F410956

General Info

Members Datasets Scaffolds Average Seq Length
332 253 664 148

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10786419|Ga0213876_107864191
Length 149
Sequence MSSEHVLPFETTLKVRDACLCLHLQRAARKAARRFDEALRPLGLTSGQFSLLMSLNRPPPAATIGSVASLLAMDRTTLTANLKPLARRGLVTVAVDPYDRRSRRLTLTASGHRLLLAAAPVWRREHAAIEDLLDGSDPERLRADLRALS

Samples

Sample ID Description Type Environment
1 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
70 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
71 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
72 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
73 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
74 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
75 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
76 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
111 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
113 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
116 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
117 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
118 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
124 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
125 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
126 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
127 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
128 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
129 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
130 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
131 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
132 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
133 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
134 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
135 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
136 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
137 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
138 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
139 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
140 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
141 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
142 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
143 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
155 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
156 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
157 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
158 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
159 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
160 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
163 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
164 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
165 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
166 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
167 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
168 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
169 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
170 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
171 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
172 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
175 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
176 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
177 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
178 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
179 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
180 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
184 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
185 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
186 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
187 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
188 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
189 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
215 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
218 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
219 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
220 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
221 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
225 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
226 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
234 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
235 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
236 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
237 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
238 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
239 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
240 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
241 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
242 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
244 2508501050 Microvirga lupini Lut6 Isolate Nodule
245 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
246 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
247 2643221607 Rhizobium sp. Root73 Isolate Unclassified
248 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
249 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
250 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
251 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
252 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
253 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.99
Metatranscriptomes 0
Isolates 3.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.12
Nodule 3.92
Rhizoplane 8.13
Rhizosphere 78.61
Stem 0
Stem Tuber 0
Unclassified 1.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213876_10786419 3300021384 Bacteria 507
2 Ga0070683_102139168 3300005329 Bacteria 537
3 Ga0070670_100032682 3300005331 Bacteria 4482
4 Ga0070666_10142943 3300005335 Bacteria 1667
5 Ga0070666_10582980 3300005335 Bacteria 815
6 Ga0070660_100129338 3300005339 Bacteria 2020
7 Ga0070689_101069617 3300005340 Bacteria 720
8 Ga0070691_10006566 3300005341 Bacteria 5321
9 Ga0070661_100907673 3300005344 Bacteria 727
10 Ga0070668_100877808 3300005347 Bacteria 801
11 Ga0070669_100983350 3300005353 Bacteria 723
12 Ga0070675_100857724 3300005354 Unclassified 831
13 Ga0070675_100940763 3300005354 Bacteria 793
14 Ga0070671_101802291 3300005355 Bacteria 544
15 Ga0070659_100234658 3300005366 Bacteria 1516
16 Ga0070667_100180584 3300005367 Bacteria 1866
17 Ga0070713_100019394 3300005436 Bacteria 5191
18 Ga0070713_100059130 3300005436 Bacteria 3200
19 Ga0070713_100144823 3300005436 Bacteria 2108
20 Ga0070711_100393899 3300005439 Bacteria 1123
21 Ga0070711_100489256 3300005439 Bacteria 1013
22 Ga0070700_100310669 3300005441 Bacteria 1154
23 Ga0070708_100356900 3300005445 Bacteria 1378
24 Ga0070678_100227495 3300005456 Bacteria 1553
25 Ga0070662_100246456 3300005457 Bacteria 1435
26 Ga0070662_100373938 3300005457 Bacteria 1172
27 Ga0070681_10020105 3300005458 Bacteria 6691
28 Ga0070681_10178432 3300005458 Bacteria 2046
29 Ga0070681_10207435 3300005458 Bacteria 1876
30 Ga0070681_10751100 3300005458 Bacteria 892
31 Ga0070685_11126930 3300005466 Bacteria 594
32 Ga0070707_100113039 3300005468 Bacteria 2635
33 Ga0070707_100680859 3300005468 Bacteria 991
34 Ga0070698_101646855 3300005471 Bacteria 594
35 Ga0070699_100402433 3300005518 Bacteria 1238
36 Ga0070679_100280789 3300005530 Bacteria 1618
37 Ga0070679_101478553 3300005530 Bacteria 626
38 Ga0070697_100065755 3300005536 Bacteria 2963
39 Ga0070665_100854374 3300005548 Bacteria 923
40 Ga0068856_100005744 3300005614 Bacteria 12226
41 Ga0068859_101166032 3300005617 Bacteria 848
42 Ga0068864_100269525 3300005618 Bacteria 1586
43 Ga0068866_10487047 3300005718 Bacteria 813
44 Ga0081455_10003119 3300005937 Bacteria 19301
45 Ga0081455_10643962 3300005937 Bacteria 684
46 Ga0081540_1006066 3300005983 Bacteria 8886
47 Ga0070717_10017174 3300006028 Bacteria 5624
48 Ga0070717_10108994 3300006028 Bacteria 2360
49 Ga0075365_10071938 3300006038 Bacteria 2329
50 Ga0075365_10173448 3300006038 Bacteria 1506
51 Ga0075368_10161010 3300006042 Bacteria 940
52 Ga0075363_100103538 3300006048 Bacteria 1577
53 Ga0075363_100680496 3300006048 Bacteria 620
54 Ga0070715_10600398 3300006163 Bacteria 645
55 Ga0075367_10221857 3300006178 Unclassified 1183
56 Ga0075428_100069473 3300006844 Bacteria 3851
57 Ga0075428_100188614 3300006844 Bacteria 2230
58 Ga0075430_100041620 3300006846 Bacteria 3886
59 Ga0075431_100004796 3300006847 Bacteria 13306
60 Ga0075431_100128953 3300006847 Bacteria 2610
61 Ga0075431_100142585 3300006847 Bacteria 2470
62 Ga0075434_100176750 3300006871 Bacteria 2155
63 Ga0075429_100022249 3300006880 Bacteria 5499
64 Ga0075436_100253282 3300006914 Bacteria 1254
65 Ga0097620_101165941 3300006931 Bacteria 848
66 Ga0099795_10003297 3300007788 Bacteria 3974
67 Ga0099795_10206164 3300007788 Bacteria 831
68 Ga0105240_10485184 3300009093 Bacteria 1377
69 Ga0105240_11266095 3300009093 Bacteria 779
70 Ga0105240_11560909 3300009093 Bacteria 691
71 Ga0111539_11628648 3300009094 Bacteria 749
72 Ga0105245_13086552 3300009098 Bacteria 516
73 Ga0114129_10028347 3300009147 Bacteria 7934
74 Ga0114129_10262116 3300009147 Bacteria 2316
75 Ga0114129_10433420 3300009147 Bacteria 1727
76 Ga0114129_10515326 3300009147 Bacteria 1560
77 Ga0105241_11997032 3300009174 Bacteria 571
78 Ga0105249_10196465 3300009553 Bacteria 1972
79 Ga0099796_10016956 3300010159 Bacteria 2161
80 Ga0099796_10216704 3300010159 Bacteria 783
81 Ga0105239_10309378 3300010375 Bacteria 1780
82 Ga0105246_10110831 3300011119 Bacteria 2016
83 Ga0157373_10162561 3300013100 Bacteria 1571
84 Ga0157371_10100890 3300013102 Bacteria 2047
85 Ga0157369_10022708 3300013105 Bacteria 6997
86 Ga0157374_10044974 3300013296 Bacteria 4084
87 Ga0157374_10197535 3300013296 Bacteria 1969
88 Ga0163162_10305493 3300013306 Bacteria 1723
89 Ga0157372_10012206 3300013307 Bacteria 9151
90 Ga0163163_10168330 3300014325 Bacteria 2238
91 Ga0163163_10346756 3300014325 Bacteria 1540
92 Ga0182008_10129399 3300014497 Bacteria 1258
93 Ga0157377_10112927 3300014745 Bacteria 1635
94 Ga0157379_10414163 3300014968 Bacteria 1240
95 Ga0157376_10482806 3300014969 Bacteria 1215
96 Ga0183362_10374 3300015683 Bacteria 900
97 Ga0214542_1000095 3300021321 Bacteria 116012
98 Ga0214543_1000026 3300021327 Bacteria 220652
99 Ga0213874_10323204 3300021377 Bacteria 585
100 Ga0213875_10098497 3300021388 Bacteria 1364
101 Ga0228711_1000003 3300022739 Bacteria 258118
102 Ga0228710_1000003 3300022740 Bacteria 262981
103 Ga0209564_1068739 3300025295 Bacteria 748
104 Ga0209256_1000321 3300025299 Bacteria 82735
105 Ga0207688_10050772 3300025901 Bacteria 2323
106 Ga0207699_10188349 3300025906 Bacteria 1391
107 Ga0207645_10336238 3300025907 Bacteria 1009
108 Ga0207705_10187454 3300025909 Bacteria 1563
109 Ga0207684_11354555 3300025910 Bacteria 584
110 Ga0207707_10242842 3300025912 Bacteria 1565
111 Ga0207707_10351818 3300025912 Bacteria 1269
112 Ga0207707_10372917 3300025912 Bacteria 1228
113 Ga0207707_10387560 3300025912 Bacteria 1201
114 Ga0207695_11481759 3300025913 Bacteria 559
115 Ga0207693_10328712 3300025915 Bacteria 1197
116 Ga0207657_10206029 3300025919 Bacteria 1580
117 Ga0207649_10497790 3300025920 Bacteria 926
118 Ga0207649_11023977 3300025920 Bacteria 650
119 Ga0207652_10095875 3300025921 Bacteria 2613
120 Ga0207652_10175530 3300025921 Bacteria 1924
121 Ga0207652_10636392 3300025921 Bacteria 954
122 Ga0207646_10118566 3300025922 Bacteria 2377
123 Ga0207646_11652216 3300025922 Bacteria 551
124 Ga0207650_10003762 3300025925 Bacteria 10377
125 Ga0207659_10848264 3300025926 Bacteria 785
126 Ga0207659_10953575 3300025926 Unclassified 738
127 Ga0207687_10345332 3300025927 Bacteria 1211
128 Ga0207687_10626514 3300025927 Bacteria 908
129 Ga0207700_10042861 3300025928 Bacteria 3321
130 Ga0207700_10068759 3300025928 Bacteria 2716
131 Ga0207700_10143977 3300025928 Bacteria 1962
132 Ga0207664_10587603 3300025929 Bacteria 1000
133 Ga0207664_11137884 3300025929 Bacteria 697
134 Ga0207644_10668193 3300025931 Bacteria 865
135 Ga0207706_10101776 3300025933 Bacteria 2528
136 Ga0207706_10193658 3300025933 Bacteria 1784
137 Ga0207670_10041670 3300025936 Bacteria 3021
138 Ga0207665_10096651 3300025939 Bacteria 2055
139 Ga0207691_10291529 3300025940 Bacteria 1403
140 Ga0207711_10331312 3300025941 Bacteria 1408
141 Ga0207712_10409754 3300025961 Bacteria 1141
142 Ga0207668_10481793 3300025972 Bacteria 1064
143 Ga0207658_10096041 3300025986 Bacteria 2311
144 Ga0207677_10510112 3300026023 Bacteria 1041
145 Ga0207678_10846185 3300026067 Bacteria 808
146 Ga0207708_10441280 3300026075 Bacteria 1082
147 Ga0207702_10006715 3300026078 Bacteria 9888
148 Ga0207676_10179962 3300026095 Bacteria 1850
149 Ga0207683_10156674 3300026121 Bacteria 2057
150 Ga0209281_1000081 3300027111 Bacteria 258084
151 Ga0209179_1059877 3300027512 Bacteria 826
152 Ga0209179_1100153 3300027512 Bacteria 645
153 Ga0209282_1000036 3300027666 Bacteria 130242
154 Ga0209813_10473539 3300027866 Bacteria 516
155 Ga0268266_10698049 3300028379 Bacteria 978
156 Ga0268266_11541647 3300028379 Bacteria 640
157 Ga0268266_12174405 3300028379 Bacteria 527
158 Ga0265325_10009971 3300031241 Bacteria 5523
159 Ga0265325_10122125 3300031241 Bacteria 1254
160 Ga0265313_10032108 3300031595 Bacteria 2685
161 Ga0316579_10009311 3300031691 Bacteria 4126
162 Ga0316578_10323270 3300031728 Unclassified 921
163 Ga0307412_10966095 3300031911 Bacteria 751
164 Ga0315914_1000002 3300031967 Bacteria 365357
165 Ga0307409_100419366 3300031995 Bacteria 1284
166 Ga0307416_100190647 3300032002 Bacteria 1933
167 Ga0307411_10214653 3300032005 Bacteria 1488
168 Ga0316583_10001179 3300032133 Bacteria 8565
169 Ga0315913_1000009 3300033430 Bacteria 149770
170 Ga0315915_1000005 3300033464 Bacteria 397591
171 Ga0373948_0020896 3300034817 Bacteria 1250
172 Ga0373926_0013297 3300035083 Bacteria 2790
173 Ga0373940_0035482 3300035088 Bacteria 1350
174 Ga0373944_0060456 3300035089 Bacteria 1214
175 Ga0373951_0147597 3300035091 Bacteria 657
176 Ga0373952_0159608 3300035092 Bacteria 638
177 Ga0373932_0029272 3300035112 Bacteria 1519
178 Ga0373954_0016173 3300035118 Bacteria 3338
179 Ga0373957_0059126 3300035120 Bacteria 1482
180 Ga0373960_0013316 3300035121 Bacteria 2062
181 Ga0373943_0044393 3300035170 Bacteria 2163
182 Ga0373946_0104231 3300035171 Bacteria 1275
183 Ga0373942_0133602 3300035207 Bacteria 785
184 Ga0373961_0008844 3300035241 Bacteria 2455
185 Ga0373962_0184118 3300035242 Bacteria 700
186 Ga0316574_0050535 3300035398 Bacteria 2588
187 Ga0373924_0350756 3300035410 Bacteria 658
188 Ga0373931_0231722 3300035691 Bacteria 1116
189 Ga0373935_0221477 3300035692 Bacteria 1314
190 Ga0373927_0026298 3300035695 Bacteria 3802
191 Ga0373947_0217715 3300035725 Bacteria 1254
192 Ga0373925_0020309 3300037068 Bacteria 4834
193 Ga0373925_0538955 3300037068 Bacteria 959
194 Ga0395900_0150832 3300037418 Bacteria 2375
195 Ga0395905_1850016 3300037471 Bacteria 510
196 Ga0436364_0192486 3300037853 Bacteria 1832
197 Ga0436364_0991921 3300037853 Bacteria 1322
198 Ga0395901_0064155 3300038443 Bacteria 3823
199 Ga0436365_0213964 3300039437 Bacteria 552
200 Ga0436365_0478620 3300039437 Bacteria 3658
201 Ga0436365_0553804 3300039437 Bacteria 1922
202 Ga0436365_1813393 3300039437 Bacteria 1573
203 Ga0436363_1530080 3300039450 Bacteria 1012
204 Ga0436362_1300803 3300039453 Bacteria 534
205 Ga0450906_020445 3300042145 Bacteria 1184
206 Ga0439434_0021882 3300042435 Bacteria 1921
207 Ga0450918_007573 3300042531 Bacteria 1919
208 Ga0466970_0516609 3300044765 Bacteria 689
209 Ga0466958_0486207 3300045836 Bacteria 801
210 Ga0466967_1554797 3300045976 Bacteria 659
211 Ga0495592_0278988 3300046454 Bacteria 1093
212 Ga0495592_0654209 3300046454 Bacteria 636
213 Ga0495603_0069959 3300046455 Bacteria 2063
214 Ga0495641_0078129 3300046461 Bacteria 1483
215 Ga0495651_0219602 3300046462 Bacteria 1316
216 Ga0495653_0019940 3300046463 Bacteria 5435
217 Ga0495580_1108212 3300046472 Bacteria 500
218 Ga0495582_0014731 3300046473 Bacteria 4298
219 Ga0495582_0073278 3300046473 Bacteria 1896
220 Ga0495639_0028029 3300046475 Bacteria 2495
221 Ga0495639_0287604 3300046475 Bacteria 818
222 Ga0495594_0144796 3300046499 Bacteria 1348
223 Ga0495628_0048297 3300046516 Bacteria 3374
224 Ga0495666_0159653 3300046526 Bacteria 1046
225 Ga0495652_0343993 3300046529 Bacteria 1070
226 Ga0495645_0085551 3300046543 Bacteria 2257
227 Ga0495645_0194667 3300046543 Bacteria 1379
228 Ga0495667_0080926 3300046559 Bacteria 2111
229 Ga0495656_0067279 3300046615 Bacteria 1581
230 Ga0495635_0101405 3300046663 Bacteria 1967
231 Ga0495588_0184842 3300046674 Bacteria 1101
232 Ga0495623_0051048 3300046679 Bacteria 2618
233 Ga0495647_0075614 3300046681 Bacteria 1356
234 Ga0495658_0020809 3300046683 Bacteria 3450
235 Ga0495658_0199762 3300046683 Bacteria 1246
236 Ga0495613_0103741 3300046689 Bacteria 2053
237 Ga0495613_0147166 3300046689 Bacteria 1681
238 Ga0495624_0130110 3300046690 Bacteria 1543
239 Ga0495581_0083287 3300047315 Bacteria 1853
240 Ga0495676_0109277 3300047321 Bacteria 2032
241 Ga0495680_0162901 3300047322 Bacteria 1618
242 Ga0495679_041689 3300047446 Bacteria 1420
243 Ga0495593_0072433 3300047673 Bacteria 1789
244 Ga0495602_0042308 3300048088 Bacteria 4152
245 Ga0496100_0056867 3300048903 Bacteria 2560
246 Ga0496100_1351488 3300048903 Bacteria 562
247 Ga0496101_0050601 3300048904 Bacteria 2992
248 Ga0496101_0219442 3300048904 Bacteria 1475
249 Ga0496102_0007259 3300048905 Bacteria 9459
250 Ga0496103_0006622 3300048906 Bacteria 6910
251 Ga0496104_0008242 3300048907 Bacteria 9255
252 Ga0496105_0004906 3300048908 Bacteria 10114
253 Ga0496105_0463123 3300048908 Bacteria 999
254 Ga0496106_1131679 3300048909 Bacteria 612
255 Ga0496107_0033773 3300048910 Bacteria 3661
256 Ga0496108_0177209 3300048911 Bacteria 1846
257 Ga0496108_0534322 3300048911 Bacteria 1023
258 Ga0496109_0004895 3300048912 Bacteria 11183
259 Ga0496109_0077576 3300048912 Bacteria 3058
260 Ga0496110_0011909 3300048913 Bacteria 7145
261 Ga0496110_0464012 3300048913 Bacteria 1154
262 Ga0496111_0010319 3300048914 Bacteria 6262
263 Ga0496111_0325076 3300048914 Bacteria 1139
264 Ga0496111_1087267 3300048914 Bacteria 570
265 Ga0496112_0000931 3300048915 Bacteria 21177
266 Ga0496112_0018908 3300048915 Bacteria 6492
267 Ga0496112_1108642 3300048915 Bacteria 709
268 Ga0496113_0000165 3300048916 Bacteria 29345
269 Ga0496113_0294289 3300048916 Bacteria 1299
270 Ga0496114_0223889 3300048917 Bacteria 1652
271 Ga0496115_0268792 3300048918 Bacteria 1401
272 Ga0501033_0141925 3300049570 Bacteria 1736
273 Ga0501034_0206205 3300049571 Bacteria 1922
274 Ga0501036_0457158 3300049572 Bacteria 1063
275 Ga0501037_0216711 3300049573 Bacteria 1348
276 Ga0501038_0187805 3300049574 Bacteria 1664
277 Ga0501039_0258662 3300049575 Bacteria 1368
278 Ga0501043_0029578 3300049579 Bacteria 4305
279 Ga0501043_1221107 3300049579 Bacteria 527
280 Ga0501046_0000010 3300049580 Bacteria 331082
281 Ga0501068_0344039 3300049584 Bacteria 958
282 Ga0501069_0621442 3300049585 Bacteria 649
283 Ga0501070_0097037 3300049586 Bacteria 2438
284 Ga0501070_0335920 3300049586 Bacteria 1228
285 Ga0501070_0789727 3300049586 Bacteria 746
286 Ga0501072_1082763 3300049588 Bacteria 624
287 Ga0501073_0010536 3300049589 Bacteria 6770
288 Ga0501074_0107262 3300049590 Bacteria 2000
289 Ga0501080_0337669 3300049742 Bacteria 1362
290 Ga0501080_0395776 3300049742 Bacteria 1243
291 Ga0501080_0668524 3300049742 Bacteria 918
292 Ga0501083_0092118 3300049744 Bacteria 2001
293 Ga0501035_0683859 3300049822 Bacteria 829
294 Ga0501044_0118430 3300049823 Bacteria 2651
295 nmdc:mga03n38_724676_c1 3300050490 Bacteria 574
296 nmdc:mga0yw44_122181_c1 3300050492 Bacteria 1678
297 nmdc:mga0yw44_743995_c1 3300050492 Bacteria 666
298 nmdc:mga06z11_153670_c1 3300050494 Bacteria 1310
299 nmdc:mga05p37_1528_c1 3300050507 Bacteria 7154
300 nmdc:mga05p37_54023_c1 3300050507 Bacteria 4942
301 nmdc:mga09592_569944_c1 3300050508 Bacteria 972
302 nmdc:mga0qj67_344777_c1 3300050509 Bacteria 1205
303 nmdc:mga06r32_12273_c1 3300050510 Bacteria 7726
304 nmdc:mga06r32_191423_c1 3300050510 Bacteria 2033
305 nmdc:mga06r32_77839_c1 3300050510 Bacteria 3222
306 nmdc:mga08y16_1098929_c1 3300050511 Bacteria 770
307 nmdc:mga0n895_2066787_c1 3300050512 Bacteria 527
308 nmdc:mga0n895_245546_c1 3300050512 Bacteria 1817
309 nmdc:mga0n895_730367_c1 3300050512 Bacteria 984
310 nmdc:mga0rr50_57154_c1 3300050513 Bacteria 2917
311 nmdc:mga0rr50_724308_c1 3300050513 Bacteria 849
312 nmdc:mga08x19_221028_c1 3300050514 Bacteria 1301
313 Ga0495601_0051437 3300053077 Unclassified 2600
314 Ga0495595_0062137 3300053084 Bacteria 1750
315 Ga0500643_013245 3300053087 Bacteria 2919
316 Ga0500566_0136633 3300053094 Bacteria 1305
317 Ga0500595_000001 3300053119 Bacteria 1088438
318 Ga0500609_012796 3300053731 Bacteria 1135
319 Ga0501084_0453138 3300054114 Bacteria 1085
320 Ga0590071_083001 3300059421 Bacteria 798
321 Ga0501082_0165929 3300060353 Bacteria 1919
322 Ga0501082_0236759 3300060353 Bacteria 1589
323 2508731241 2508501050 Bacteria 9633614
324 2513998081 2513237159 Bacteria 6810126
325 2585388566 2582581865 Bacteria 6644329
326 2644051109 2643221607 Bacteria 6314006
327 2644484013 2643221686 Bacteria 6310811
328 2842523186 2842521101 Bacteria 6569494
329 2882461828 2882456835 Bacteria 6863978
330 2883293310 2883291878 Bacteria 5894118
331 2896386436 2896384573 Bacteria 7700774
332 2924218600 2924214083 Bacteria 7080103
333 Ga0213876_10786419
334 Ga0070683_102139168
335 Ga0070670_100032682
336 Ga0070666_10142943
337 Ga0070666_10582980
338 Ga0070660_100129338
339 Ga0070689_101069617
340 Ga0070691_10006566
341 Ga0070661_100907673
342 Ga0070668_100877808
343 Ga0070669_100983350
344 Ga0070675_100857724
345 Ga0070675_100940763
346 Ga0070671_101802291
347 Ga0070659_100234658
348 Ga0070667_100180584
349 Ga0070713_100019394
350 Ga0070713_100059130
351 Ga0070713_100144823
352 Ga0070711_100393899
353 Ga0070711_100489256
354 Ga0070700_100310669
355 Ga0070708_100356900
356 Ga0070678_100227495
357 Ga0070662_100246456
358 Ga0070662_100373938
359 Ga0070681_10020105
360 Ga0070681_10178432
361 Ga0070681_10207435
362 Ga0070681_10751100
363 Ga0070685_11126930
364 Ga0070707_100113039
365 Ga0070707_100680859
366 Ga0070698_101646855
367 Ga0070699_100402433
368 Ga0070679_100280789
369 Ga0070679_101478553
370 Ga0070697_100065755
371 Ga0070665_100854374
372 Ga0068856_100005744
373 Ga0068859_101166032
374 Ga0068864_100269525
375 Ga0068866_10487047
376 Ga0081455_10003119
377 Ga0081455_10643962
378 Ga0081540_1006066
379 Ga0070717_10017174
380 Ga0070717_10108994
381 Ga0075365_10071938
382 Ga0075365_10173448
383 Ga0075368_10161010
384 Ga0075363_100103538
385 Ga0075363_100680496
386 Ga0070715_10600398
387 Ga0075367_10221857
388 Ga0075428_100069473
389 Ga0075428_100188614
390 Ga0075430_100041620
391 Ga0075431_100004796
392 Ga0075431_100128953
393 Ga0075431_100142585
394 Ga0075434_100176750
395 Ga0075429_100022249
396 Ga0075436_100253282
397 Ga0097620_101165941
398 Ga0099795_10003297
399 Ga0099795_10206164
400 Ga0105240_10485184
401 Ga0105240_11266095
402 Ga0105240_11560909
403 Ga0111539_11628648
404 Ga0105245_13086552
405 Ga0114129_10028347
406 Ga0114129_10262116
407 Ga0114129_10433420
408 Ga0114129_10515326
409 Ga0105241_11997032
410 Ga0105249_10196465
411 Ga0099796_10016956
412 Ga0099796_10216704
413 Ga0105239_10309378
414 Ga0105246_10110831
415 Ga0157373_10162561
416 Ga0157371_10100890
417 Ga0157369_10022708
418 Ga0157374_10044974
419 Ga0157374_10197535
420 Ga0163162_10305493
421 Ga0157372_10012206
422 Ga0163163_10168330
423 Ga0163163_10346756
424 Ga0182008_10129399
425 Ga0157377_10112927
426 Ga0157379_10414163
427 Ga0157376_10482806
428 Ga0183362_10374
429 Ga0214542_1000095
430 Ga0214543_1000026
431 Ga0213874_10323204
432 Ga0213875_10098497
433 Ga0228711_1000003
434 Ga0228710_1000003
435 Ga0209564_1068739
436 Ga0209256_1000321
437 Ga0207688_10050772
438 Ga0207699_10188349
439 Ga0207645_10336238
440 Ga0207705_10187454
441 Ga0207684_11354555
442 Ga0207707_10242842
443 Ga0207707_10351818
444 Ga0207707_10372917
445 Ga0207707_10387560
446 Ga0207695_11481759
447 Ga0207693_10328712
448 Ga0207657_10206029
449 Ga0207649_10497790
450 Ga0207649_11023977
451 Ga0207652_10095875
452 Ga0207652_10175530
453 Ga0207652_10636392
454 Ga0207646_10118566
455 Ga0207646_11652216
456 Ga0207650_10003762
457 Ga0207659_10848264
458 Ga0207659_10953575
459 Ga0207687_10345332
460 Ga0207687_10626514
461 Ga0207700_10042861
462 Ga0207700_10068759
463 Ga0207700_10143977
464 Ga0207664_10587603
465 Ga0207664_11137884
466 Ga0207644_10668193
467 Ga0207706_10101776
468 Ga0207706_10193658
469 Ga0207670_10041670
470 Ga0207665_10096651
471 Ga0207691_10291529
472 Ga0207711_10331312
473 Ga0207712_10409754
474 Ga0207668_10481793
475 Ga0207658_10096041
476 Ga0207677_10510112
477 Ga0207678_10846185
478 Ga0207708_10441280
479 Ga0207702_10006715
480 Ga0207676_10179962
481 Ga0207683_10156674
482 Ga0209281_1000081
483 Ga0209179_1059877
484 Ga0209179_1100153
485 Ga0209282_1000036
486 Ga0209813_10473539
487 Ga0268266_10698049
488 Ga0268266_11541647
489 Ga0268266_12174405
490 Ga0265325_10009971
491 Ga0265325_10122125
492 Ga0265313_10032108
493 Ga0316579_10009311
494 Ga0316578_10323270
495 Ga0307412_10966095
496 Ga0315914_1000002
497 Ga0307409_100419366
498 Ga0307416_100190647
499 Ga0307411_10214653
500 Ga0316583_10001179
501 Ga0315913_1000009
502 Ga0315915_1000005
503 Ga0373948_0020896
504 Ga0373926_0013297
505 Ga0373940_0035482
506 Ga0373944_0060456
507 Ga0373951_0147597
508 Ga0373952_0159608
509 Ga0373932_0029272
510 Ga0373954_0016173
511 Ga0373957_0059126
512 Ga0373960_0013316
513 Ga0373943_0044393
514 Ga0373946_0104231
515 Ga0373942_0133602
516 Ga0373961_0008844
517 Ga0373962_0184118
518 Ga0316574_0050535
519 Ga0373924_0350756
520 Ga0373931_0231722
521 Ga0373935_0221477
522 Ga0373927_0026298
523 Ga0373947_0217715
524 Ga0373925_0020309
525 Ga0373925_0538955
526 Ga0395900_0150832
527 Ga0395905_1850016
528 Ga0436364_0192486
529 Ga0436364_0991921
530 Ga0395901_0064155
531 Ga0436365_0213964
532 Ga0436365_0478620
533 Ga0436365_0553804
534 Ga0436365_1813393
535 Ga0436363_1530080
536 Ga0436362_1300803
537 Ga0450906_020445
538 Ga0439434_0021882
539 Ga0450918_007573
540 Ga0466970_0516609
541 Ga0466958_0486207
542 Ga0466967_1554797
543 Ga0495592_0278988
544 Ga0495592_0654209
545 Ga0495603_0069959
546 Ga0495641_0078129
547 Ga0495651_0219602
548 Ga0495653_0019940
549 Ga0495580_1108212
550 Ga0495582_0014731
551 Ga0495582_0073278
552 Ga0495639_0028029
553 Ga0495639_0287604
554 Ga0495594_0144796
555 Ga0495628_0048297
556 Ga0495666_0159653
557 Ga0495652_0343993
558 Ga0495645_0085551
559 Ga0495645_0194667
560 Ga0495667_0080926
561 Ga0495656_0067279
562 Ga0495635_0101405
563 Ga0495588_0184842
564 Ga0495623_0051048
565 Ga0495647_0075614
566 Ga0495658_0020809
567 Ga0495658_0199762
568 Ga0495613_0103741
569 Ga0495613_0147166
570 Ga0495624_0130110
571 Ga0495581_0083287
572 Ga0495676_0109277
573 Ga0495680_0162901
574 Ga0495679_041689
575 Ga0495593_0072433
576 Ga0495602_0042308
577 Ga0496100_0056867
578 Ga0496100_1351488
579 Ga0496101_0050601
580 Ga0496101_0219442
581 Ga0496102_0007259
582 Ga0496103_0006622
583 Ga0496104_0008242
584 Ga0496105_0004906
585 Ga0496105_0463123
586 Ga0496106_1131679
587 Ga0496107_0033773
588 Ga0496108_0177209
589 Ga0496108_0534322
590 Ga0496109_0004895
591 Ga0496109_0077576
592 Ga0496110_0011909
593 Ga0496110_0464012
594 Ga0496111_0010319
595 Ga0496111_0325076
596 Ga0496111_1087267
597 Ga0496112_0000931
598 Ga0496112_0018908
599 Ga0496112_1108642
600 Ga0496113_0000165
601 Ga0496113_0294289
602 Ga0496114_0223889
603 Ga0496115_0268792
604 Ga0501033_0141925
605 Ga0501034_0206205
606 Ga0501036_0457158
607 Ga0501037_0216711
608 Ga0501038_0187805
609 Ga0501039_0258662
610 Ga0501043_0029578
611 Ga0501043_1221107
612 Ga0501046_0000010
613 Ga0501068_0344039
614 Ga0501069_0621442
615 Ga0501070_0097037
616 Ga0501070_0335920
617 Ga0501070_0789727
618 Ga0501072_1082763
619 Ga0501073_0010536
620 Ga0501074_0107262
621 Ga0501080_0337669
622 Ga0501080_0395776
623 Ga0501080_0668524
624 Ga0501083_0092118
625 Ga0501035_0683859
626 Ga0501044_0118430
627 nmdc:mga03n38_724676_c1
628 nmdc:mga0yw44_122181_c1
629 nmdc:mga0yw44_743995_c1
630 nmdc:mga06z11_153670_c1
631 nmdc:mga05p37_1528_c1
632 nmdc:mga05p37_54023_c1
633 nmdc:mga09592_569944_c1
634 nmdc:mga0qj67_344777_c1
635 nmdc:mga06r32_12273_c1
636 nmdc:mga06r32_191423_c1
637 nmdc:mga06r32_77839_c1
638 nmdc:mga08y16_1098929_c1
639 nmdc:mga0n895_2066787_c1
640 nmdc:mga0n895_245546_c1
641 nmdc:mga0n895_730367_c1
642 nmdc:mga0rr50_57154_c1
643 nmdc:mga0rr50_724308_c1
644 nmdc:mga08x19_221028_c1
645 Ga0495601_0051437
646 Ga0495595_0062137
647 Ga0500643_013245
648 Ga0500566_0136633
649 Ga0500595_000001
650 Ga0500609_012796
651 Ga0501084_0453138
652 Ga0590071_083001
653 Ga0501082_0165929
654 Ga0501082_0236759
655 2508731241
656 2513998081
657 2585388566
658 2644051109
659 2644484013
660 2842523186
661 2882461828
662 2883293310
663 2896386436
664 2924218600

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12802

MarR_2

MarR family

42

102

0.98

PF01047

MarR

MarR family

44

102

0.97

PF13463

HTH_27

Winged helix DNA-binding domain

44

111

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fx4-assembly1.cif.gz_B crystal structure of m. tuberculosis transcriptional regulator mosr (rv1049) in compex with dna 0.952 18 147
3q5f-assembly1.cif.gz_B crystal structure of the salmonella transcriptional regulator slya in complex with dna 0.9136 20 147
1z9c-assembly2.cif.gz_C crystal structure of ohrr bound to the ohra promoter: structure of marr family protein with operator dna 0.9128 20 147
7el3-assembly1.cif.gz_B crystal structure of hpar-dna complex from acinetobacter baumannii 0.9101 20 147
4fx4-assembly1.cif.gz_A crystal structure of m. tuberculosis transcriptional regulator mosr (rv1049) in compex with dna 0.902 18 147
ID Description Score Start End Superfamily
4fx4B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9388 18 147 1.10.10.10
af_Q57693_7_69_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9223 49 115 1.10.10.10
3q5fB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9136 20 147 1.10.10.10
4fx4A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9057 18 147 1.10.10.10
4fx0A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8988 17 147 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A506TWN2-F1-model_v4 MarR family transcriptional regulator 0.9914 12 147 GO:0003700
GO:0006950
AF-H0H649-F1-model_v4 deleted 0.9855 16 148
AF-A0A0T6Z6X3-F1-model_v4 HTH marR-type domain-containing protein 0.9774 16 148 GO:0003700
GO:0006950
AF-A0A1I3KE33-F1-model_v4 DNA-binding transcriptional regulator, MarR family 0.9714 15 147 GO:0003677
GO:0003700
GO:0006950
AF-H0H649-F1-model_v4 deleted 0.971 16 148

Map