F410985

General Info

Members Datasets Scaffolds Average Seq Length
332 221 664 162

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10000520|Ga0307513_1000052045
Length 195
Sequence VTELSGAGRQPESVDVIGRALVITASNRAATGVYADRGGPVLAEGLRNWGFTVDGPLVVPDGEPVAEALRDAVRQQYDVVLTTGGTGLSPTDRTPEATRAVLEREVPGLAEAIRYRGTSAGIPTAALSRGLAGLAGRTLIVNLPGSPGGCRDGLAVLDGVLLHAVDQIRGGDHPSASPSSSGFPGSDLAEPVHRG

Samples

Sample ID Description Type Environment
1 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
33 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
64 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
65 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
66 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
67 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
68 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
69 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
70 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
71 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
72 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
73 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
74 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
75 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
76 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
82 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
83 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
84 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
85 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
86 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
87 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
88 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
89 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
90 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
91 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
92 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
93 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
94 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
95 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
96 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
97 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
98 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
99 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
100 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
101 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
102 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
103 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
104 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
107 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
108 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
109 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
110 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
111 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
112 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
113 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
114 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
115 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
116 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
117 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
118 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
119 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
120 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
121 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
122 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
123 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
124 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
125 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
126 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
127 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
128 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
129 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
130 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
131 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
132 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
133 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
134 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
135 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
136 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
137 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
138 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
141 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
157 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
158 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
159 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
160 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
163 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
164 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
165 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
166 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
169 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
170 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
173 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
174 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
175 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
176 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
180 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
181 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
182 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
183 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
184 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
185 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
186 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
187 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
188 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
189 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
190 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
191 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
192 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
193 2501939600 Micromonospora sp. L5 Isolate Unclassified
194 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
195 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
196 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
197 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
198 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
199 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
200 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
201 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
202 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
203 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
204 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
205 2867475112 Streptomyces sp. TM32 Isolate Unclassified
206 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
207 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
208 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
209 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
210 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
211 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
212 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
213 649633069 Micromonospora sp. L5 Isolate Unclassified
214 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
215 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
216 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
217 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
218 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
219 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
220 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
221 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.27
Metatranscriptomes 0
Isolates 8.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.93
Nodule 0.6
Rhizoplane 2.41
Rhizosphere 78.92
Stem 0
Stem Tuber 0
Unclassified 1.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307513_10000520 3300031456 Bacteria 55252
2 JGI25406J46586_10159174 3300003203 Bacteria 659
3 rootH2_10035622 3300003320 Bacteria 4885
4 JGI25160J50197_1010936 3300003354 Bacteria 3252
5 Ga0070683_100025261 3300005329 Bacteria 5332
6 Ga0068869_100804353 3300005334 Bacteria 808
7 Ga0070680_100242700 3300005336 Bacteria 1523
8 Ga0070680_101053130 3300005336 Bacteria 703
9 Ga0070682_100383211 3300005337 Bacteria 1058
10 Ga0070682_100493772 3300005337 Bacteria 947
11 Ga0070668_100027806 3300005347 Bacteria 4293
12 Ga0070675_100761654 3300005354 Bacteria 884
13 Ga0070667_100083685 3300005367 Bacteria 2734
14 Ga0070667_100174163 3300005367 Bacteria 1901
15 Ga0070709_10047407 3300005434 Bacteria 2677
16 Ga0070714_100603940 3300005435 Bacteria 1054
17 Ga0070713_100605441 3300005436 Bacteria 1041
18 Ga0070685_10057975 3300005466 Bacteria 2256
19 Ga0070685_10280352 3300005466 Bacteria 1116
20 Ga0070684_100337083 3300005535 Bacteria 1386
21 Ga0068855_100095126 3300005563 Bacteria 3434
22 Ga0070664_101254297 3300005564 Bacteria 700
23 Ga0068856_100172548 3300005614 Bacteria 2175
24 Ga0068852_101047666 3300005616 Bacteria 835
25 Ga0068861_100566775 3300005719 Bacteria 1037
26 Ga0068861_100953845 3300005719 Bacteria 816
27 Ga0068861_101493318 3300005719 Bacteria 663
28 Ga0068870_10127490 3300005840 Bacteria 1474
29 Ga0068863_101233283 3300005841 Bacteria 754
30 Ga0068860_100000314 3300005843 Bacteria 66294
31 Ga0081539_10003194 3300005985 Bacteria 20724
32 Ga0075365_10053499 3300006038 Bacteria 2674
33 Ga0075365_10173695 3300006038 Bacteria 1505
34 Ga0075364_10059241 3300006051 Bacteria 2510
35 Ga0075364_10070160 3300006051 Bacteria 2306
36 Ga0075367_10099638 3300006178 Bacteria 1775
37 Ga0075428_100006102 3300006844 Bacteria 13400
38 Ga0075428_100017260 3300006844 Bacteria 7976
39 Ga0075428_100583790 3300006844 Bacteria 1194
40 Ga0075430_100002236 3300006846 Bacteria 16035
41 Ga0075430_100002375 3300006846 Bacteria 15634
42 Ga0075429_100014563 3300006880 Bacteria 6815
43 Ga0075435_100475550 3300007076 Bacteria 1079
44 Ga0105247_10783990 3300009101 Bacteria 726
45 Ga0114129_10022780 3300009147 Bacteria 8881
46 Ga0114129_10025049 3300009147 Bacteria 8457
47 Ga0105238_11816323 3300009551 Bacteria 642
48 Ga0105238_12718367 3300009551 Bacteria 531
49 Ga0157370_10534032 3300013104 Bacteria 1076
50 Ga0157369_10039614 3300013105 Bacteria 5149
51 Ga0157378_10409610 3300013297 Bacteria 1338
52 Ga0163162_10733424 3300013306 Bacteria 1108
53 Ga0157372_10203303 3300013307 Bacteria 2295
54 Ga0157375_10571411 3300013308 Bacteria 1291
55 Ga0163163_10075350 3300014325 Bacteria 3368
56 Ga0163163_10221959 3300014325 Bacteria 1939
57 Ga0163163_10851281 3300014325 Bacteria 975
58 Ga0157377_10086955 3300014745 Bacteria 1838
59 Ga0157379_10226354 3300014968 Bacteria 1695
60 Ga0157379_10807250 3300014968 Bacteria 886
61 Ga0163161_10011458 3300017792 Bacteria 6151
62 Ga0207426_1007298 3300025302 Bacteria 4646
63 Ga0207426_1031994 3300025302 Bacteria 1710
64 Ga0207699_10462428 3300025906 Bacteria 912
65 Ga0207687_10228363 3300025927 Bacteria 1469
66 Ga0207686_10956501 3300025934 Bacteria 693
67 Ga0207691_10080768 3300025940 Bacteria 2924
68 Ga0207689_10079800 3300025942 Bacteria 2689
69 Ga0207689_10117298 3300025942 Bacteria 2189
70 Ga0207667_10091187 3300025949 Bacteria 3148
71 Ga0207658_10507390 3300025986 Bacteria 1075
72 Ga0207703_10274251 3300026035 Bacteria 1529
73 Ga0207678_10958175 3300026067 Bacteria 757
74 Ga0207678_11678867 3300026067 Bacteria 558
75 Ga0207702_10290180 3300026078 Bacteria 1549
76 Ga0207702_10659378 3300026078 Bacteria 1029
77 Ga0207641_11122357 3300026088 Bacteria 785
78 Ga0207641_11311713 3300026088 Bacteria 724
79 Ga0207648_10551481 3300026089 Bacteria 1059
80 Ga0207675_100114320 3300026118 Bacteria 2549
81 Ga0207675_100579102 3300026118 Bacteria 1124
82 Ga0207683_10028535 3300026121 Bacteria 4825
83 Ga0207683_10128908 3300026121 Bacteria 2274
84 Ga0268266_10279156 3300028379 Bacteria 1553
85 Ga0268264_10007457 3300028381 Bacteria 9129
86 Ga0268264_10028837 3300028381 Bacteria 4543
87 Ga0307517_10047565 3300028786 Bacteria 4441
88 Ga0307515_10009332 3300028794 Bacteria 18986
89 Ga0307515_10014839 3300028794 Bacteria 14403
90 Ga0307515_10094409 3300028794 Bacteria 3695
91 Ga0307515_10431477 3300028794 Bacteria 936
92 Ga0307512_10003921 3300030522 Bacteria 16677
93 Ga0307512_10045304 3300030522 Bacteria 3604
94 Ga0265327_10000001 3300031251 Bacteria 894475
95 Ga0307513_10024753 3300031456 Bacteria 6978
96 Ga0307513_10042580 3300031456 Bacteria 4998
97 Ga0307513_10191011 3300031456 Bacteria 1900
98 Ga0307509_10013767 3300031507 Bacteria 9546
99 Ga0307408_100045401 3300031548 Bacteria 3138
100 Ga0307408_100238113 3300031548 Bacteria 1494
101 Ga0307508_10001533 3300031616 Bacteria 25846
102 Ga0307508_10015908 3300031616 Bacteria 6854
103 Ga0307514_10124153 3300031649 Bacteria 1793
104 Ga0307516_10389114 3300031730 Bacteria 1055
105 Ga0307405_10043610 3300031731 Bacteria 2738
106 Ga0307405_10085746 3300031731 Bacteria 2071
107 Ga0307410_10018317 3300031852 Bacteria 4230
108 Ga0307410_10102109 3300031852 Bacteria 2057
109 Ga0307410_10403589 3300031852 Bacteria 1105
110 Ga0307406_10004035 3300031901 Bacteria 7984
111 Ga0307406_10006337 3300031901 Bacteria 6528
112 Ga0307406_10072715 3300031901 Bacteria 2258
113 Ga0307406_10377888 3300031901 Bacteria 1116
114 Ga0307407_10072813 3300031903 Bacteria 2051
115 Ga0307407_10205068 3300031903 Bacteria 1324
116 Ga0307407_10255221 3300031903 Bacteria 1203
117 Ga0307407_10280033 3300031903 Bacteria 1155
118 Ga0307407_10415522 3300031903 Bacteria 968
119 Ga0307407_10617632 3300031903 Bacteria 809
120 Ga0307412_10360813 3300031911 Bacteria 1170
121 Ga0307409_100000518 3300031995 Bacteria 16635
122 Ga0307409_100003335 3300031995 Bacteria 8690
123 Ga0307409_100064335 3300031995 Bacteria 2881
124 Ga0307409_100152607 3300031995 Bacteria 2008
125 Ga0307409_100469611 3300031995 Bacteria 1218
126 Ga0307409_100472325 3300031995 Bacteria 1215
127 Ga0307416_100016338 3300032002 Bacteria 5155
128 Ga0307416_100126946 3300032002 Bacteria 2286
129 Ga0307416_100950768 3300032002 Bacteria 961
130 Ga0307416_101099148 3300032002 Bacteria 900
131 Ga0307416_102581908 3300032002 Bacteria 606
132 Ga0307411_10027502 3300032005 Bacteria 3443
133 Ga0307411_10110320 3300032005 Bacteria 1967
134 Ga0307415_100000009 3300032126 Bacteria 90122
135 Ga0307415_100014390 3300032126 Bacteria 4650
136 Ga0307415_100063401 3300032126 Bacteria 2568
137 Ga0307510_10186601 3300033180 Bacteria 1628
138 Ga0373938_0002040 3300034957 Bacteria 3239
139 Ga0373941_0047693 3300035115 Bacteria 1350
140 Ga0373935_0006496 3300035692 Bacteria 6986
141 Ga0373925_0277999 3300037068 Bacteria 1348
142 Ga0451789_0231866 3300041443 Bacteria 1451
143 Ga0451793_1151039 3300041452 Bacteria 1637
144 Ga0451797_0225105 3300041453 Bacteria 623
145 Ga0451802_1623828 3300041460 Bacteria 1516
146 Ga0451833_0036334 3300041491 Bacteria 604
147 Ga0451841_0165799 3300041498 Bacteria 1337
148 Ga0451841_0635374 3300041498 Bacteria 1065
149 Ga0451853_0007362 3300041512 Bacteria 788
150 Ga0451853_3544865 3300041512 Bacteria 727
151 Ga0439459_0062325 3300042438 Bacteria 845
152 Ga0466969_0019804 3300044656 Bacteria 3490
153 Ga0466969_0095868 3300044656 Bacteria 1401
154 Ga0466965_0215199 3300044683 Bacteria 1023
155 Ga0466966_0472040 3300044684 Bacteria 754
156 Ga0466964_0004150 3300044706 Bacteria 5329
157 Ga0466964_0198380 3300044706 Bacteria 962
158 Ga0453684_0083876 3300044712 Unclassified 3965
159 Ga0453684_0094001 3300044712 Bacteria 3691
160 Ga0453684_0175060 3300044712 Unclassified 2525
161 Ga0466971_0057862 3300044719 Bacteria 1749
162 Ga0466971_0076236 3300044719 Bacteria 1526
163 Ga0466971_0161056 3300044719 Bacteria 1050
164 Ga0466971_0178589 3300044719 Bacteria 997
165 Ga0466971_0224929 3300044719 Bacteria 890
166 Ga0466971_0329187 3300044719 Bacteria 737
167 Ga0466970_0108511 3300044765 Bacteria 1515
168 Ga0466970_0479873 3300044765 Bacteria 715
169 Ga0466957_0034080 3300044842 Bacteria 3055
170 Ga0466957_0117346 3300044842 Bacteria 1694
171 Ga0466960_0103386 3300044901 Bacteria 1470
172 Ga0466959_0005272 3300045049 Bacteria 8831
173 Ga0466958_0161444 3300045836 Bacteria 1416
174 Ga0466967_0064936 3300045976 Bacteria 3247
175 Ga0466967_0764232 3300045976 Bacteria 959
176 Ga0495592_0112215 3300046454 Bacteria 1927
177 Ga0495629_0433824 3300046459 Bacteria 891
178 Ga0495638_0084981 3300046460 Bacteria 1914
179 Ga0495651_0009439 3300046462 Bacteria 7492
180 Ga0495580_0037963 3300046472 Bacteria 3453
181 Ga0495662_0000375 3300046476 Bacteria 19754
182 Ga0495662_0017982 3300046476 Bacteria 3420
183 Ga0495664_0003065 3300046477 Bacteria 9055
184 Ga0495610_0135742 3300046512 Bacteria 1064
185 Ga0495618_0146855 3300046514 Bacteria 1507
186 Ga0495628_0005407 3300046516 Bacteria 11190
187 Ga0495630_0142920 3300046517 Bacteria 1819
188 Ga0495630_0312237 3300046517 Bacteria 1202
189 Ga0495632_0261766 3300046519 Bacteria 773
190 Ga0495666_0003939 3300046526 Bacteria 7504
191 Ga0495665_0002970 3300046531 Bacteria 9164
192 Ga0495640_0017759 3300046533 Bacteria 5293
193 Ga0495586_0006934 3300046535 Bacteria 6036
194 Ga0495587_0019037 3300046536 Bacteria 4253
195 Ga0495645_0029794 3300046543 Bacteria 3972
196 Ga0495667_0189031 3300046559 Bacteria 1320
197 Ga0495668_0358938 3300046616 Bacteria 800
198 Ga0495588_0594105 3300046674 Bacteria 580
199 Ga0495657_0007529 3300046675 Bacteria 8411
200 Ga0495599_0014091 3300046678 Bacteria 4949
201 Ga0495613_0006217 3300046689 Bacteria 8930
202 Ga0495613_0018582 3300046689 Bacteria 5182
203 Ga0495600_0387832 3300046809 Bacteria 871
204 Ga0495581_0013599 3300047315 Bacteria 4721
205 Ga0495604_0001175 3300047317 Bacteria 21642
206 Ga0495674_0153854 3300047319 Bacteria 1927
207 Ga0495675_0005871 3300047444 Bacteria 7501
208 Ga0495675_0305575 3300047444 Bacteria 944
209 Ga0495684_0010644 3300047471 Bacteria 7108
210 Ga0495686_0221165 3300047472 Bacteria 1077
211 Ga0496103_0854874 3300048906 Bacteria 572
212 Ga0496108_0000196 3300048911 Bacteria 55981
213 Ga0496112_0293200 3300048915 Bacteria 1573
214 Ga0496112_0776227 3300048915 Bacteria 884
215 Ga0496126_0118295 3300048929 Bacteria 2301
216 Ga0501031_0000683 3300049568 Bacteria 20253
217 Ga0501032_0000291 3300049569 Bacteria 42013
218 Ga0501032_0217619 3300049569 Bacteria 1244
219 Ga0501033_0026685 3300049570 Bacteria 4345
220 Ga0501034_0003231 3300049571 Bacteria 18662
221 Ga0501036_0015009 3300049572 Bacteria 6464
222 Ga0501037_0000280 3300049573 Bacteria 43512
223 Ga0501037_0138423 3300049573 Bacteria 1743
224 Ga0501037_0463918 3300049573 Bacteria 863
225 Ga0501038_0000883 3300049574 Bacteria 26567
226 Ga0501039_0000382 3300049575 Bacteria 31795
227 Ga0501039_0448153 3300049575 Bacteria 1014
228 Ga0501040_0154831 3300049576 Bacteria 1618
229 Ga0501041_0114584 3300049577 Bacteria 1674
230 Ga0501042_0246100 3300049578 Bacteria 1290
231 Ga0501043_0001643 3300049579 Bacteria 19416
232 Ga0501043_0491198 3300049579 Bacteria 918
233 Ga0501046_0000442 3300049580 Bacteria 41660
234 Ga0501047_0014474 3300049581 Bacteria 7502
235 Ga0501048_0000716 3300049582 Bacteria 24260
236 Ga0501067_0000956 3300049583 Bacteria 15478
237 Ga0501067_0015813 3300049583 Bacteria 4174
238 Ga0501068_0008820 3300049584 Bacteria 5625
239 Ga0501068_0009207 3300049584 Bacteria 5518
240 Ga0501068_0171936 3300049584 Bacteria 1368
241 Ga0501068_0590211 3300049584 Bacteria 723
242 Ga0501069_0007077 3300049585 Bacteria 5874
243 Ga0501069_0059038 3300049585 Bacteria 2140
244 Ga0501069_0078052 3300049585 Bacteria 1862
245 Ga0501069_0283842 3300049585 Bacteria 969
246 Ga0501070_0004564 3300049586 Bacteria 11875
247 Ga0501070_0052290 3300049586 Bacteria 3390
248 Ga0501071_0089826 3300049587 Bacteria 2255
249 Ga0501071_0152802 3300049587 Bacteria 1723
250 Ga0501071_0303537 3300049587 Bacteria 1210
251 Ga0501072_0004451 3300049588 Bacteria 10643
252 Ga0501072_0159275 3300049588 Bacteria 1801
253 Ga0501072_0267924 3300049588 Bacteria 1359
254 Ga0501072_0403132 3300049588 Unclassified 1085
255 Ga0501073_0001462 3300049589 Bacteria 17490
256 Ga0501073_0039309 3300049589 Bacteria 3351
257 Ga0501074_0003804 3300049590 Bacteria 10731
258 Ga0501074_0003950 3300049590 Bacteria 10564
259 Ga0501074_0465752 3300049590 Bacteria 896
260 Ga0501076_0088096 3300049592 Bacteria 2495
261 Ga0501076_0189143 3300049592 Bacteria 1680
262 Ga0501076_1047870 3300049592 Bacteria 672
263 Ga0501077_0047234 3300049593 Bacteria 2735
264 Ga0501079_0088950 3300049741 Bacteria 2391
265 Ga0501080_0001004 3300049742 Bacteria 23167
266 Ga0501080_0007872 3300049742 Bacteria 9645
267 Ga0501081_0213765 3300049743 Bacteria 1401
268 Ga0501083_0001725 3300049744 Bacteria 14895
269 Ga0501035_0025105 3300049822 Bacteria 5463
270 Ga0501044_0002104 3300049823 Bacteria 22907
271 Ga0501045_0099853 3300049824 Bacteria 2148
272 nmdc:mga03n38_174204_c1 3300050490 Bacteria 1098
273 nmdc:mga00v17_21379_c1 3300050491 Bacteria 3719
274 nmdc:mga00v17_292932_c1 3300050491 Bacteria 1057
275 nmdc:mga0yw44_158377_c1 3300050492 Bacteria 1481
276 nmdc:mga0yw44_69625_c1 3300050492 Bacteria 2180
277 nmdc:mga06z11_271686_c1 3300050494 Bacteria 1002
278 nmdc:mga05p37_11247_c1 3300050507 Bacteria 10644
279 nmdc:mga05p37_1188049_c1 3300050507 Bacteria 789
280 nmdc:mga05p37_11911_c1 3300050507 Bacteria 10371
281 nmdc:mga09592_141024_c1 3300050508 Bacteria 2078
282 nmdc:mga09592_7996_c1 3300050508 Bacteria 8599
283 nmdc:mga0qj67_24_c1 3300050509 Bacteria 106844
284 nmdc:mga0qj67_52978_c1 3300050509 Bacteria 3212
285 nmdc:mga06r32_226_c2 3300050510 Bacteria 42893
286 nmdc:mga06r32_6901_c1 3300050510 Bacteria 10209
287 Ga0495655_0115965 3300053083 Bacteria 810
288 Ga0495619_0067677 3300053085 Bacteria 2385
289 Ga0500643_000216 3300053087 Bacteria 54230
290 Ga0500641_0002497 3300053096 Bacteria 6503
291 Ga0500641_0322567 3300053096 Bacteria 628
292 Ga0500652_025956 3300053131 Bacteria 2251
293 Ga0500568_0006602 3300053139 Bacteria 5802
294 Ga0500604_0039396 3300053151 Bacteria 1421
295 Ga0500616_0000470 3300053153 Bacteria 52404
296 Ga0500616_0008666 3300053153 Bacteria 6284
297 Ga0500633_0226375 3300053160 Bacteria 698
298 Ga0501084_0005680 3300054114 Bacteria 10243
299 Ga0501084_0299254 3300054114 Unclassified 1359
300 Ga0501082_0055615 3300060353 Bacteria 3408
301 Ga0501082_0192278 3300060353 Bacteria 1775
302 Ga0466962_0047278 3300061719 Bacteria 2056
303 Ga0466962_0267451 3300061719 Bacteria 842
304 2501944836 2501939600 Bacteria 6907073
305 2515854521 2515154155 Bacteria 7985436
306 2623585735 2622736626 Bacteria 7181580
307 2644323929 2643221657 Bacteria 5490246
308 2644429750 2643221677 Bacteria 7584031
309 2731909204 2731639228 Bacteria 4187555
310 2772642861 2772190715 Bacteria 6959372
311 2811848823 2808606982 Bacteria 7791042
312 2827628867 2827628540 Bacteria 6858585
313 2856859621 2856858025 Bacteria 7255264
314 2858904938 2858902515 Bacteria 7086037
315 2862707863 2862705112 Bacteria 6563286
316 2867478482 2867475112 Bacteria 6909112
317 2880494502 2880489317 Bacteria 7096270
318 2929226375 2929219909 Bacteria 6984360
319 2929233076 2929226422 Bacteria 7248583
320 2935392551 2935390628 Bacteria 7043367
321 2990046957 2990044586 Bacteria 6603797
322 2997455914 2997451912 Bacteria 8492419
323 3006493483 3006486233 Bacteria 8157040
324 649816329 649633069 Bacteria 6962533
325 8003836033 8003830390 Bacteria 6541657
326 8003873036 8003870546 Bacteria 7396674
327 8008485573 8008485437 Bacteria 7198341
328 8025481077 8025478263 Bacteria 8209203
329 8054709611 8054704163 Bacteria 7247792
330 8054729602 8054727385 Bacteria 7558670
331 8056447611 8056447290 Bacteria 7680491
332 8057570968 8057568493 Bacteria 7221719
333 Ga0307513_10000520
334 JGI25406J46586_10159174
335 rootH2_10035622
336 JGI25160J50197_1010936
337 Ga0070683_100025261
338 Ga0068869_100804353
339 Ga0070680_100242700
340 Ga0070680_101053130
341 Ga0070682_100383211
342 Ga0070682_100493772
343 Ga0070668_100027806
344 Ga0070675_100761654
345 Ga0070667_100083685
346 Ga0070667_100174163
347 Ga0070709_10047407
348 Ga0070714_100603940
349 Ga0070713_100605441
350 Ga0070685_10057975
351 Ga0070685_10280352
352 Ga0070684_100337083
353 Ga0068855_100095126
354 Ga0070664_101254297
355 Ga0068856_100172548
356 Ga0068852_101047666
357 Ga0068861_100566775
358 Ga0068861_100953845
359 Ga0068861_101493318
360 Ga0068870_10127490
361 Ga0068863_101233283
362 Ga0068860_100000314
363 Ga0081539_10003194
364 Ga0075365_10053499
365 Ga0075365_10173695
366 Ga0075364_10059241
367 Ga0075364_10070160
368 Ga0075367_10099638
369 Ga0075428_100006102
370 Ga0075428_100017260
371 Ga0075428_100583790
372 Ga0075430_100002236
373 Ga0075430_100002375
374 Ga0075429_100014563
375 Ga0075435_100475550
376 Ga0105247_10783990
377 Ga0114129_10022780
378 Ga0114129_10025049
379 Ga0105238_11816323
380 Ga0105238_12718367
381 Ga0157370_10534032
382 Ga0157369_10039614
383 Ga0157378_10409610
384 Ga0163162_10733424
385 Ga0157372_10203303
386 Ga0157375_10571411
387 Ga0163163_10075350
388 Ga0163163_10221959
389 Ga0163163_10851281
390 Ga0157377_10086955
391 Ga0157379_10226354
392 Ga0157379_10807250
393 Ga0163161_10011458
394 Ga0207426_1007298
395 Ga0207426_1031994
396 Ga0207699_10462428
397 Ga0207687_10228363
398 Ga0207686_10956501
399 Ga0207691_10080768
400 Ga0207689_10079800
401 Ga0207689_10117298
402 Ga0207667_10091187
403 Ga0207658_10507390
404 Ga0207703_10274251
405 Ga0207678_10958175
406 Ga0207678_11678867
407 Ga0207702_10290180
408 Ga0207702_10659378
409 Ga0207641_11122357
410 Ga0207641_11311713
411 Ga0207648_10551481
412 Ga0207675_100114320
413 Ga0207675_100579102
414 Ga0207683_10028535
415 Ga0207683_10128908
416 Ga0268266_10279156
417 Ga0268264_10007457
418 Ga0268264_10028837
419 Ga0307517_10047565
420 Ga0307515_10009332
421 Ga0307515_10014839
422 Ga0307515_10094409
423 Ga0307515_10431477
424 Ga0307512_10003921
425 Ga0307512_10045304
426 Ga0265327_10000001
427 Ga0307513_10024753
428 Ga0307513_10042580
429 Ga0307513_10191011
430 Ga0307509_10013767
431 Ga0307408_100045401
432 Ga0307408_100238113
433 Ga0307508_10001533
434 Ga0307508_10015908
435 Ga0307514_10124153
436 Ga0307516_10389114
437 Ga0307405_10043610
438 Ga0307405_10085746
439 Ga0307410_10018317
440 Ga0307410_10102109
441 Ga0307410_10403589
442 Ga0307406_10004035
443 Ga0307406_10006337
444 Ga0307406_10072715
445 Ga0307406_10377888
446 Ga0307407_10072813
447 Ga0307407_10205068
448 Ga0307407_10255221
449 Ga0307407_10280033
450 Ga0307407_10415522
451 Ga0307407_10617632
452 Ga0307412_10360813
453 Ga0307409_100000518
454 Ga0307409_100003335
455 Ga0307409_100064335
456 Ga0307409_100152607
457 Ga0307409_100469611
458 Ga0307409_100472325
459 Ga0307416_100016338
460 Ga0307416_100126946
461 Ga0307416_100950768
462 Ga0307416_101099148
463 Ga0307416_102581908
464 Ga0307411_10027502
465 Ga0307411_10110320
466 Ga0307415_100000009
467 Ga0307415_100014390
468 Ga0307415_100063401
469 Ga0307510_10186601
470 Ga0373938_0002040
471 Ga0373941_0047693
472 Ga0373935_0006496
473 Ga0373925_0277999
474 Ga0451789_0231866
475 Ga0451793_1151039
476 Ga0451797_0225105
477 Ga0451802_1623828
478 Ga0451833_0036334
479 Ga0451841_0165799
480 Ga0451841_0635374
481 Ga0451853_0007362
482 Ga0451853_3544865
483 Ga0439459_0062325
484 Ga0466969_0019804
485 Ga0466969_0095868
486 Ga0466965_0215199
487 Ga0466966_0472040
488 Ga0466964_0004150
489 Ga0466964_0198380
490 Ga0453684_0083876
491 Ga0453684_0094001
492 Ga0453684_0175060
493 Ga0466971_0057862
494 Ga0466971_0076236
495 Ga0466971_0161056
496 Ga0466971_0178589
497 Ga0466971_0224929
498 Ga0466971_0329187
499 Ga0466970_0108511
500 Ga0466970_0479873
501 Ga0466957_0034080
502 Ga0466957_0117346
503 Ga0466960_0103386
504 Ga0466959_0005272
505 Ga0466958_0161444
506 Ga0466967_0064936
507 Ga0466967_0764232
508 Ga0495592_0112215
509 Ga0495629_0433824
510 Ga0495638_0084981
511 Ga0495651_0009439
512 Ga0495580_0037963
513 Ga0495662_0000375
514 Ga0495662_0017982
515 Ga0495664_0003065
516 Ga0495610_0135742
517 Ga0495618_0146855
518 Ga0495628_0005407
519 Ga0495630_0142920
520 Ga0495630_0312237
521 Ga0495632_0261766
522 Ga0495666_0003939
523 Ga0495665_0002970
524 Ga0495640_0017759
525 Ga0495586_0006934
526 Ga0495587_0019037
527 Ga0495645_0029794
528 Ga0495667_0189031
529 Ga0495668_0358938
530 Ga0495588_0594105
531 Ga0495657_0007529
532 Ga0495599_0014091
533 Ga0495613_0006217
534 Ga0495613_0018582
535 Ga0495600_0387832
536 Ga0495581_0013599
537 Ga0495604_0001175
538 Ga0495674_0153854
539 Ga0495675_0005871
540 Ga0495675_0305575
541 Ga0495684_0010644
542 Ga0495686_0221165
543 Ga0496103_0854874
544 Ga0496108_0000196
545 Ga0496112_0293200
546 Ga0496112_0776227
547 Ga0496126_0118295
548 Ga0501031_0000683
549 Ga0501032_0000291
550 Ga0501032_0217619
551 Ga0501033_0026685
552 Ga0501034_0003231
553 Ga0501036_0015009
554 Ga0501037_0000280
555 Ga0501037_0138423
556 Ga0501037_0463918
557 Ga0501038_0000883
558 Ga0501039_0000382
559 Ga0501039_0448153
560 Ga0501040_0154831
561 Ga0501041_0114584
562 Ga0501042_0246100
563 Ga0501043_0001643
564 Ga0501043_0491198
565 Ga0501046_0000442
566 Ga0501047_0014474
567 Ga0501048_0000716
568 Ga0501067_0000956
569 Ga0501067_0015813
570 Ga0501068_0008820
571 Ga0501068_0009207
572 Ga0501068_0171936
573 Ga0501068_0590211
574 Ga0501069_0007077
575 Ga0501069_0059038
576 Ga0501069_0078052
577 Ga0501069_0283842
578 Ga0501070_0004564
579 Ga0501070_0052290
580 Ga0501071_0089826
581 Ga0501071_0152802
582 Ga0501071_0303537
583 Ga0501072_0004451
584 Ga0501072_0159275
585 Ga0501072_0267924
586 Ga0501072_0403132
587 Ga0501073_0001462
588 Ga0501073_0039309
589 Ga0501074_0003804
590 Ga0501074_0003950
591 Ga0501074_0465752
592 Ga0501076_0088096
593 Ga0501076_0189143
594 Ga0501076_1047870
595 Ga0501077_0047234
596 Ga0501079_0088950
597 Ga0501080_0001004
598 Ga0501080_0007872
599 Ga0501081_0213765
600 Ga0501083_0001725
601 Ga0501035_0025105
602 Ga0501044_0002104
603 Ga0501045_0099853
604 nmdc:mga03n38_174204_c1
605 nmdc:mga00v17_21379_c1
606 nmdc:mga00v17_292932_c1
607 nmdc:mga0yw44_158377_c1
608 nmdc:mga0yw44_69625_c1
609 nmdc:mga06z11_271686_c1
610 nmdc:mga05p37_11247_c1
611 nmdc:mga05p37_1188049_c1
612 nmdc:mga05p37_11911_c1
613 nmdc:mga09592_141024_c1
614 nmdc:mga09592_7996_c1
615 nmdc:mga0qj67_24_c1
616 nmdc:mga0qj67_52978_c1
617 nmdc:mga06r32_226_c2
618 nmdc:mga06r32_6901_c1
619 Ga0495655_0115965
620 Ga0495619_0067677
621 Ga0500643_000216
622 Ga0500641_0002497
623 Ga0500641_0322567
624 Ga0500652_025956
625 Ga0500568_0006602
626 Ga0500604_0039396
627 Ga0500616_0000470
628 Ga0500616_0008666
629 Ga0500633_0226375
630 Ga0501084_0005680
631 Ga0501084_0299254
632 Ga0501082_0055615
633 Ga0501082_0192278
634 Ga0466962_0047278
635 Ga0466962_0267451
636 2501944836
637 2515854521
638 2623585735
639 2644323929
640 2644429750
641 2731909204
642 2772642861
643 2811848823
644 2827628867
645 2856859621
646 2858904938
647 2862707863
648 2867478482
649 2880494502
650 2929226375
651 2929233076
652 2935392551
653 2990046957
654 2997455914
655 3006493483
656 649816329
657 8003836033
658 8003873036
659 8008485573
660 8025481077
661 8054709611
662 8054729602
663 8056447611
664 8057570968

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00994

MoCF_biosynth

Probable molybdopterin binding domain

21

163

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oi9-assembly1.cif.gz_A crystal structure of molybdenum cofactor synthesis domain from mycobacterium avium 0.9633 10 154
2g4r-assembly1.cif.gz_B anomalous substructure of moga 0.9616 10 152
3pzy-assembly1.cif.gz_A crystal structure of molybdopterin biosynthesis mog protein from mycobacterium paratuberculosis 0.9411 8 154
4twg-assembly1.cif.gz_A the structure of the molybdopterin biosynthesis mog protein from mycobacterium ulcerans 0.9392 8 152
3tcr-assembly1.cif.gz_A crystal structure of a molybdopterin biosynthesis protein from mycobacterium abscessus 0.9388 10 152
ID Description Score Start End Superfamily
af_O53897_20_180_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9341 10 152 3.40.980.10
2g4rC00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9125 10 152 3.40.980.10
1o8nC00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9064 9 154 3.40.980.10
af_Q8BUV3_1_191_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9041 1 153 3.40.980.10
af_P39205_1_179_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.903 8 153 3.40.980.10
ID Description Score Start End GO Terms
AF-A0A7I7ZA68-F1-model_v4 deleted 0.9788 46 158
AF-A0A562WPG1-F1-model_v4 Molybdenum cofactor synthesis domain-containing protein 0.9782 8 157 GO:0006777
AF-A0A1C6TBG2-F1-model_v4 Molybdenum cofactor synthesis domain-containing protein 0.9765 8 157 GO:0006777
AF-A0A0N0AMC6-F1-model_v4 deleted 0.9756 33 157
AF-C7Q0J0-F1-model_v4 Molybdenum cofactor synthesis domain protein 0.9737 8 157 GO:0006777

Map