657_100410303 214
238 3300025919 Ga0207657_10067420 Ga0207657_100674202 214
239 3300025920 Ga0207649_10373456 Ga0207649_103734563 214
240 3300025923 Ga0207681_10344490 Ga0207681_103444903 214
241 3300025926 Ga0207659_10040429 Ga0207659_100404293 214
242 3300025927 Ga0207687_10051003 Ga0207687_100510033 214
243 3300025927 Ga0207687_10072897 Ga0207687_100728973 214
244 3300025929 Ga0207664_10001425 Ga0207664_1000142510 214
245 3300025929 Ga0207664_10366770 Ga0207664_103667702 214
246 3300025932 Ga0207690_10000017 Ga0207690_10000017200 214
247 3300025932 Ga0207690_10215978 Ga0207690_102159782 214
248 3300025934 Ga0207686_10154723 Ga0207686_101547233 214
249 3300025936 Ga0207670_10228936 Ga0207670_102289362 214
250 3300025938 Ga0207704_10028448 Ga0207704_100284483 214
251 3300025941 Ga0207711_10257185 Ga0207711_102571853 214
252 3300025942 Ga0207689_10020265 Ga0207689_100202656 214
253 3300025942 Ga0207689_10060407 Ga0207689_100604073 214
254 3300025944 Ga0207661_10027579 Ga0207661_100275794 214
255 3300025945 Ga0207679_10371750 Ga0207679_103717503 214
256 3300025945 Ga0207679_10435473 Ga0207679_104354732 214
257 3300025972 Ga0207668_10422120 Ga0207668_104221203 214
258 3300025981 Ga0207640_10324456 Ga0207640_103244562 214
259 3300026023 Ga0207677_10032538 Ga0207677_100325383 214
260 3300026023 Ga0207677_10190609 Ga0207677_101906093 214
261 3300026075 Ga0207708_10065923 Ga0207708_100659233 214
262 3300026075 Ga0207708_10322445 Ga0207708_103224452 214
263 3300026089 Ga0207648_10403709 Ga0207648_104037092 214
264 3300026116 Ga0207674_10023509 Ga0207674_100235098 214
265 3300026116 Ga0207674_10359153 Ga0207674_103591533 214
266 3300026118 Ga0207675_100564134 Ga0207675_1005641343 214
267 3300026118 Ga0207675_100881169 Ga0207675_1008811692 214
268 3300026142 Ga0207698_10192808 Ga0207698_101928083 214
269 3300026142 Ga0207698_10393301 Ga0207698_103933013 214
270 3300026142 Ga0207698_11177282 Ga0207698_111772821 214
271 3300027907 Ga0207428_10243867 Ga0207428_102438673 214
272 3300028381 Ga0268264_10026624 Ga0268264_100266242 214
273 3300028558 Ga0265326_10050232 Ga0265326_100502322 214
274 3300028563 Ga0265319_1000118 Ga0265319_100011850 214
275 3300028563 Ga0265319_1003066 Ga0265319_10030663 214
276 3300028800 Ga0265338_10154509 Ga0265338_101545092 214
277 3300031235 Ga0265330_10106191 Ga0265330_101061912 214
278 3300031240 Ga0265320_10038599 Ga0265320_100385993 214
279 3300031251 Ga0265327_10054170 Ga0265327_100541702 214
280 3300031995 Ga0307409_100251208 Ga0307409_1002512083 214
281 3300032002 Ga0307416_100345713 Ga0307416_1003457133 214
282 3300032126 Ga0307415_100512938 Ga0307415_1005129382 214
283 3300037853 Ga0436364_0737248 Ga0436364_0737248_8255_8950 214
284 3300038443 Ga0395901_0528008 Ga0395901_0528008_329_1012 214
285 3300044693 Ga0466961_0121255 Ga0466961_0121255_375_1070 214
286 3300044765 Ga0466970_0276773 Ga0466970_0276773_155_850 214
287 3300044901 Ga0466960_0013930 Ga0466960_0013930_2063_2707 214
288 3300044901 Ga0466960_0034840 Ga0466960_0034840_1025_1669 214
289 3300044901 Ga0466960_0111586 Ga0466960_0111586_261_905 214
290 3300045836 Ga0466958_0005233 Ga0466958_0005233_2426_3208 214
291 3300045836 Ga0466958_0219890 Ga0466958_0219890_111_797 214
292 3300045976 Ga0466967_0048329 Ga0466967_0048329_2641_3285 214
293 3300045976 Ga0466967_0058619 Ga0466967_0058619_1461_2105 214
294 3300045976 Ga0466967_0222522 Ga0466967_0222522_148_792 214
295 3300045976 Ga0466967_0609885 Ga0466967_0609885_326_1033 214
296 3300046477 Ga0495664_0000025 Ga0495664_0000025_7531_8214 214
297 3300046529 Ga0495652_0088765 Ga0495652_0088765_12_695 214
298 3300046536 Ga0495587_0187803 Ga0495587_0187803_46_732 214
299 3300046543 Ga0495645_0000463 Ga0495645_0000463_24644_25366 214
300 3300046681 Ga0495647_0188440 Ga0495647_0188440_132_821 214
301 3300047315 Ga0495581_0276323 Ga0495581_0276323_190_879 214
302 3300047317 Ga0495604_0212774 Ga0495604_0212774_154_861 214
303 3300047320 Ga0495672_0007449 Ga0495672_0007449_6055_6747 214
304 3300047320 Ga0495672_0047954 Ga0495672_0047954_354_1037 214
305 3300047471 Ga0495684_0001866 Ga0495684_0001866_13576_14265 214
306 3300048903 Ga0496100_0177281 Ga0496100_0177281_89_733 214
307 3300048903 Ga0496100_0304654 Ga0496100_0304654_455_1180 214
308 3300048903 Ga0496100_0444110 Ga0496100_0444110_19_663 214
309 3300048904 Ga0496101_0100296 Ga0496101_0100296_235_960 214
310 3300048905 Ga0496102_0000002 Ga0496102_0000002_124451_125134 214
311 3300048905 Ga0496102_0253727 Ga0496102_0253727_967_1611 214
312 3300048905 Ga0496102_0833374 Ga0496102_0833374_31_675 214
313 3300048906 Ga0496103_0000047 Ga0496103_0000047_24868_25551 214
314 3300048906 Ga0496103_0175082 Ga0496103_0175082_86_730 214
315 3300048909 Ga0496106_0184203 Ga0496106_0184203_586_1311 214
316 3300048909 Ga0496106_0185946 Ga0496106_0185946_767_1411 214
317 3300048911 Ga0496108_0087514 Ga0496108_0087514_1361_2047 214
318 3300048912 Ga0496109_0047152 Ga0496109_0047152_344_1030 214
319 3300048912 Ga0496109_0349273 Ga0496109_0349273_211_936 214
320 3300048913 Ga0496110_0063284 Ga0496110_0063284_1487_2131 214
321 3300048913 Ga0496110_0114284 Ga0496110_0114284_1296_2021 214
322 3300048914 Ga0496111_0098190 Ga0496111_0098190_773_1417 214
323 3300048915 Ga0496112_0005877 Ga0496112_0005877_8754_9446 214
324 3300048916 Ga0496113_0067862 Ga0496113_0067862_373_1017 214
325 3300048916 Ga0496113_0269341 Ga0496113_0269341_338_1018 214
326 3300048927 Ga0496124_0122853 Ga0496124_0122853_18_710 214
327 3300049578 Ga0501042_0167794 Ga0501042_0167794_14_694 214
328 3300049583 Ga0501067_0142027 Ga0501067_0142027_672_1319 214
329 3300049583 Ga0501067_0297517 Ga0501067_0297517_79_723 214
330 3300049585 Ga0501069_0142789 Ga0501069_0142789_37_681 214
331 3300050508 nmdc:mga09592_3784_c1 nmdc:mga09592_3784_c1_9469_10164 214
332 3300050511 nmdc:mga08y16_71613_c1 nmdc:mga08y16_71613_c1_1777_2421 214

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00834

Ribul_P_3_epim

Ribulose-phosphate 3 epimerase family

43

241

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5umf-assembly1.cif.gz_C crystal structure of a ribulose-phosphate 3-epimerase from neisseria gonorrhoeae with bound phosphate 0.9766 3 212
7sbj-assembly1.cif.gz_C crystal structure of ribulose-phosphate 3-epimerase from stenotrophomonas maltophilia k279a 0.9626 4 212
7b1w-assembly2.cif.gz_K-3 crystal structure of plastidial ribulose epimerase rpe1 from the model alga chlamydomonas reinhardtii 0.957 2 207
5umf-assembly1.cif.gz_C crystal structure of a ribulose-phosphate 3-epimerase from neisseria gonorrhoeae with bound phosphate 0.9543 3 212
1rpx-assembly1.cif.gz_A d-ribulose-5-phosphate 3-epimerase from solanum tuberosum chloroplasts 0.9542 2 210
ID Description Score Start End Superfamily
af_P0AG07_1_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9699 1 212 3.20.20.70
af_A0A1D6PJ99_41_293_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9596 2 203 3.20.20.70
af_Q58093_1_217_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9587 3 211 3.20.20.70
af_P0AG07_1_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9566 1 212 3.20.20.70
2fliC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9508 1 212 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A7K0RIV7-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9927 1 211 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-H0E3V1-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9876 2 212 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A2W6CAP4-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9863 6 214 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A7W0US68-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9846 2 213 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A2T4UD53-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9825 1 214 GO:0004750
GO:0006098
GO:0019323
GO:0046872

Feature Viewer

pLDDT pTM Quality
94.61 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map