F411033

General Info

Members Datasets Scaffolds Average Seq Length
332 194 664 204

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0004114|Ga0466969_0004114_675_1427
Length 250
Sequence VTRIVVAYSPRARAFFGAGKGRIFGPVLLPAGPRTLAAGRSRGHTAAMSRPTRGFVGKRRAPRDRRLPPGQYDIGRDFPVLTAEVTPRVHTDRWTMTIDGQVRSPGKWTWDELHRLPQEEYRGDIHCVTTWSKFDTSFGGVSVDLLLDQVEPLPTASHVLATSTTGYTTNLPLEHLRNGKAWLVWTHEGKPLPRDHGGPVRLLVPHLYFWKSAKWITKLTLLDHDVPGFWERNGYHDLGDPWLEQRYQGD

Samples

Sample ID Description Type Environment
1 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
112 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
113 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
114 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
115 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
116 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
119 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
120 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
134 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
135 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
136 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
137 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
138 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
139 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
147 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
148 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
151 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
152 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
153 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
154 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
161 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
162 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
163 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
178 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
183 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
187 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
190 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
191 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
192 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
193 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
194 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 98.8
Metatranscriptomes 0.9
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0.3
Bulb 0
Endosphere 2.71
Nodule 0
Rhizoplane 6.33
Rhizosphere 89.76
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466969_0004114 3300044656 Bacteria 7722
2 LJQas_1008694 3300000549 Bacteria 1230
3 LJQas_1025543 3300000549 Bacteria 688
4 JGI24735J21928_10023198 3300002067 Bacteria 1883
5 Ga0070658_10018332 3300005327 Bacteria 5604
6 Ga0070683_100247393 3300005329 Bacteria 1696
7 Ga0070680_100316502 3300005336 Bacteria 1324
8 Ga0070682_100231971 3300005337 Bacteria 1320
9 Ga0070660_100599721 3300005339 Bacteria 921
10 Ga0070689_100194547 3300005340 Bacteria 1652
11 Ga0070691_10036900 3300005341 Bacteria 2304
12 Ga0070687_100025576 3300005343 Bacteria 2834
13 Ga0070692_10352574 3300005345 Bacteria 915
14 Ga0070668_100008635 3300005347 Bacteria 7565
15 Ga0070668_100494248 3300005347 Bacteria 1058
16 Ga0070673_100049242 3300005364 Bacteria 3290
17 Ga0070659_100267681 3300005366 Bacteria 1419
18 Ga0070667_100285635 3300005367 Bacteria 1483
19 Ga0070700_100015098 3300005441 Bacteria 4372
20 Ga0070694_100012166 3300005444 Bacteria 5346
21 Ga0070663_100033181 3300005455 Bacteria 3565
22 Ga0070663_100673296 3300005455 Bacteria 877
23 Ga0070678_100036494 3300005456 Bacteria 3441
24 Ga0070678_100241643 3300005456 Bacteria 1510
25 Ga0070662_100088405 3300005457 Bacteria 2322
26 Ga0068867_100005221 3300005459 Bacteria 9169
27 Ga0070699_100166450 3300005518 Bacteria 1953
28 Ga0070679_100021430 3300005530 Bacteria 6309
29 Ga0070679_100297202 3300005530 Bacteria 1566
30 Ga0070679_100912943 3300005530 Bacteria 822
31 Ga0070684_100005400 3300005535 Bacteria 9790
32 Ga0068853_100027585 3300005539 Bacteria 4771
33 Ga0068853_100104592 3300005539 Bacteria 2506
34 Ga0070695_100043380 3300005545 Bacteria 2860
35 Ga0070665_100306401 3300005548 Bacteria 1592
36 Ga0068855_100003612 3300005563 Bacteria 18901
37 Ga0070664_100005545 3300005564 Bacteria 10133
38 Ga0068857_100452856 3300005577 Bacteria 1200
39 Ga0068856_100078619 3300005614 Bacteria 3271
40 Ga0070702_100005332 3300005615 Bacteria 5973
41 Ga0070702_100168563 3300005615 Bacteria 1422
42 Ga0068852_100005282 3300005616 Bacteria 9221
43 Ga0068852_100007180 3300005616 Bacteria 8119
44 Ga0068864_100114525 3300005618 Bacteria 2404
45 Ga0068851_10044887 3300005834 Bacteria 2233
46 Ga0068870_10008303 3300005840 Bacteria 4665
47 Ga0068870_10170371 3300005840 Bacteria 1299
48 Ga0068858_100083013 3300005842 Bacteria 2979
49 Ga0081540_1001394 3300005983 Bacteria 20936
50 Ga0070717_10022954 3300006028 Bacteria 4936
51 Ga0075365_10010755 3300006038 Bacteria 5347
52 Ga0075365_10498473 3300006038 Bacteria 861
53 Ga0070715_10057576 3300006163 Bacteria 1694
54 Ga0075433_10056085 3300006852 Bacteria 3441
55 Ga0075434_100090334 3300006871 Bacteria 3064
56 Ga0068865_100018614 3300006881 Bacteria 4484
57 Ga0075436_100200579 3300006914 Bacteria 1413
58 Ga0105251_10112766 3300009011 Bacteria 1238
59 Ga0111539_10056953 3300009094 Bacteria 4643
60 Ga0105245_10084768 3300009098 Bacteria 2903
61 Ga0105243_10006984 3300009148 Bacteria 8694
62 Ga0105241_10452919 3300009174 Bacteria 1135
63 Ga0105237_11369969 3300009545 Bacteria 714
64 Ga0105238_10063372 3300009551 Bacteria 3697
65 Ga0105238_10088708 3300009551 Bacteria 3079
66 Ga0105249_10015640 3300009553 Bacteria 6718
67 Ga0105239_10049338 3300010375 Bacteria 4616
68 Ga0105239_10966360 3300010375 Bacteria 979
69 Ga0157338_1021133 3300012515 Bacteria 759
70 Ga0157371_10040135 3300013102 Bacteria 3345
71 Ga0157370_10103283 3300013104 Bacteria 2668
72 Ga0157369_10685753 3300013105 Bacteria 1055
73 Ga0157374_10679650 3300013296 Bacteria 1042
74 Ga0157378_10198263 3300013297 Bacteria 1897
75 Ga0157372_10072175 3300013307 Bacteria 3890
76 Ga0157372_10215900 3300013307 Bacteria 2223
77 Ga0157372_10647792 3300013307 Bacteria 1230
78 Ga0157372_10825856 3300013307 Bacteria 1076
79 Ga0157372_11306538 3300013307 Bacteria 837
80 Ga0163163_11762413 3300014325 Bacteria 680
81 Ga0157380_10013797 3300014326 Bacteria 5902
82 Ga0157377_10124119 3300014745 Bacteria 1569
83 Ga0157379_10130807 3300014968 Bacteria 2259
84 Ga0157376_10016036 3300014969 Bacteria 5677
85 Ga0163161_10005522 3300017792 Bacteria 8760
86 Ga0197907_11065939 3300020069 Bacteria 2275
87 Ga0206356_11342855 3300020070 Bacteria 2930
88 Ga0206353_10418961 3300020082 Bacteria 4362
89 Ga0207656_10106347 3300025321 Bacteria 1292
90 Ga0207688_10003161 3300025901 Bacteria 8986
91 Ga0207688_10127240 3300025901 Bacteria 1491
92 Ga0207688_10248097 3300025901 Bacteria 1078
93 Ga0207647_10027024 3300025904 Bacteria 3746
94 Ga0207643_10007415 3300025908 Bacteria 5883
95 Ga0207705_10054067 3300025909 Bacteria 2894
96 Ga0207660_10042767 3300025917 Bacteria 3181
97 Ga0207660_10078470 3300025917 Bacteria 2420
98 Ga0207657_10014967 3300025919 Bacteria 7536
99 Ga0207657_10341869 3300025919 Bacteria 1181
100 Ga0207652_10060804 3300025921 Bacteria 3260
101 Ga0207652_10693540 3300025921 Bacteria 909
102 Ga0207694_10112499 3300025924 Bacteria 2166
103 Ga0207694_10120301 3300025924 Bacteria 2096
104 Ga0207659_10395041 3300025926 Bacteria 1156
105 Ga0207687_10126938 3300025927 Bacteria 1917
106 Ga0207687_10357582 3300025927 Bacteria 1191
107 Ga0207690_10015902 3300025932 Bacteria 4569
108 Ga0207690_10050792 3300025932 Bacteria 2770
109 Ga0207706_10085135 3300025933 Bacteria 2779
110 Ga0207706_10181190 3300025933 Bacteria 1850
111 Ga0207709_10048574 3300025935 Bacteria 2586
112 Ga0207670_10384859 3300025936 Bacteria 1118
113 Ga0207669_10059867 3300025937 Bacteria 2332
114 Ga0207704_10036595 3300025938 Bacteria 2825
115 Ga0207665_10000093 3300025939 Bacteria 58107
116 Ga0207711_10561250 3300025941 Bacteria 1065
117 Ga0207661_10017618 3300025944 Bacteria 5291
118 Ga0207661_10271924 3300025944 Bacteria 1512
119 Ga0207661_10749528 3300025944 Bacteria 899
120 Ga0207679_10091472 3300025945 Bacteria 2355
121 Ga0207667_10111563 3300025949 Bacteria 2821
122 Ga0207712_10019177 3300025961 Bacteria 4463
123 Ga0207712_10130054 3300025961 Bacteria 1917
124 Ga0207640_10466626 3300025981 Bacteria 1044
125 Ga0207658_10067577 3300025986 Bacteria 2693
126 Ga0207677_10021085 3300026023 Bacteria 3974
127 Ga0207677_10048053 3300026023 Bacteria 2870
128 Ga0207677_10849976 3300026023 Bacteria 820
129 Ga0207639_10064793 3300026041 Bacteria 2834
130 Ga0207678_10015477 3300026067 Bacteria 6705
131 Ga0207678_10190531 3300026067 Bacteria 1752
132 Ga0207678_10298550 3300026067 Bacteria 1384
133 Ga0207708_10006573 3300026075 Bacteria 8605
134 Ga0207702_10196896 3300026078 Bacteria 1866
135 Ga0207702_10408901 3300026078 Bacteria 1310
136 Ga0207648_10004906 3300026089 Bacteria 13620
137 Ga0207676_10066118 3300026095 Bacteria 2882
138 Ga0207674_10567288 3300026116 Bacteria 1096
139 Ga0207675_100004039 3300026118 Bacteria 14213
140 Ga0207675_100015644 3300026118 Bacteria 7075
141 Ga0207683_10001142 3300026121 Bacteria 24117
142 Ga0207683_10141486 3300026121 Bacteria 2168
143 Ga0207698_10008727 3300026142 Bacteria 6427
144 Ga0207698_10628874 3300026142 Bacteria 1061
145 Ga0207428_10281218 3300027907 Bacteria 1235
146 Ga0268266_10004367 3300028379 Bacteria 13585
147 Ga0268265_10106402 3300028380 Bacteria 2279
148 Ga0265338_10134283 3300028800 Bacteria 1948
149 Ga0307511_10001508 3300030521 Bacteria 24631
150 Ga0265330_10119330 3300031235 Bacteria 1124
151 Ga0265320_10026636 3300031240 Bacteria 3023
152 Ga0265340_10023800 3300031247 Bacteria 3118
153 Ga0265339_10012328 3300031249 Bacteria 5224
154 Ga0307408_100629069 3300031548 Bacteria 957
155 Ga0265313_10039793 3300031595 Bacteria 2330
156 Ga0265314_10021317 3300031711 Bacteria 4986
157 Ga0265342_10114054 3300031712 Bacteria 1527
158 Ga0307405_10295626 3300031731 Bacteria 1226
159 Ga0307413_10020490 3300031824 Bacteria 3519
160 Ga0307410_10027589 3300031852 Bacteria 3590
161 Ga0307410_10165780 3300031852 Bacteria 1660
162 Ga0307410_10324187 3300031852 Bacteria 1223
163 Ga0307410_10340394 3300031852 Bacteria 1195
164 Ga0307410_10480203 3300031852 Bacteria 1019
165 Ga0307410_10951494 3300031852 Bacteria 738
166 Ga0326468_10004383 3300031889 Bacteria 1232
167 Ga0307406_10091401 3300031901 Bacteria 2050
168 Ga0307406_10426969 3300031901 Bacteria 1057
169 Ga0307407_10161075 3300031903 Bacteria 1468
170 Ga0307407_10164332 3300031903 Bacteria 1456
171 Ga0307407_10307520 3300031903 Bacteria 1108
172 Ga0307407_10487935 3300031903 Bacteria 901
173 Ga0307407_10660915 3300031903 Bacteria 784
174 Ga0307412_10115390 3300031911 Bacteria 1925
175 Ga0307409_100056001 3300031995 Bacteria 3048
176 Ga0307409_100095044 3300031995 Bacteria 2454
177 Ga0307409_100175768 3300031995 Bacteria 1889
178 Ga0307409_100371665 3300031995 Bacteria 1356
179 Ga0307409_100405216 3300031995 Bacteria 1304
180 Ga0307409_100444805 3300031995 Bacteria 1249
181 Ga0307409_100451143 3300031995 Bacteria 1241
182 Ga0307416_100124737 3300032002 Bacteria 2304
183 Ga0307416_100656955 3300032002 Bacteria 1134
184 Ga0307416_100900823 3300032002 Bacteria 984
185 Ga0307414_10091812 3300032004 Bacteria 2258
186 Ga0307414_10182969 3300032004 Bacteria 1687
187 Ga0307411_10114146 3300032005 Bacteria 1940
188 Ga0307411_10487626 3300032005 Bacteria 1039
189 Ga0307415_100030992 3300032126 Bacteria 3440
190 Ga0307415_100035863 3300032126 Bacteria 3243
191 Ga0307415_100076915 3300032126 Bacteria 2368
192 Ga0307415_100095575 3300032126 Bacteria 2163
193 Ga0307415_100111741 3300032126 Bacteria 2029
194 Ga0307415_100141660 3300032126 Bacteria 1837
195 Ga0307415_100197431 3300032126 Bacteria 1593
196 Ga0307415_100438960 3300032126 Bacteria 1125
197 Ga0307415_100555398 3300032126 Bacteria 1014
198 Ga0307415_101080256 3300032126 Bacteria 750
199 Ga0373930_0003655 3300034816 Bacteria 2456
200 Ga0373938_0002639 3300034957 Bacteria 2894
201 Ga0373929_0012029 3300035085 Bacteria 1639
202 Ga0373951_0006866 3300035091 Bacteria 2601
203 Ga0373960_0006738 3300035121 Bacteria 2703
204 Ga0373942_0011880 3300035207 Bacteria 2071
205 Ga0373962_0036510 3300035242 Bacteria 1368
206 Ga0373925_0823497 3300037068 Bacteria 765
207 Ga0395899_0206000 3300037312 Bacteria 1369
208 Ga0395900_0085911 3300037418 Bacteria 3233
209 Ga0395900_0134682 3300037418 Bacteria 2531
210 Ga0395898_0052182 3300037466 Bacteria 3995
211 Ga0395898_0395326 3300037466 Bacteria 1318
212 Ga0395905_0313775 3300037471 Bacteria 1457
213 Ga0395901_0031806 3300038443 Bacteria 5441
214 Ga0395901_0167250 3300038443 Bacteria 2308
215 Ga0395901_0271120 3300038443 Bacteria 1765
216 Ga0451800_0234817 3300041459 Bacteria 852
217 Ga0439464_0039604 3300042439 Bacteria 1341
218 Ga0466969_0011983 3300044656 Bacteria 4584
219 Ga0466965_0013199 3300044683 Bacteria 3894
220 Ga0466965_0040716 3300044683 Bacteria 2288
221 Ga0466965_0068318 3300044683 Bacteria 1784
222 Ga0466965_0163984 3300044683 Bacteria 1166
223 Ga0466965_0171063 3300044683 Bacteria 1143
224 Ga0466965_0221134 3300044683 Bacteria 1009
225 Ga0466965_0239422 3300044683 Bacteria 971
226 Ga0466966_0004375 3300044684 Bacteria 9315
227 Ga0466966_0092374 3300044684 Bacteria 1878
228 Ga0466966_0102233 3300044684 Bacteria 1772
229 Ga0466961_0002074 3300044693 Bacteria 12493
230 Ga0466961_0036117 3300044693 Bacteria 3172
231 Ga0466961_0114947 3300044693 Bacteria 1691
232 Ga0466963_0009180 3300044694 Bacteria 5949
233 Ga0466963_0033537 3300044694 Bacteria 3334
234 Ga0466963_0070391 3300044694 Bacteria 2353
235 Ga0466963_0088506 3300044694 Bacteria 2106
236 Ga0466963_0196229 3300044694 Bacteria 1411
237 Ga0466963_0615687 3300044694 Bacteria 767
238 Ga0466964_0047298 3300044706 Bacteria 1755
239 Ga0466971_0043162 3300044719 Bacteria 2027
240 Ga0466971_0112401 3300044719 Bacteria 1257
241 Ga0466971_0134324 3300044719 Bacteria 1150
242 Ga0466971_0162257 3300044719 Bacteria 1046
243 Ga0466970_0051038 3300044765 Bacteria 2207
244 Ga0466970_0066537 3300044765 Bacteria 1934
245 Ga0466970_0121374 3300044765 Bacteria 1431
246 Ga0466970_0206630 3300044765 Bacteria 1093
247 Ga0466957_0006837 3300044842 Bacteria 6446
248 Ga0466957_0052095 3300044842 Bacteria 2491
249 Ga0466960_0006219 3300044901 Bacteria 4781
250 Ga0466960_0028282 3300044901 Bacteria 2564
251 Ga0466960_0037545 3300044901 Bacteria 2273
252 Ga0466960_0081733 3300044901 Bacteria 1630
253 Ga0466960_0157230 3300044901 Bacteria 1218
254 Ga0466960_0273754 3300044901 Bacteria 944
255 Ga0466959_0024680 3300045049 Bacteria 4454
256 Ga0466959_0042345 3300045049 Bacteria 3359
257 Ga0466959_0077273 3300045049 Bacteria 2403
258 Ga0466959_0084879 3300045049 Bacteria 2279
259 Ga0466959_0109208 3300045049 Bacteria 1975
260 Ga0466959_0137042 3300045049 Bacteria 1732
261 Ga0466959_0431692 3300045049 Bacteria 894
262 Ga0466958_0004498 3300045836 Bacteria 7364
263 Ga0466958_0164220 3300045836 Bacteria 1404
264 Ga0466958_0175215 3300045836 Bacteria 1359
265 Ga0466958_0292438 3300045836 Bacteria 1045
266 Ga0466958_0766144 3300045836 Bacteria 629
267 Ga0466967_0000522 3300045976 Bacteria 18716
268 Ga0466967_0021232 3300045976 Bacteria 5267
269 Ga0466967_0035747 3300045976 Bacteria 4233
270 Ga0466967_0045290 3300045976 Bacteria 3821
271 Ga0466967_0061978 3300045976 Bacteria 3319
272 Ga0466967_0071374 3300045976 Bacteria 3109
273 Ga0466967_0122237 3300045976 Bacteria 2407
274 Ga0466967_0182428 3300045976 Bacteria 1980
275 Ga0466967_0239992 3300045976 Bacteria 1728
276 Ga0466967_0408867 3300045976 Bacteria 1321
277 Ga0466967_0932653 3300045976 Bacteria 864
278 Ga0495653_0018195 3300046463 Bacteria 5710
279 Ga0495663_0095359 3300046525 Bacteria 974
280 Ga0495635_0241513 3300046663 Bacteria 1219
281 Ga0495676_0225115 3300047321 Bacteria 1291
282 Ga0496100_0767732 3300048903 Bacteria 754
283 Ga0496102_0040274 3300048905 Bacteria 4225
284 Ga0496104_0605792 3300048907 Bacteria 1005
285 Ga0496107_0498170 3300048910 Bacteria 904
286 Ga0496108_0063475 3300048911 Bacteria 3110
287 Ga0496108_0726646 3300048911 Bacteria 860
288 Ga0496108_0832805 3300048911 Bacteria 795
289 Ga0496109_0324962 3300048912 Bacteria 1452
290 Ga0496109_0374455 3300048912 Bacteria 1345
291 Ga0496109_0393975 3300048912 Bacteria 1308
292 Ga0496110_0036914 3300048913 Bacteria 4246
293 Ga0496110_0108972 3300048913 Bacteria 2487
294 Ga0496110_0263399 3300048913 Bacteria 1569
295 Ga0496110_0889141 3300048913 Bacteria 796
296 Ga0496111_0184423 3300048914 Bacteria 1551
297 Ga0496114_0098429 3300048917 Bacteria 2494
298 Ga0496114_0274638 3300048917 Bacteria 1485
299 Ga0496114_0596291 3300048917 Bacteria 974
300 Ga0496114_0771353 3300048917 Bacteria 839
301 Ga0496115_0107749 3300048918 Bacteria 2288
302 Ga0496126_0000055 3300048929 Bacteria 297958
303 Ga0496126_0093947 3300048929 Bacteria 2633
304 Ga0501038_0281943 3300049574 Bacteria 1308
305 Ga0501047_0500606 3300049581 Bacteria 1042
306 Ga0501067_0011667 3300049583 Bacteria 4868
307 Ga0501067_0011899 3300049583 Bacteria 4822
308 Ga0501067_0016206 3300049583 Bacteria 4118
309 Ga0501068_0107619 3300049584 Bacteria 1732
310 Ga0501069_0070712 3300049585 Bacteria 1955
311 Ga0501070_0200989 3300049586 Bacteria 1637
312 Ga0501070_0298462 3300049586 Bacteria 1313
313 Ga0501044_0310966 3300049823 Bacteria 1502
314 nmdc:mga00v17_292213_c1 3300050491 Bacteria 1058
315 nmdc:mga0yw44_181427_c1 3300050492 Bacteria 1386
316 nmdc:mga0yw44_9708_c1 3300050492 Bacteria 4885
317 nmdc:mga05p37_311953_c1 3300050507 Bacteria 1864
318 nmdc:mga08y16_53602_c1 3300050511 Bacteria 4217
319 nmdc:mga0n895_15136_c1 3300050512 Bacteria 7029
320 nmdc:mga0rr50_251965_c1 3300050513 Bacteria 1467
321 nmdc:mga0a205_86940_c1 3300050515 Bacteria 3020
322 Ga0495595_0021806 3300053084 Bacteria 2803
323 Ga0500556_0002907 3300053104 Bacteria 5202
324 Ga0500593_000160 3300053117 Bacteria 26926
325 Ga0500573_0003926 3300053140 Bacteria 7768
326 Ga0500573_0103356 3300053140 Bacteria 1601
327 Ga0466962_0002126 3300061719 Bacteria 9356
328 Ga0466962_0010437 3300061719 Bacteria 4465
329 Ga0466962_0064224 3300061719 Bacteria 1753
330 Ga0466962_0206777 3300061719 Bacteria 960
331 Ga0466962_0228234 3300061719 Bacteria 912
332 2984595448 2984592036 Bacteria 3670284
333 Ga0466969_0004114
334 LJQas_1008694
335 LJQas_1025543
336 JGI24735J21928_10023198
337 Ga0070658_10018332
338 Ga0070683_100247393
339 Ga0070680_100316502
340 Ga0070682_100231971
341 Ga0070660_100599721
342 Ga0070689_100194547
343 Ga0070691_10036900
344 Ga0070687_100025576
345 Ga0070692_10352574
346 Ga0070668_100008635
347 Ga0070668_100494248
348 Ga0070673_100049242
349 Ga0070659_100267681
350 Ga0070667_100285635
351 Ga0070700_100015098
352 Ga0070694_100012166
353 Ga0070663_100033181
354 Ga0070663_100673296
355 Ga0070678_100036494
356 Ga0070678_100241643
357 Ga0070662_100088405
358 Ga0068867_100005221
359 Ga0070699_100166450
360 Ga0070679_100021430
361 Ga0070679_100297202
362 Ga0070679_100912943
363 Ga0070684_100005400
364 Ga0068853_100027585
365 Ga0068853_100104592
366 Ga0070695_100043380
367 Ga0070665_100306401
368 Ga0068855_100003612
369 Ga0070664_100005545
370 Ga0068857_100452856
371 Ga0068856_100078619
372 Ga0070702_100005332
373 Ga0070702_100168563
374 Ga0068852_100005282
375 Ga0068852_100007180
376 Ga0068864_100114525
377 Ga0068851_10044887
378 Ga0068870_10008303
379 Ga0068870_10170371
380 Ga0068858_100083013
381 Ga0081540_1001394
382 Ga0070717_10022954
383 Ga0075365_10010755
384 Ga0075365_10498473
385 Ga0070715_10057576
386 Ga0075433_10056085
387 Ga0075434_100090334
388 Ga0068865_100018614
389 Ga0075436_100200579
390 Ga0105251_10112766
391 Ga0111539_10056953
392 Ga0105245_10084768
393 Ga0105243_10006984
394 Ga0105241_10452919
395 Ga0105237_11369969
396 Ga0105238_10063372
397 Ga0105238_10088708
398 Ga0105249_10015640
399 Ga0105239_10049338
400 Ga0105239_10966360
401 Ga0157338_1021133
402 Ga0157371_10040135
403 Ga0157370_10103283
404 Ga0157369_10685753
405 Ga0157374_10679650
406 Ga0157378_10198263
407 Ga0157372_10072175
408 Ga0157372_10215900
409 Ga0157372_10647792
410 Ga0157372_10825856
411 Ga0157372_11306538
412 Ga0163163_11762413
413 Ga0157380_10013797
414 Ga0157377_10124119
415 Ga0157379_10130807
416 Ga0157376_10016036
417 Ga0163161_10005522
418 Ga0197907_11065939
419 Ga0206356_11342855
420 Ga0206353_10418961
421 Ga0207656_10106347
422 Ga0207688_10003161
423 Ga0207688_10127240
424 Ga0207688_10248097
425 Ga0207647_10027024
426 Ga0207643_10007415
427 Ga0207705_10054067
428 Ga0207660_10042767
429 Ga0207660_10078470
430 Ga0207657_10014967
431 Ga0207657_10341869
432 Ga0207652_10060804
433 Ga0207652_10693540
434 Ga0207694_10112499
435 Ga0207694_10120301
436 Ga0207659_10395041
437 Ga0207687_10126938
438 Ga0207687_10357582
439 Ga0207690_10015902
440 Ga0207690_10050792
441 Ga0207706_10085135
442 Ga0207706_10181190
443 Ga0207709_10048574
444 Ga0207670_10384859
445 Ga0207669_10059867
446 Ga0207704_10036595
447 Ga0207665_10000093
448 Ga0207711_10561250
449 Ga0207661_10017618
450 Ga0207661_10271924
451 Ga0207661_10749528
452 Ga0207679_10091472
453 Ga0207667_10111563
454 Ga0207712_10019177
455 Ga0207712_10130054
456 Ga0207640_10466626
457 Ga0207658_10067577
458 Ga0207677_10021085
459 Ga0207677_10048053
460 Ga0207677_10849976
461 Ga0207639_10064793
462 Ga0207678_10015477
463 Ga0207678_10190531
464 Ga0207678_10298550
465 Ga0207708_10006573
466 Ga0207702_10196896
467 Ga0207702_10408901
468 Ga0207648_10004906
469 Ga0207676_10066118
470 Ga0207674_10567288
471 Ga0207675_100004039
472 Ga0207675_100015644
473 Ga0207683_10001142
474 Ga0207683_10141486
475 Ga0207698_10008727
476 Ga0207698_10628874
477 Ga0207428_10281218
478 Ga0268266_10004367
479 Ga0268265_10106402
480 Ga0265338_10134283
481 Ga0307511_10001508
482 Ga0265330_10119330
483 Ga0265320_10026636
484 Ga0265340_10023800
485 Ga0265339_10012328
486 Ga0307408_100629069
487 Ga0265313_10039793
488 Ga0265314_10021317
489 Ga0265342_10114054
490 Ga0307405_10295626
491 Ga0307413_10020490
492 Ga0307410_10027589
493 Ga0307410_10165780
494 Ga0307410_10324187
495 Ga0307410_10340394
496 Ga0307410_10480203
497 Ga0307410_10951494
498 Ga0326468_10004383
499 Ga0307406_10091401
500 Ga0307406_10426969
501 Ga0307407_10161075
502 Ga0307407_10164332
503 Ga0307407_10307520
504 Ga0307407_10487935
505 Ga0307407_10660915
506 Ga0307412_10115390
507 Ga0307409_100056001
508 Ga0307409_100095044
509 Ga0307409_100175768
510 Ga0307409_100371665
511 Ga0307409_100405216
512 Ga0307409_100444805
513 Ga0307409_100451143
514 Ga0307416_100124737
515 Ga0307416_100656955
516 Ga0307416_100900823
517 Ga0307414_10091812
518 Ga0307414_10182969
519 Ga0307411_10114146
520 Ga0307411_10487626
521 Ga0307415_100030992
522 Ga0307415_100035863
523 Ga0307415_100076915
524 Ga0307415_100095575
525 Ga0307415_100111741
526 Ga0307415_100141660
527 Ga0307415_100197431
528 Ga0307415_100438960
529 Ga0307415_100555398
530 Ga0307415_101080256
531 Ga0373930_0003655
532 Ga0373938_0002639
533 Ga0373929_0012029
534 Ga0373951_0006866
535 Ga0373960_0006738
536 Ga0373942_0011880
537 Ga0373962_0036510
538 Ga0373925_0823497
539 Ga0395899_0206000
540 Ga0395900_0085911
541 Ga0395900_0134682
542 Ga0395898_0052182
543 Ga0395898_0395326
544 Ga0395905_0313775
545 Ga0395901_0031806
546 Ga0395901_0167250
547 Ga0395901_0271120
548 Ga0451800_0234817
549 Ga0439464_0039604
550 Ga0466969_0011983
551 Ga0466965_0013199
552 Ga0466965_0040716
553 Ga0466965_0068318
554 Ga0466965_0163984
555 Ga0466965_0171063
556 Ga0466965_0221134
557 Ga0466965_0239422
558 Ga0466966_0004375
559 Ga0466966_0092374
560 Ga0466966_0102233
561 Ga0466961_0002074
562 Ga0466961_0036117
563 Ga0466961_0114947
564 Ga0466963_0009180
565 Ga0466963_0033537
566 Ga0466963_0070391
567 Ga0466963_0088506
568 Ga0466963_0196229
569 Ga0466963_0615687
570 Ga0466964_0047298
571 Ga0466971_0043162
572 Ga0466971_0112401
573 Ga0466971_0134324
574 Ga0466971_0162257
575 Ga0466970_0051038
576 Ga0466970_0066537
577 Ga0466970_0121374
578 Ga0466970_0206630
579 Ga0466957_0006837
580 Ga0466957_0052095
581 Ga0466960_0006219
582 Ga0466960_0028282
583 Ga0466960_0037545
584 Ga0466960_0081733
585 Ga0466960_0157230
586 Ga0466960_0273754
587 Ga0466959_0024680
588 Ga0466959_0042345
589 Ga0466959_0077273
590 Ga0466959_0084879
591 Ga0466959_0109208
592 Ga0466959_0137042
593 Ga0466959_0431692
594 Ga0466958_0004498
595 Ga0466958_0164220
596 Ga0466958_0175215
597 Ga0466958_0292438
598 Ga0466958_0766144
599 Ga0466967_0000522
600 Ga0466967_0021232
601 Ga0466967_0035747
602 Ga0466967_0045290
603 Ga0466967_0061978
604 Ga0466967_0071374
605 Ga0466967_0122237
606 Ga0466967_0182428
607 Ga0466967_0239992
608 Ga0466967_0408867
609 Ga0466967_0932653
610 Ga0495653_0018195
611 Ga0495663_0095359
612 Ga0495635_0241513
613 Ga0495676_0225115
614 Ga0496100_0767732
615 Ga0496102_0040274
616 Ga0496104_0605792
617 Ga0496107_0498170
618 Ga0496108_0063475
619 Ga0496108_0726646
620 Ga0496108_0832805
621 Ga0496109_0324962
622 Ga0496109_0374455
623 Ga0496109_0393975
624 Ga0496110_0036914
625 Ga0496110_0108972
626 Ga0496110_0263399
627 Ga0496110_0889141
628 Ga0496111_0184423
629 Ga0496114_0098429
630 Ga0496114_0274638
631 Ga0496114_0596291
632 Ga0496114_0771353
633 Ga0496115_0107749
634 Ga0496126_0000055
635 Ga0496126_0093947
636 Ga0501038_0281943
637 Ga0501047_0500606
638 Ga0501067_0011667
639 Ga0501067_0011899
640 Ga0501067_0016206
641 Ga0501068_0107619
642 Ga0501069_0070712
643 Ga0501070_0200989
644 Ga0501070_0298462
645 Ga0501044_0310966
646 nmdc:mga00v17_292213_c1
647 nmdc:mga0yw44_181427_c1
648 nmdc:mga0yw44_9708_c1
649 nmdc:mga05p37_311953_c1
650 nmdc:mga08y16_53602_c1
651 nmdc:mga0n895_15136_c1
652 nmdc:mga0rr50_251965_c1
653 nmdc:mga0a205_86940_c1
654 Ga0495595_0021806
655 Ga0500556_0002907
656 Ga0500593_000160
657 Ga0500573_0003926
658 Ga0500573_0103356
659 Ga0466962_0002126
660 Ga0466962_0010437
661 Ga0466962_0064224
662 Ga0466962_0206777
663 Ga0466962_0228234
664 2984595448

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00174

Oxidored_molyb

Oxidoreductase molybdopterin binding domain

83

230

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xdy-assembly7.cif.gz_G structural and biochemical identification of a novel bacterial oxidoreductase, w-containing cofactor 0.9041 41 192
1xdq-assembly3.cif.gz_C structural and biochemical identification of a novel bacterial oxidoreductase 0.9026 41 192
2bpb-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella 0.8891 41 187
2c9x-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella y236f mutant 0.8889 41 187
2ca3-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella r55m mutant 0.8887 41 187
ID Description Score Start End Superfamily
3pjyA00 Mainly Beta;Sandwich;Jelly Rolls;Protein of unknown function DUF192 0.9215 109 124 2.60.120.1140
1xdyH00 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9047 41 192 3.90.420.10
2ca4A01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8851 32 187 3.90.420.10
af_Q54XJ8_10_262_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8797 32 187 3.90.420.10
af_P11035_116_359_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8784 32 182 3.90.420.10
ID Description Score Start End GO Terms
AF-A0A7Y6A7Q0-F1-model_v4 Sulfite oxidase-like oxidoreductase 0.979 19 190
AF-A0A538ND30-F1-model_v4 Sulfite oxidase-like oxidoreductase 0.9626 18 199
AF-A0A2T6DYQ4-F1-model_v4 Sulfite oxidase-like oxidoreductase 0.962 18 199
AF-A0A2V6CY43-F1-model_v4 Sulfite oxidase-like oxidoreductase 0.962 60 176
AF-A0A1G1M3C8-F1-model_v4 Oxidoreductase 0.9602 44 199

Map