F410929

General Info

Members Datasets Scaffolds Average Seq Length
332 224 330 101

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10000164|Ga0105239_1000016435
Length 120
Sequence LNSRRGQGFLAARRHAVETAVTQCQHSALIAPVTPSAKGCEECLETGDWWVHLRLCRICGHVGCCDDSPNRHATAHFHATRHPIIEGYDPPEGWGWCFIDEKEVDLPDQTPQIGPIPRFF

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
3 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
4 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
5 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
12 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
13 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
14 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
18 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
19 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
20 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
21 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
22 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
85 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
92 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
93 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
96 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
97 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
147 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
148 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
149 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
150 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
160 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
169 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
170 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
171 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
172 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
173 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
174 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
175 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
176 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
177 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
178 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
179 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
180 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
181 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
184 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
185 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
186 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
187 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
196 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
197 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
198 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
199 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
200 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
201 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
202 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
203 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
204 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
205 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
206 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
210 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
211 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
212 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
213 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
214 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
215 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
216 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
217 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
218 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
219 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
220 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
221 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
222 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
223 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
224 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0
Isolates 0.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.27
Nodule 0.3
Rhizoplane 2.71
Rhizosphere 68.07
Stem 0
Stem Tuber 0
Unclassified 12.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2445162 2162886007 Bacteria 886
2 JGI24736J21556_1000107 3300001904 Bacteria 13974
3 JGI24741J21665_1005215 3300001915 Bacteria 2756
4 JGI24740J21852_10010030 3300001979 Bacteria 3669
5 JGI24739J22299_10008990 3300001989 Bacteria 3729
6 JGI24737J22298_10017985 3300001990 Bacteria 2272
7 JGI24735J21928_10004162 3300002067 Bacteria 4886
8 JGI24738J21930_10002431 3300002075 Bacteria 4880
9 JGI24749J21850_1047867 3300002076 Bacteria 634
10 JGI25156J39149_1040281 3300002705 Bacteria 648
11 JGI25154J39366_1001942 3300002738 Bacteria 6148
12 JGI25157J39369_1000194 3300002741 Bacteria 51347
13 rootH2_10023162 3300003320 Bacteria 5547
14 rootH1_10005419 3300003323 Bacteria 14086
15 rootH1_10011285 3300003323 Bacteria 2393
16 Ga0055539_1000386 3300003752 Bacteria 17814
17 Ga0055539_1001280 3300003752 Bacteria 4987
18 Ga0055533_1000016 3300003756 Bacteria 396179
19 Ga0055525_1001486 3300003759 Bacteria 4061
20 Ga0055535_1000778 3300003761 Bacteria 23355
21 Ga0055529_1000239 3300003763 Bacteria 68765
22 Ga0055536_1008178 3300003781 Bacteria 4547
23 Ga0055530_10007565 3300003791 Bacteria 4547
24 Ga0055530_10012234 3300003791 Bacteria 3008
25 Ga0055531_10003674 3300003794 Bacteria 9667
26 Ga0065704_10001261 3300005289 Bacteria 13329
27 Ga0065704_10132934 3300005289 Bacteria 1606
28 Ga0070658_10054925 3300005327 Bacteria 3235
29 Ga0070658_10084223 3300005327 Bacteria 2614
30 Ga0070658_10344484 3300005327 Bacteria 1275
31 Ga0070690_100034346 3300005330 Bacteria 3178
32 Ga0068869_101163682 3300005334 Bacteria 677
33 Ga0070660_100870758 3300005339 Bacteria 759
34 Ga0070661_100007621 3300005344 Bacteria 7467
35 Ga0070668_100010030 3300005347 Bacteria 7020
36 Ga0070669_100020510 3300005353 Bacteria 4720
37 Ga0070671_100005770 3300005355 Bacteria 9859
38 Ga0070673_100002821 3300005364 Bacteria 10688
39 Ga0070673_102223882 3300005364 Bacteria 521
40 Ga0070659_100002705 3300005366 Bacteria 12600
41 Ga0070659_100113542 3300005366 Bacteria 2188
42 Ga0070659_100467595 3300005366 Bacteria 1072
43 Ga0070667_100018574 3300005367 Bacteria 5767
44 Ga0070663_100263712 3300005455 Bacteria 1367
45 Ga0070663_100373701 3300005455 Bacteria 1159
46 Ga0070678_100277124 3300005456 Bacteria 1417
47 Ga0070662_100062760 3300005457 Bacteria 2716
48 Ga0068867_100989715 3300005459 Bacteria 762
49 Ga0070679_101043110 3300005530 Bacteria 762
50 Ga0068853_100094035 3300005539 Bacteria 2640
51 Ga0070672_100738802 3300005543 Bacteria 863
52 Ga0070693_101177157 3300005547 Bacteria 588
53 Ga0070665_100000972 3300005548 Bacteria 36392
54 Ga0070665_100081601 3300005548 Bacteria 3239
55 Ga0068855_100119840 3300005563 Bacteria 3012
56 Ga0068855_100209771 3300005563 Bacteria 2189
57 Ga0068855_100274329 3300005563 Bacteria 1874
58 Ga0068855_100453494 3300005563 Bacteria 1399
59 Ga0068855_100641927 3300005563 Bacteria 1141
60 Ga0070664_100101396 3300005564 Bacteria 2503
61 Ga0068857_100001367 3300005577 Bacteria 19219
62 Ga0068857_100097167 3300005577 Bacteria 2640
63 Ga0068857_100356665 3300005577 Bacteria 1355
64 Ga0068857_100830133 3300005577 Bacteria 884
65 Ga0068854_100082517 3300005578 Bacteria 2376
66 Ga0068854_100105089 3300005578 Bacteria 2122
67 Ga0068856_100014166 3300005614 Bacteria 7710
68 Ga0068852_100227257 3300005616 Bacteria 1778
69 Ga0068852_100546229 3300005616 Bacteria 1158
70 Ga0068864_100001223 3300005618 Bacteria 21337
71 Ga0068866_10378349 3300005718 Bacteria 907
72 Ga0068861_100099028 3300005719 Bacteria 2315
73 Ga0068851_10002249 3300005834 Bacteria 8482
74 Ga0068863_100040638 3300005841 Bacteria 4422
75 Ga0068863_100593905 3300005841 Bacteria 1095
76 Ga0068858_100035448 3300005842 Bacteria 4628
77 Ga0068860_100039797 3300005843 Bacteria 4496
78 Ga0068860_100330151 3300005843 Bacteria 1498
79 Ga0068862_100047562 3300005844 Bacteria 3661
80 Ga0068862_100262651 3300005844 Bacteria 1576
81 Ga0075369_10015635 3300006186 Bacteria 3050
82 Ga0075370_10009723 3300006353 Bacteria 5006
83 Ga0075370_10059985 3300006353 Bacteria 2167
84 Ga0075370_10153990 3300006353 Bacteria 1348
85 Ga0068871_101523905 3300006358 Bacteria 632
86 Ga0105251_10011958 3300009011 Bacteria 4930
87 Ga0105250_10277121 3300009092 Bacteria 721
88 Ga0105240_10001507 3300009093 Bacteria 39670
89 Ga0105240_10037625 3300009093 Bacteria 6216
90 Ga0105240_10199446 3300009093 Bacteria 2346
91 Ga0105240_10449249 3300009093 Bacteria 1443
92 Ga0105240_11053106 3300009093 Bacteria 868
93 Ga0105245_10630533 3300009098 Bacteria 1101
94 Ga0105247_10406941 3300009101 Bacteria 971
95 Ga0105242_10091401 3300009176 Bacteria 2562
96 Ga0105248_10054587 3300009177 Bacteria 4481
97 Ga0105248_10411182 3300009177 Bacteria 1523
98 Ga0105248_10587375 3300009177 Bacteria 1257
99 Ga0105248_12626457 3300009177 Bacteria 574
100 Ga0105237_10008251 3300009545 Bacteria 11310
101 Ga0105237_10137569 3300009545 Bacteria 2437
102 Ga0105238_10026097 3300009551 Bacteria 5954
103 Ga0105238_10174203 3300009551 Bacteria 2128
104 Ga0105238_10422390 3300009551 Bacteria 1328
105 Ga0105249_11543338 3300009553 Bacteria 736
106 Ga0105148_110133 3300009978 Bacteria 716
107 Ga0105239_10000164 3300010375 Bacteria 95286
108 Ga0105239_10076671 3300010375 Bacteria 3677
109 Ga0105246_10428193 3300011119 Bacteria 1106
110 Ga0157373_10028358 3300013100 Bacteria 4038
111 Ga0157370_10003887 3300013104 Bacteria 17402
112 Ga0157369_10046646 3300013105 Bacteria 4709
113 Ga0157374_11289169 3300013296 Bacteria 752
114 Ga0157374_11577906 3300013296 Bacteria 680
115 Ga0157378_10271774 3300013297 Bacteria 1630
116 Ga0157372_10000732 3300013307 Bacteria 35785
117 Ga0157379_10304968 3300014968 Bacteria 1452
118 Ga0157379_10806462 3300014968 Bacteria 886
119 Ga0157376_12461953 3300014969 Bacteria 560
120 Ga0157376_12680764 3300014969 Bacteria 538
121 Ga0182006_1137089 3300015261 Bacteria 838
122 Ga0182005_1067550 3300015265 Bacteria 980
123 Ga0163161_10058811 3300017792 Bacteria 2794
124 Ga0209674_100041 3300025226 Bacteria 396231
125 Ga0209563_100043 3300025230 Bacteria 397271
126 Ga0209563_105987 3300025230 Bacteria 2135
127 Ga0207427_100700 3300025231 Bacteria 15771
128 Ga0209258_100074 3300025242 Bacteria 271062
129 Ga0209646_1000069 3300025246 Bacteria 230340
130 Ga0209026_1000006 3300025250 Bacteria 677225
131 Ga0209677_100067 3300025253 Bacteria 146379
132 Ga0209677_100077 3300025253 Bacteria 126245
133 Ga0209148_1009785 3300025254 Bacteria 1848
134 Ga0209759_1000189 3300025256 Bacteria 98732
135 Ga0209759_1000834 3300025256 Bacteria 24274
136 Ga0209759_1001251 3300025256 Bacteria 15402
137 Ga0209759_1017053 3300025256 Bacteria 1804
138 Ga0209233_1085295 3300025261 Bacteria 553
139 Ga0209455_1000066 3300025272 Bacteria 316811
140 Ga0209676_1001119 3300025292 Bacteria 29587
141 Ga0209676_1003405 3300025292 Bacteria 9832
142 Ga0209676_1003451 3300025292 Bacteria 9719
143 Ga0209050_1004256 3300025298 Bacteria 9832
144 Ga0209050_1004321 3300025298 Bacteria 9696
145 Ga0209050_1008531 3300025298 Bacteria 5450
146 Ga0209051_1000877 3300025303 Bacteria 30359
147 Ga0209257_1004543 3300025304 Bacteria 10627
148 Ga0209257_1005303 3300025304 Bacteria 9159
149 Ga0207697_10029728 3300025315 Bacteria 2237
150 Ga0207697_10261680 3300025315 Bacteria 766
151 Ga0207656_10005598 3300025321 Bacteria 4454
152 Ga0207713_1002293 3300025735 Bacteria 14085
153 Ga0207710_10039799 3300025900 Bacteria 2081
154 Ga0207710_10224921 3300025900 Bacteria 933
155 Ga0207680_10732835 3300025903 Bacteria 708
156 Ga0207647_10000657 3300025904 Bacteria 26990
157 Ga0207705_10036998 3300025909 Bacteria 3493
158 Ga0207705_10049053 3300025909 Bacteria 3038
159 Ga0207705_10176217 3300025909 Bacteria 1612
160 Ga0207705_10944399 3300025909 Bacteria 667
161 Ga0207705_11013274 3300025909 Bacteria 641
162 Ga0207654_10029150 3300025911 Bacteria 3017
163 Ga0207695_10010134 3300025913 Bacteria 11566
164 Ga0207695_10167046 3300025913 Bacteria 2128
165 Ga0207695_10173984 3300025913 Bacteria 2076
166 Ga0207695_10945638 3300025913 Bacteria 741
167 Ga0207671_10005728 3300025914 Bacteria 11327
168 Ga0207671_10448306 3300025914 Bacteria 1028
169 Ga0207660_11385956 3300025917 Bacteria 570
170 Ga0207657_10066757 3300025919 Bacteria 3061
171 Ga0207657_10303044 3300025919 Bacteria 1265
172 Ga0207649_10008830 3300025920 Bacteria 5502
173 Ga0207649_11104932 3300025920 Bacteria 625
174 Ga0207681_10002145 3300025923 Bacteria 12590
175 Ga0207681_10414285 3300025923 Bacteria 1090
176 Ga0207694_10127993 3300025924 Bacteria 2033
177 Ga0207694_10314753 3300025924 Bacteria 1291
178 Ga0207687_10323542 3300025927 Bacteria 1249
179 Ga0207644_10002514 3300025931 Bacteria 11798
180 Ga0207644_11255116 3300025931 Bacteria 623
181 Ga0207690_10097848 3300025932 Bacteria 2089
182 Ga0207690_10252979 3300025932 Bacteria 1362
183 Ga0207706_10091491 3300025933 Bacteria 2674
184 Ga0207686_10233605 3300025934 Bacteria 1335
185 Ga0207711_10001926 3300025941 Bacteria 18849
186 Ga0207711_10124139 3300025941 Bacteria 2308
187 Ga0207711_10224649 3300025941 Bacteria 1718
188 Ga0207689_11494347 3300025942 Bacteria 564
189 Ga0207667_10046605 3300025949 Bacteria 4590
190 Ga0207667_10101153 3300025949 Bacteria 2973
191 Ga0207667_10355017 3300025949 Bacteria 1495
192 Ga0207667_10424486 3300025949 Bacteria 1353
193 Ga0207667_10572340 3300025949 Bacteria 1141
194 Ga0207667_11984492 3300025949 Bacteria 542
195 Ga0207651_10009764 3300025960 Bacteria 5277
196 Ga0207651_11915400 3300025960 Bacteria 533
197 Ga0207712_11126517 3300025961 Bacteria 699
198 Ga0207668_10019878 3300025972 Bacteria 4255
199 Ga0207640_10002820 3300025981 Bacteria 9322
200 Ga0207640_10009671 3300025981 Bacteria 5406
201 Ga0207658_10006565 3300025986 Bacteria 7932
202 Ga0207677_10448648 3300026023 Bacteria 1105
203 Ga0207703_10027429 3300026035 Bacteria 4486
204 Ga0207639_10075267 3300026041 Bacteria 2654
205 Ga0207678_10167592 3300026067 Bacteria 1875
206 Ga0207678_10392299 3300026067 Bacteria 1201
207 Ga0207702_10002360 3300026078 Bacteria 18035
208 Ga0207641_10000574 3300026088 Bacteria 40676
209 Ga0207641_10009847 3300026088 Bacteria 7869
210 Ga0207648_10149363 3300026089 Bacteria 2061
211 Ga0207676_10012012 3300026095 Bacteria 6197
212 Ga0207674_10023855 3300026116 Bacteria 6543
213 Ga0207674_10052829 3300026116 Bacteria 4143
214 Ga0207674_10178249 3300026116 Bacteria 2077
215 Ga0207675_100039595 3300026118 Bacteria 4399
216 Ga0207683_10151985 3300026121 Bacteria 2089
217 Ga0207698_10003867 3300026142 Bacteria 9065
218 Ga0207698_11461853 3300026142 Bacteria 699
219 Ga0209281_1000110 3300027111 Bacteria 215631
220 Ga0268266_10000566 3300028379 Bacteria 51401
221 Ga0268266_10001421 3300028379 Bacteria 28599
222 Ga0268266_11028354 3300028379 Bacteria 797
223 Ga0268265_10008004 3300028380 Bacteria 7136
224 Ga0268265_10008020 3300028380 Bacteria 7130
225 Ga0268264_10016140 3300028381 Bacteria 6118
226 Ga0268264_10238546 3300028381 Bacteria 1683
227 Ga0268264_10727654 3300028381 Bacteria 987
228 Ga0265336_10000013 3300028666 Bacteria 252156
229 Ga0265324_10000432 3300029957 Bacteria 29768
230 Ga0265340_10037757 3300031247 Bacteria 2392
231 Ga0307513_10570946 3300031456 Bacteria 842
232 Ga0307509_10787271 3300031507 Bacteria 616
233 Ga0307408_100078026 3300031548 Bacteria 2467
234 Ga0307516_10000559 3300031730 Bacteria 50194
235 Ga0307410_10021606 3300031852 Bacteria 3961
236 Ga0307406_10004017 3300031901 Bacteria 8004
237 Ga0307406_10373918 3300031901 Bacteria 1121
238 Ga0307406_10905892 3300031901 Bacteria 751
239 Ga0307412_10023738 3300031911 Bacteria 3777
240 Ga0307409_101027710 3300031995 Bacteria 843
241 Ga0307409_101255019 3300031995 Bacteria 765
242 Ga0307416_100002244 3300032002 Bacteria 10995
243 Ga0307414_10137457 3300032004 Bacteria 1908
244 Ga0307414_10157864 3300032004 Bacteria 1798
245 Ga0373959_0010921 3300034820 Bacteria 1595
246 Ga0373934_0022645 3300035086 Bacteria 2424
247 Ga0373931_1285647 3300035691 Bacteria 503
248 Ga0373925_0559593 3300037068 Bacteria 941
249 Ga0395899_0236824 3300037312 Bacteria 1258
250 Ga0395900_0888271 3300037418 Bacteria 815
251 Ga0395898_0336637 3300037466 Bacteria 1439
252 Ga0395901_0350989 3300038443 Bacteria 1522
253 Ga0436365_1011890 3300039437 Bacteria 7432
254 Ga0439465_0246683 3300041413 Bacteria 660
255 Ga0451789_0018752 3300041443 Bacteria 640
256 Ga0451800_0862879 3300041459 Bacteria 598
257 Ga0451841_1201973 3300041498 Bacteria 1243
258 Ga0451849_1135337 3300041505 Bacteria 923
259 Ga0451853_0524760 3300041512 Bacteria 772
260 Ga0451853_1393126 3300041512 Bacteria 1256
261 Ga0451853_3904735 3300041512 Bacteria 672
262 Ga0466963_0508377 3300044694 Bacteria 851
263 Ga0495638_0099372 3300046460 Bacteria 1742
264 Ga0495650_0007825 3300046471 Bacteria 6355
265 Ga0495607_0017429 3300046501 Bacteria 4610
266 Ga0495583_0000034 3300046506 Bacteria 246856
267 Ga0495606_0002607 3300046507 Bacteria 20631
268 Ga0495632_0184679 3300046519 Bacteria 954
269 Ga0495654_0000380 3300046530 Bacteria 38222
270 Ga0495668_0054813 3300046616 Bacteria 2202
271 Ga0495625_0000443 3300046660 Bacteria 62139
272 Ga0495625_0128491 3300046660 Bacteria 1718
273 Ga0495669_0017422 3300046684 Bacteria 3084
274 Ga0495649_0000728 3300046694 Bacteria 26762
275 Ga0495589_0126290 3300046794 Bacteria 1230
276 Ga0495686_0001084 3300047472 Bacteria 32345
277 Ga0495686_0163475 3300047472 Bacteria 1299
278 Ga0495686_0240689 3300047472 Bacteria 1020
279 Ga0495686_0318887 3300047472 Bacteria 852
280 Ga0496102_0027391 3300048905 Bacteria 5090
281 Ga0496103_0004087 3300048906 Bacteria 8866
282 Ga0496109_1753205 3300048912 Bacteria 554
283 Ga0496110_0388192 3300048913 Bacteria 1272
284 Ga0496111_0358296 3300048914 Bacteria 1079
285 Ga0496112_0640420 3300048915 Bacteria 993
286 Ga0496115_0498474 3300048918 Bacteria 979
287 Ga0496116_0004791 3300048919 Bacteria 12770
288 Ga0496117_0020871 3300048920 Bacteria 5327
289 Ga0496118_0042308 3300048921 Bacteria 3595
290 Ga0496118_0097646 3300048921 Bacteria 1998
291 Ga0496119_0055241 3300048922 Bacteria 2413
292 Ga0496119_0274283 3300048922 Bacteria 841
293 Ga0496120_0027324 3300048923 Bacteria 3512
294 Ga0496121_0000072 3300048924 Bacteria 244975
295 Ga0496121_0006787 3300048924 Bacteria 14023
296 Ga0496121_0011566 3300048924 Bacteria 9775
297 Ga0496122_0028838 3300048925 Bacteria 4696
298 Ga0496123_0075343 3300048926 Bacteria 2083
299 Ga0496124_0006647 3300048927 Bacteria 12543
300 Ga0496124_0008841 3300048927 Bacteria 10458
301 Ga0496124_0010379 3300048927 Bacteria 9439
302 Ga0496124_0157061 3300048927 Bacteria 1777
303 Ga0496124_0586992 3300048927 Bacteria 728
304 Ga0496125_0039493 3300048928 Bacteria 4062
305 Ga0496126_0015709 3300048929 Bacteria 7608
306 Ga0496126_0207083 3300048929 Bacteria 1653
307 Ga0501034_0277228 3300049571 Bacteria 1617
308 Ga0501035_0924506 3300049822 Bacteria 690
309 Ga0501044_0253297 3300049823 Bacteria 1701
310 nmdc:mga0k408_436798_c1 3300050493 Bacteria 778
311 nmdc:mga07m45_229588_c1 3300050496 Bacteria 1080
312 nmdc:mga07m45_434672_c1 3300050496 Bacteria 761
313 nmdc:mga07m45_78988_c1 3300050496 Bacteria 1878
314 Ga0500635_0000008 3300053080 Bacteria 167327
315 Ga0500635_0033674 3300053080 Bacteria 1673
316 Ga0500578_0483801 3300053086 Bacteria 699
317 Ga0500643_092401 3300053087 Bacteria 825
318 Ga0500646_0081543 3300053090 Bacteria 988
319 Ga0500641_0001732 3300053096 Bacteria 7762
320 Ga0500641_0198347 3300053096 Bacteria 857
321 Ga0500608_000165 3300053122 Bacteria 27378
322 Ga0500658_0032760 3300053134 Bacteria 2040
323 Ga0500559_0072399 3300053136 Bacteria 1553
324 Ga0500564_308890 3300053138 Bacteria 603
325 Ga0500588_0076101 3300053146 Bacteria 1112
326 Ga0500589_025047 3300053147 Bacteria 2761
327 Ga0500616_0005843 3300053153 Bacteria 8244
328 Ga0500616_0145184 3300053153 Bacteria 1105
329 Ga0500638_345060 3300053162 Bacteria 555
330 Ga0500636_0003090 3300053177 Bacteria 9330

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009177 Ga0105248_12626457 Ga0105248_126264572 96
2 iso_pu_bacteria 2643221547 2643756592 97
3 iso_pu_bacteria 2939669807 2939673090 97
4 3300027111 Ga0209281_1000110 Ga0209281_1000110162 98
5 3300028379 Ga0268266_11028354 Ga0268266_110283542 98
6 3300046501 Ga0495607_0017429 Ga0495607_0017429_1525_1821 98
7 3300046530 Ga0495654_0000380 Ga0495654_0000380_36142_36438 98
8 3300048924 Ga0496121_0011566 Ga0496121_0011566_742_1038 98
9 3300048927 Ga0496124_0010379 Ga0496124_0010379_1713_2009 98
10 3300003781 Ga0055536_1008178 Ga0055536_10081783 99
11 3300003791 Ga0055530_10007565 Ga0055530_100075653 99
12 3300003791 Ga0055530_10012234 Ga0055530_100122343 99
13 3300003794 Ga0055531_10003674 Ga0055531_100036742 99
14 3300005289 Ga0065704_10132934 Ga0065704_101329341 99
15 3300005347 Ga0070668_100010030 Ga0070668_1000100303 99
16 3300005353 Ga0070669_100020510 Ga0070669_1000205103 99
17 3300005355 Ga0070671_100005770 Ga0070671_1000057703 99
18 3300005367 Ga0070667_100018574 Ga0070667_1000185745 99
19 3300005548 Ga0070665_100081601 Ga0070665_1000816012 99
20 3300005563 Ga0068855_100641927 Ga0068855_1006419272 99
21 3300005841 Ga0068863_100040638 Ga0068863_1000406382 99
22 3300005842 Ga0068858_100035448 Ga0068858_1000354482 99
23 3300005843 Ga0068860_100039797 Ga0068860_1000397973 99
24 3300005844 Ga0068862_100047562 Ga0068862_1000475624 99
25 3300005844 Ga0068862_100262651 Ga0068862_1002626512 99
26 3300006186 Ga0075369_10015635 Ga0075369_100156352 99
27 3300009011 Ga0105251_10011958 Ga0105251_100119583 99
28 3300009092 Ga0105250_10277121 Ga0105250_102771212 99
29 3300009101 Ga0105247_10406941 Ga0105247_104069412 99
30 3300009177 Ga0105248_10054587 Ga0105248_100545873 99
31 3300009553 Ga0105249_11543338 Ga0105249_115433382 99
32 3300009978 Ga0105148_110133 Ga0105148_1101332 99
33 3300025292 Ga0209676_1003405 Ga0209676_10034052 99
34 3300025292 Ga0209676_1003451 Ga0209676_10034517 99
35 3300025298 Ga0209050_1004256 Ga0209050_10042562 99
36 3300025298 Ga0209050_1004321 Ga0209050_10043213 99
37 3300025303 Ga0209051_1000877 Ga0209051_100087733 99
38 3300025304 Ga0209257_1004543 Ga0209257_10045437 99
39 3300025304 Ga0209257_1005303 Ga0209257_10053032 99
40 3300025315 Ga0207697_10261680 Ga0207697_102616802 99
41 3300025735 Ga0207713_1002293 Ga0207713_100229311 99
42 3300025900 Ga0207710_10039799 Ga0207710_100397992 99
43 3300025900 Ga0207710_10224921 Ga0207710_102249212 99
44 3300025903 Ga0207680_10732835 Ga0207680_107328352 99
45 3300025923 Ga0207681_10002145 Ga0207681_100021454 99
46 3300025931 Ga0207644_10002514 Ga0207644_100025143 99
47 3300025941 Ga0207711_10001926 Ga0207711_1000192615 99
48 3300025949 Ga0207667_10572340 Ga0207667_105723402 99
49 3300025961 Ga0207712_11126517 Ga0207712_111265172 99
50 3300025972 Ga0207668_10019878 Ga0207668_100198782 99
51 3300025986 Ga0207658_10006565 Ga0207658_100065655 99
52 3300026035 Ga0207703_10027429 Ga0207703_100274292 99
53 3300026088 Ga0207641_10009847 Ga0207641_100098472 99
54 3300028379 Ga0268266_10001421 Ga0268266_100014215 99
55 3300028380 Ga0268265_10008004 Ga0268265_100080043 99
56 3300028380 Ga0268265_10008020 Ga0268265_100080205 99
57 3300028381 Ga0268264_10016140 Ga0268264_100161406 99
58 3300048905 Ga0496102_0027391 Ga0496102_0027391_130_429 99
59 3300048906 Ga0496103_0004087 Ga0496103_0004087_3026_3325 99
60 3300048919 Ga0496116_0004791 Ga0496116_0004791_2710_3009 99
61 3300048920 Ga0496117_0020871 Ga0496117_0020871_2665_2964 99
62 3300048921 Ga0496118_0042308 Ga0496118_0042308_1234_1533 99
63 3300048922 Ga0496119_0055241 Ga0496119_0055241_1931_2230 99
64 3300048922 Ga0496119_0274283 Ga0496119_0274283_451_750 99
65 3300048923 Ga0496120_0027324 Ga0496120_0027324_2144_2443 99
66 3300048924 Ga0496121_0006787 Ga0496121_0006787_10361_10660 99
67 3300048925 Ga0496122_0028838 Ga0496122_0028838_3571_3870 99
68 3300048926 Ga0496123_0075343 Ga0496123_0075343_1624_1923 99
69 3300048927 Ga0496124_0006647 Ga0496124_0006647_6155_6460 99
70 3300048927 Ga0496124_0157061 Ga0496124_0157061_1199_1498 99
71 3300048928 Ga0496125_0039493 Ga0496125_0039493_3438_3737 99
72 3300053087 Ga0500643_092401 Ga0500643_092401_368_667 99
73 3300053096 Ga0500641_0001732 Ga0500641_0001732_3459_3758 99
74 3300053122 Ga0500608_000165 Ga0500608_000165_11419_11724 99
75 2162886007 SwRhRL2b_contig_2445162 SwRhRL2b_0616.00001900 100
76 3300001904 JGI24736J21556_1000107 JGI24736J21556_100010712 100
77 3300001915 JGI24741J21665_1005215 JGI24741J21665_10052152 100
78 3300001979 JGI24740J21852_10010030 JGI24740J21852_100100302 100
79 3300001989 JGI24739J22299_10008990 JGI24739J22299_100089902 100
80 3300001990 JGI24737J22298_10017985 JGI24737J22298_100179853 100
81 3300002067 JGI24735J21928_10004162 JGI24735J21928_100041624 100
82 3300002075 JGI24738J21930_10002431 JGI24738J21930_100024314 100
83 3300002076 JGI24749J21850_1047867 JGI24749J21850_10478672 100
84 3300002705 JGI25156J39149_1040281 JGI25156J39149_10402811 100
85 3300002738 JGI25154J39366_1001942 JGI25154J39366_10019423 100
86 3300002741 JGI25157J39369_1000194 JGI25157J39369_10001943 100
87 3300003320 rootH2_10023162 rootH2_100231622 100
88 3300003323 rootH1_10005419 rootH1_100054199 100
89 3300003323 rootH1_10011285 rootH1_100112853 100
90 3300003752 Ga0055539_1000386 Ga0055539_10003867 100
91 3300003752 Ga0055539_1001280 Ga0055539_10012804 100
92 3300003756 Ga0055533_1000016 Ga0055533_1000016273 100
93 3300003759 Ga0055525_1001486 Ga0055525_10014863 100
94 3300003761 Ga0055535_1000778 Ga0055535_100077818 100
95 3300003763 Ga0055529_1000239 Ga0055529_10002395 100
96 3300005289 Ga0065704_10001261 Ga0065704_100012612 100
97 3300005327 Ga0070658_10054925 Ga0070658_100549253 100
98 3300005327 Ga0070658_10084223 Ga0070658_100842232 100
99 3300005327 Ga0070658_10344484 Ga0070658_103444841 100
100 3300005330 Ga0070690_100034346 Ga0070690_1000343464 100
101 3300005334 Ga0068869_101163682 Ga0068869_1011636821 100
102 3300005339 Ga0070660_100870758 Ga0070660_1008707581 100
103 3300005344 Ga0070661_100007621 Ga0070661_1000076212 100
104 3300005364 Ga0070673_100002821 Ga0070673_1000028212 100
105 3300005364 Ga0070673_102223882 Ga0070673_1022238821 100
106 3300005366 Ga0070659_100002705 Ga0070659_1000027055 100
107 3300005366 Ga0070659_100113542 Ga0070659_1001135422 100
108 3300005366 Ga0070659_100467595 Ga0070659_1004675952 100
109 3300005455 Ga0070663_100263712 Ga0070663_1002637122 100
110 3300005455 Ga0070663_100373701 Ga0070663_1003737012 100
111 3300005456 Ga0070678_100277124 Ga0070678_1002771242 100
112 3300005457 Ga0070662_100062760 Ga0070662_1000627602 100
113 3300005459 Ga0068867_100989715 Ga0068867_1009897152 100
114 3300005530 Ga0070679_101043110 Ga0070679_1010431101 100
115 3300005539 Ga0068853_100094035 Ga0068853_1000940352 100
116 3300005543 Ga0070672_100738802 Ga0070672_1007388021 100
117 3300005547 Ga0070693_101177157 Ga0070693_1011771572 100
118 3300005548 Ga0070665_100000972 Ga0070665_1000009723 100
119 3300005563 Ga0068855_100119840 Ga0068855_1001198403 100
120 3300005563 Ga0068855_100209771 Ga0068855_1002097712 100
121 3300005563 Ga0068855_100274329 Ga0068855_1002743293 100
122 3300005563 Ga0068855_100453494 Ga0068855_1004534942 100
123 3300005564 Ga0070664_100101396 Ga0070664_1001013961 100
124 3300005577 Ga0068857_100001367 Ga0068857_1000013676 100
125 3300005577 Ga0068857_100097167 Ga0068857_1000971672 100
126 3300005577 Ga0068857_100356665 Ga0068857_1003566652 100
127 3300005577 Ga0068857_100830133 Ga0068857_1008301332 100
128 3300005578 Ga0068854_100082517 Ga0068854_1000825171 100
129 3300005578 Ga0068854_100105089 Ga0068854_1001050892 100
130 3300005614 Ga0068856_100014166 Ga0068856_1000141667 100
131 3300005616 Ga0068852_100227257 Ga0068852_1002272572 100
132 3300005616 Ga0068852_100546229 Ga0068852_1005462292 100
133 3300005618 Ga0068864_100001223 Ga0068864_1000012234 100
134 3300005718 Ga0068866_10378349 Ga0068866_103783492 100
135 3300005719 Ga0068861_100099028 Ga0068861_1000990282 100
136 3300005834 Ga0068851_10002249 Ga0068851_100022497 100
137 3300005841 Ga0068863_100593905 Ga0068863_1005939052 100
138 3300005843 Ga0068860_100330151 Ga0068860_1003301512 100
139 3300006353 Ga0075370_10009723 Ga0075370_100097232 100
140 3300006353 Ga0075370_10059985 Ga0075370_100599852 100
141 3300006353 Ga0075370_10153990 Ga0075370_101539903 100
142 3300006358 Ga0068871_101523905 Ga0068871_1015239051 100
143 3300009093 Ga0105240_10001507 Ga0105240_100015079 100
144 3300009093 Ga0105240_10037625 Ga0105240_100376252 100
145 3300009093 Ga0105240_10199446 Ga0105240_101994463 100
146 3300009093 Ga0105240_10449249 Ga0105240_104492491 100
147 3300009093 Ga0105240_11053106 Ga0105240_110531062 100
148 3300009098 Ga0105245_10630533 Ga0105245_106305331 100
149 3300009176 Ga0105242_10091401 Ga0105242_100914012 100
150 3300009177 Ga0105248_10411182 Ga0105248_104111822 100
151 3300009177 Ga0105248_10587375 Ga0105248_105873752 100
152 3300009545 Ga0105237_10008251 Ga0105237_100082515 100
153 3300009545 Ga0105237_10137569 Ga0105237_101375691 100
154 3300009551 Ga0105238_10026097 Ga0105238_100260974 100
155 3300009551 Ga0105238_10174203 Ga0105238_101742032 100
156 3300009551 Ga0105238_10422390 Ga0105238_104223901 100
157 3300010375 Ga0105239_10000164 Ga0105239_1000016435 100
158 3300010375 Ga0105239_10076671 Ga0105239_100766713 100
159 3300011119 Ga0105246_10428193 Ga0105246_104281932 100
160 3300013100 Ga0157373_10028358 Ga0157373_100283583 100
161 3300013104 Ga0157370_10003887 Ga0157370_1000388714 100
162 3300013105 Ga0157369_10046646 Ga0157369_100466462 100
163 3300013296 Ga0157374_11289169 Ga0157374_112891692 100
164 3300013296 Ga0157374_11577906 Ga0157374_115779061 100
165 3300013297 Ga0157378_10271774 Ga0157378_102717742 100
166 3300013307 Ga0157372_10000732 Ga0157372_1000073227 100
167 3300014968 Ga0157379_10304968 Ga0157379_103049681 100
168 3300014968 Ga0157379_10806462 Ga0157379_108064622 100
169 3300014969 Ga0157376_12461953 Ga0157376_124619532 100
170 3300014969 Ga0157376_12680764 Ga0157376_126807642 100
171 3300015261 Ga0182006_1137089 Ga0182006_11370891 100
172 3300015265 Ga0182005_1067550 Ga0182005_10675502 100
173 3300017792 Ga0163161_10058811 Ga0163161_100588112 100
174 3300025226 Ga0209674_100041 Ga0209674_100041111 100
175 3300025230 Ga0209563_100043 Ga0209563_100043111 100
176 3300025230 Ga0209563_105987 Ga0209563_1059872 100
177 3300025231 Ga0207427_100700 Ga0207427_1007004 100
178 3300025242 Ga0209258_100074 Ga0209258_100074242 100
179 3300025246 Ga0209646_1000069 Ga0209646_1000069181 100
180 3300025250 Ga0209026_1000006 Ga0209026_1000006276 100
181 3300025253 Ga0209677_100067 Ga0209677_10006799 100
182 3300025253 Ga0209677_100077 Ga0209677_100077111 100
183 3300025254 Ga0209148_1009785 Ga0209148_10097852 100
184 3300025256 Ga0209759_1000189 Ga0209759_100018917 100
185 3300025256 Ga0209759_1000834 Ga0209759_10008345 100
186 3300025256 Ga0209759_1001251 Ga0209759_10012516 100
187 3300025256 Ga0209759_1017053 Ga0209759_10170532 100
188 3300025261 Ga0209233_1085295 Ga0209233_10852951 100
189 3300025272 Ga0209455_1000066 Ga0209455_1000066282 100
190 3300025292 Ga0209676_1001119 Ga0209676_100111915 100
191 3300025298 Ga0209050_1008531 Ga0209050_10085315 100
192 3300025315 Ga0207697_10029728 Ga0207697_100297283 100
193 3300025321 Ga0207656_10005598 Ga0207656_100055982 100
194 3300025904 Ga0207647_10000657 Ga0207647_100006574 100
195 3300025909 Ga0207705_10036998 Ga0207705_100369983 100
196 3300025909 Ga0207705_10049053 Ga0207705_100490533 100
197 3300025909 Ga0207705_10176217 Ga0207705_101762172 100
198 3300025909 Ga0207705_10944399 Ga0207705_109443992 100
199 3300025909 Ga0207705_11013274 Ga0207705_110132742 100
200 3300025911 Ga0207654_10029150 Ga0207654_100291502 100
201 3300025913 Ga0207695_10010134 Ga0207695_1001013410 100
202 3300025913 Ga0207695_10167046 Ga0207695_101670463 100
203 3300025913 Ga0207695_10173984 Ga0207695_101739843 100
204 3300025913 Ga0207695_10945638 Ga0207695_109456382 100
205 3300025914 Ga0207671_10005728 Ga0207671_100057288 100
206 3300025914 Ga0207671_10448306 Ga0207671_104483062 100
207 3300025917 Ga0207660_11385956 Ga0207660_113859562 100
208 3300025919 Ga0207657_10066757 Ga0207657_100667574 100
209 3300025919 Ga0207657_10303044 Ga0207657_103030442 100
210 3300025920 Ga0207649_10008830 Ga0207649_100088302 100
211 3300025920 Ga0207649_11104932 Ga0207649_111049322 100
212 3300025923 Ga0207681_10414285 Ga0207681_104142852 100
213 3300025924 Ga0207694_10127993 Ga0207694_101279931 100
214 3300025924 Ga0207694_10314753 Ga0207694_103147532 100
215 3300025927 Ga0207687_10323542 Ga0207687_103235422 100
216 3300025931 Ga0207644_11255116 Ga0207644_112551161 100
217 3300025932 Ga0207690_10097848 Ga0207690_100978482 100
218 3300025932 Ga0207690_10252979 Ga0207690_102529792 100
219 3300025933 Ga0207706_10091491 Ga0207706_100914912 100
220 3300025934 Ga0207686_10233605 Ga0207686_102336052 100
221 3300025941 Ga0207711_10124139 Ga0207711_101241392 100
222 3300025941 Ga0207711_10224649 Ga0207711_102246492 100
223 3300025942 Ga0207689_11494347 Ga0207689_114943472 100
224 3300025949 Ga0207667_10046605 Ga0207667_100466058 100
225 3300025949 Ga0207667_10101153 Ga0207667_101011531 100
226 3300025949 Ga0207667_10355017 Ga0207667_103550172 100
227 3300025949 Ga0207667_10424486 Ga0207667_104244862 100
228 3300025949 Ga0207667_11984492 Ga0207667_119844921 100
229 3300025960 Ga0207651_10009764 Ga0207651_100097644 100
230 3300025960 Ga0207651_11915400 Ga0207651_119154002 100
231 3300025981 Ga0207640_10002820 Ga0207640_100028202 100
232 3300025981 Ga0207640_10009671 Ga0207640_100096715 100
233 3300026023 Ga0207677_10448648 Ga0207677_104486482 100
234 3300026041 Ga0207639_10075267 Ga0207639_100752671 100
235 3300026067 Ga0207678_10167592 Ga0207678_101675922 100
236 3300026067 Ga0207678_10392299 Ga0207678_103922992 100
237 3300026078 Ga0207702_10002360 Ga0207702_100023601 100
238 3300026088 Ga0207641_10000574 Ga0207641_1000057436 100
239 3300026089 Ga0207648_10149363 Ga0207648_101493632 100
240 3300026095 Ga0207676_10012012 Ga0207676_100120123 100
241 3300026116 Ga0207674_10023855 Ga0207674_100238557 100
242 3300026116 Ga0207674_10052829 Ga0207674_100528293 100
243 3300026116 Ga0207674_10178249 Ga0207674_101782492 100
244 3300026118 Ga0207675_100039595 Ga0207675_1000395953 100
245 3300026121 Ga0207683_10151985 Ga0207683_101519852 100
246 3300026142 Ga0207698_10003867 Ga0207698_100038672 100
247 3300026142 Ga0207698_11461853 Ga0207698_114618531 100
248 3300028379 Ga0268266_10000566 Ga0268266_1000056634 100
249 3300028381 Ga0268264_10238546 Ga0268264_102385462 100
250 3300028381 Ga0268264_10727654 Ga0268264_107276541 100
251 3300028666 Ga0265336_10000013 Ga0265336_10000013126 100
252 3300029957 Ga0265324_10000432 Ga0265324_1000043214 100
253 3300031247 Ga0265340_10037757 Ga0265340_100377572 100
254 3300031456 Ga0307513_10570946 Ga0307513_105709461 100
255 3300031507 Ga0307509_10787271 Ga0307509_107872712 100
256 3300031548 Ga0307408_100078026 Ga0307408_1000780263 100
257 3300031730 Ga0307516_10000559 Ga0307516_1000055927 100
258 3300031852 Ga0307410_10021606 Ga0307410_100216063 100
259 3300031901 Ga0307406_10004017 Ga0307406_1000401711 100
260 3300031901 Ga0307406_10373918 Ga0307406_103739182 100
261 3300031901 Ga0307406_10905892 Ga0307406_109058922 100
262 3300031911 Ga0307412_10023738 Ga0307412_100237382 100
263 3300031995 Ga0307409_101027710 Ga0307409_1010277102 100
264 3300031995 Ga0307409_101255019 Ga0307409_1012550191 100
265 3300032002 Ga0307416_100002244 Ga0307416_10000224419 100
266 3300032004 Ga0307414_10137457 Ga0307414_101374572 100
267 3300032004 Ga0307414_10157864 Ga0307414_101578642 100
268 3300034820 Ga0373959_0010921 Ga0373959_0010921_477_782 100
269 3300035086 Ga0373934_0022645 Ga0373934_0022645_1593_1898 100
270 3300035691 Ga0373931_1285647 Ga0373931_1285647_28_333 100
271 3300037068 Ga0373925_0559593 Ga0373925_0559593_336_641 100
272 3300037312 Ga0395899_0236824 Ga0395899_0236824_388_693 100
273 3300037418 Ga0395900_0888271 Ga0395900_0888271_487_792 100
274 3300037466 Ga0395898_0336637 Ga0395898_0336637_776_1081 100
275 3300038443 Ga0395901_0350989 Ga0395901_0350989_1103_1408 100
276 3300039437 Ga0436365_1011890 Ga0436365_1011890_6701_7147 100
277 3300041413 Ga0439465_0246683 Ga0439465_0246683_342_647 100
278 3300041443 Ga0451789_0018752 Ga0451789_0018752_48_353 100
279 3300041459 Ga0451800_0862879 Ga0451800_0862879_266_574 100
280 3300041498 Ga0451841_1201973 Ga0451841_1201973_398_703 100
281 3300041505 Ga0451849_1135337 Ga0451849_1135337_588_893 100
282 3300041512 Ga0451853_0524760 Ga0451853_0524760_394_699 100
283 3300041512 Ga0451853_1393126 Ga0451853_1393126_765_1070 100
284 3300041512 Ga0451853_3904735 Ga0451853_3904735_194_499 100
285 3300044694 Ga0466963_0508377 Ga0466963_0508377_188_493 100
286 3300046460 Ga0495638_0099372 Ga0495638_0099372_295_597 100
287 3300046471 Ga0495650_0007825 Ga0495650_0007825_3712_4017 100
288 3300046506 Ga0495583_0000034 Ga0495583_0000034_230907_231212 100
289 3300046507 Ga0495606_0002607 Ga0495606_0002607_15088_15393 100
290 3300046519 Ga0495632_0184679 Ga0495632_0184679_202_507 100
291 3300046616 Ga0495668_0054813 Ga0495668_0054813_1655_1960 100
292 3300046660 Ga0495625_0000443 Ga0495625_0000443_24116_24418 100
293 3300046660 Ga0495625_0128491 Ga0495625_0128491_640_945 100
294 3300046684 Ga0495669_0017422 Ga0495669_0017422_1957_2262 100
295 3300046694 Ga0495649_0000728 Ga0495649_0000728_10435_10740 100
296 3300046794 Ga0495589_0126290 Ga0495589_0126290_221_526 100
297 3300047472 Ga0495686_0001084 Ga0495686_0001084_16277_16579 100
298 3300047472 Ga0495686_0163475 Ga0495686_0163475_516_818 100
299 3300047472 Ga0495686_0240689 Ga0495686_0240689_134_439 100
300 3300047472 Ga0495686_0318887 Ga0495686_0318887_450_752 100
301 3300048912 Ga0496109_1753205 Ga0496109_1753205_181_483 100
302 3300048913 Ga0496110_0388192 Ga0496110_0388192_14_316 100
303 3300048914 Ga0496111_0358296 Ga0496111_0358296_34_336 100
304 3300048915 Ga0496112_0640420 Ga0496112_0640420_217_519 100
305 3300048918 Ga0496115_0498474 Ga0496115_0498474_543_848 100
306 3300048921 Ga0496118_0097646 Ga0496118_0097646_698_1060 100
307 3300048924 Ga0496121_0000072 Ga0496121_0000072_164086_164448 100
308 3300048927 Ga0496124_0008841 Ga0496124_0008841_4988_5314 100
309 3300048927 Ga0496124_0586992 Ga0496124_0586992_49_354 100
310 3300048929 Ga0496126_0015709 Ga0496126_0015709_5952_6314 100
311 3300048929 Ga0496126_0207083 Ga0496126_0207083_1199_1507 100
312 3300049571 Ga0501034_0277228 Ga0501034_0277228_152_463 100
313 3300049822 Ga0501035_0924506 Ga0501035_0924506_51_356 100
314 3300049823 Ga0501044_0253297 Ga0501044_0253297_350_661 100
315 3300050493 nmdc:mga0k408_436798_c1 nmdc:mga0k408_436798_c1_358_663 100
316 3300050496 nmdc:mga07m45_229588_c1 nmdc:mga07m45_229588_c1_282_587 100
317 3300050496 nmdc:mga07m45_434672_c1 nmdc:mga07m45_434672_c1_297_602 100
318 3300050496 nmdc:mga07m45_78988_c1 nmdc:mga07m45_78988_c1_1279_1584 100
319 3300053080 Ga0500635_0000008 Ga0500635_0000008_157822_158127 100
320 3300053080 Ga0500635_0033674 Ga0500635_0033674_771_1076 100
321 3300053086 Ga0500578_0483801 Ga0500578_0483801_51_356 100
322 3300053090 Ga0500646_0081543 Ga0500646_0081543_271_579 100
323 3300053096 Ga0500641_0198347 Ga0500641_0198347_428_733 100
324 3300053134 Ga0500658_0032760 Ga0500658_0032760_1307_1615 100
325 3300053136 Ga0500559_0072399 Ga0500559_0072399_479_781 100
326 3300053138 Ga0500564_308890 Ga0500564_308890_25_330 100
327 3300053146 Ga0500588_0076101 Ga0500588_0076101_30_332 100
328 3300053147 Ga0500589_025047 Ga0500589_025047_512_817 100
329 3300053153 Ga0500616_0005843 Ga0500616_0005843_6979_7284 100
330 3300053153 Ga0500616_0145184 Ga0500616_0145184_680_985 100
331 3300053162 Ga0500638_345060 Ga0500638_345060_209_514 100
332 3300053177 Ga0500636_0003090 Ga0500636_0003090_2081_2386 100

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02148

zf-UBP

Zn-finger in ubiquitin-hydrolases and other protein

40

109

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ida-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9439 1 97
2ida-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9346 1 97
2i50-assembly1.cif.gz_A solution structure of ubp-m znf-ubp domain 0.77 4 83
6t9l-assembly1.cif.gz_K saga dub module bound to a ubiqitinated nucleosome 0.7424 32 82
5g0f-assembly1.cif.gz_A crystal structure of danio rerio hdac6 znf-ubp domain 0.7379 4 83
ID Description Score Start End Superfamily
2idaA01 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.9511 1 83 3.30.40.10
2idaA01 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8895 1 83 3.30.40.10
af_Q9GRV2_34_127_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8339 20 84 3.30.40.10
af_A0A1D6LDR0_35_160_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8057 31 83 3.30.40.10
af_Q0J492_27_131_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.7872 33 85 3.30.40.10
ID Description Score Start End GO Terms
AF-A0A7W5Q5D6-F1-model_v4 UBP-type domain-containing protein 0.9883 10 97 GO:0008270
AF-A0A7W0RST2-F1-model_v4 UBP-type zinc finger domain-containing protein 0.9841 1 58 GO:0008270
AF-A0A1I4Q454-F1-model_v4 UBP-type domain-containing protein 0.9838 3 97 GO:0008270
AF-A0A4Q3XV57-F1-model_v4 deleted 0.9834 1 60
AF-A0A4Q2YQC4-F1-model_v4 UBP-type domain-containing protein 0.9823 19 97 GO:0008270

Feature Viewer

pLDDT pTM Quality
88.69 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map