F410716

General Info

Members Datasets Scaffolds Average Seq Length
331 181 662 356

Family's Representative Sequence

Representative Sequence 3300053086|Ga0500578_0000024|Ga0500578_0000024_69855_71024
Length 389
Sequence MSNVECRSKYVRVFHFNIRHSSVQPSTFRYMKSTLLLGTRKGLIAYRFQQGKWTMESCSFEGVPISIAYADPRNGTWWACQDHGHWGVKLQRSKDRGKSWEEVAAPAYPEGEEVKEGMPATTRYLWSMAHGGKNYTSRLWVGTDPGGLFVSEDEGNSFQLVDSLWKHPTRKDWFGGGRDLPGIHSIVVDPRNEDHIHIGISCAGVFETTDAGKSWAIRNKGMNADFLPDPSVETGFDPHIVVAAPGNPDTLWQQNHCGIFRSTDAGKNWLDVSEADGPARFGFAIAVAGDNPDQAWVAPADSDVNRTAIQGALVICRTDDGGKTWKQLRNGLPQESCFDIVYRHALVNDSNAVVFGTTTGNLFFSPDRGDNWQVINNYLPMIYSVQFAE

Samples

Sample ID Description Type Environment
1 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
125 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
126 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
127 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
128 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
129 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
130 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
131 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
134 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
135 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
136 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
137 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
138 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
139 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
140 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
141 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
142 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
143 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
151 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
152 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
162 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
166 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
167 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
168 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
177 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
178 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
179 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
180 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
181 2738541278 Niastella sp. CF465 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0.3
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.51
Nodule 0
Rhizoplane 3.32
Rhizosphere 91.84
Stem 0
Stem Tuber 0
Unclassified 8.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500578_0000024 3300053086 Bacteria 151503
2 rootH2_10049481 3300003320 Bacteria 8238
3 rootH2_10132053 3300003320 Bacteria 2973
4 rootH1_10006977 3300003323 Bacteria 15686
5 rootH1_10096535 3300003323 Bacteria 2838
6 Ga0070676_10042177 3300005328 Bacteria 2648
7 Ga0070683_100029539 3300005329 Bacteria 4964
8 Ga0070683_100072554 3300005329 Bacteria 3213
9 Ga0070670_100072488 3300005331 Bacteria 2958
10 Ga0070670_100129010 3300005331 Bacteria 2183
11 Ga0070670_100155474 3300005331 Bacteria 1980
12 Ga0068869_100041730 3300005334 Bacteria 3287
13 Ga0068869_100117946 3300005334 Bacteria 2027
14 Ga0068869_100185073 3300005334 Unclassified 1634
15 Ga0070666_10010917 3300005335 Bacteria 5690
16 Ga0070666_10094246 3300005335 Bacteria 2059
17 Ga0070682_100051453 3300005337 Bacteria 2574
18 Ga0068868_100085294 3300005338 Bacteria 2537
19 Ga0070660_100061902 3300005339 Bacteria 2906
20 Ga0070689_100128161 3300005340 Bacteria 2033
21 Ga0070668_100044002 3300005347 Bacteria 3424
22 Ga0070668_100059722 3300005347 Bacteria 2951
23 Ga0070668_100059897 3300005347 Bacteria 2947
24 Ga0070669_100054294 3300005353 Bacteria 2934
25 Ga0070675_100012317 3300005354 Bacteria 6702
26 Ga0070675_100060880 3300005354 Bacteria 3116
27 Ga0070673_100003940 3300005364 Bacteria 9326
28 Ga0070673_100012390 3300005364 Bacteria 5851
29 Ga0070673_100111033 3300005364 Bacteria 2274
30 Ga0070688_100003740 3300005365 Bacteria 7878
31 Ga0070659_100042687 3300005366 Bacteria 3545
32 Ga0070667_100073817 3300005367 Bacteria 2909
33 Ga0070700_100189278 3300005441 Bacteria 1438
34 Ga0070708_100047850 3300005445 Bacteria 3778
35 Ga0070678_100025209 3300005456 Bacteria 3996
36 Ga0070662_100027676 3300005457 Bacteria 3939
37 Ga0070706_100138747 3300005467 Bacteria 2269
38 Ga0070698_100008358 3300005471 Bacteria 11187
39 Ga0070698_100196842 3300005471 Bacteria 1952
40 Ga0070698_100326773 3300005471 Unclassified 1465
41 Ga0070699_100033283 3300005518 Bacteria 4452
42 Ga0070679_100012329 3300005530 Bacteria 8165
43 Ga0070684_100014418 3300005535 Bacteria 6404
44 Ga0070684_100018387 3300005535 Bacteria 5757
45 Ga0070697_100012673 3300005536 Bacteria 6604
46 Ga0068853_100001343 3300005539 Bacteria 17728
47 Ga0068853_100065383 3300005539 Unclassified 3156
48 Ga0068853_100072235 3300005539 Bacteria 3006
49 Ga0068853_100113272 3300005539 Bacteria 2411
50 Ga0068853_100359492 3300005539 Bacteria 1356
51 Ga0070695_100014921 3300005545 Bacteria 4686
52 Ga0070695_100069907 3300005545 Bacteria 2295
53 Ga0070695_100087783 3300005545 Unclassified 2070
54 Ga0070696_100018447 3300005546 Bacteria 4716
55 Ga0070696_100086204 3300005546 Bacteria 2229
56 Ga0070665_100001425 3300005548 Bacteria 28047
57 Ga0070704_100036657 3300005549 Bacteria 3343
58 Ga0068855_100000630 3300005563 Bacteria 43230
59 Ga0068855_100037238 3300005563 Bacteria 5787
60 Ga0068855_100037672 3300005563 Bacteria 5749
61 Ga0068855_100098296 3300005563 Bacteria 3372
62 Ga0070664_100134259 3300005564 Bacteria 2175
63 Ga0068857_100004171 3300005577 Bacteria 12171
64 Ga0068857_100058126 3300005577 Bacteria 3433
65 Ga0068854_100069907 3300005578 Bacteria 2565
66 Ga0068854_100101573 3300005578 Bacteria 2157
67 Ga0068856_100217060 3300005614 Bacteria 1928
68 Ga0068852_100011415 3300005616 Bacteria 6687
69 Ga0068852_100120953 3300005616 Bacteria 2397
70 Ga0068859_100386781 3300005617 Bacteria 1495
71 Ga0068864_100069753 3300005618 Bacteria 3057
72 Ga0068861_100006797 3300005719 Bacteria 7813
73 Ga0068861_100013945 3300005719 Bacteria 5633
74 Ga0068870_10029939 3300005840 Bacteria 2748
75 Ga0068870_10037546 3300005840 Bacteria 2498
76 Ga0068863_100035472 3300005841 Unclassified 4751
77 Ga0068860_100000029 3300005843 Bacteria 259192
78 Ga0068860_100003906 3300005843 Bacteria 15324
79 Ga0068860_100017189 3300005843 Bacteria 7051
80 Ga0068860_100031293 3300005843 Bacteria 5115
81 Ga0068860_100201535 3300005843 Bacteria 1928
82 Ga0068862_100013235 3300005844 Bacteria 6824
83 Ga0068862_100025051 3300005844 Bacteria 5008
84 Ga0068862_100111386 3300005844 Bacteria 2403
85 Ga0081539_10027587 3300005985 Bacteria 3592
86 Ga0068871_100054329 3300006358 Bacteria 3249
87 Ga0068871_100094521 3300006358 Bacteria 2495
88 Ga0075428_100016346 3300006844 Bacteria 8200
89 Ga0075428_100018798 3300006844 Bacteria 7641
90 Ga0075428_100059356 3300006844 Bacteria 4189
91 Ga0075431_100026148 3300006847 Bacteria 5987
92 Ga0075429_100031585 3300006880 Bacteria 4602
93 Ga0075429_100092304 3300006880 Bacteria 2641
94 Ga0075429_100242403 3300006880 Bacteria 1579
95 Ga0068865_100110737 3300006881 Bacteria 2025
96 Ga0097620_100386796 3300006931 Bacteria 1495
97 Ga0105240_10001435 3300009093 Bacteria 40778
98 Ga0105240_10001517 3300009093 Bacteria 39516
99 Ga0105240_10002716 3300009093 Bacteria 28079
100 Ga0105240_10002823 3300009093 Bacteria 27474
101 Ga0105240_10015666 3300009093 Bacteria 10295
102 Ga0105240_10021041 3300009093 Bacteria 8682
103 Ga0105240_10081433 3300009093 Bacteria 3978
104 Ga0105240_10104936 3300009093 Bacteria 3431
105 Ga0111539_10005858 3300009094 Bacteria 15881
106 Ga0114129_10001177 3300009147 Bacteria 34690
107 Ga0114129_10121930 3300009147 Bacteria 3587
108 Ga0105243_10398388 3300009148 Bacteria 1278
109 Ga0105241_10000801 3300009174 Bacteria 23852
110 Ga0105241_10008168 3300009174 Bacteria 7708
111 Ga0105241_10103912 3300009174 Bacteria 2263
112 Ga0105241_10153762 3300009174 Bacteria 1884
113 Ga0105242_10056672 3300009176 Bacteria 3207
114 Ga0105237_10003140 3300009545 Bacteria 19871
115 Ga0105237_10005413 3300009545 Bacteria 14415
116 Ga0105237_10018813 3300009545 Bacteria 7144
117 Ga0105237_10023757 3300009545 Bacteria 6275
118 Ga0105237_10027549 3300009545 Bacteria 5798
119 Ga0105237_10131036 3300009545 Bacteria 2502
120 Ga0105237_10261811 3300009545 Bacteria 1732
121 Ga0105238_10006137 3300009551 Bacteria 11930
122 Ga0105238_10032732 3300009551 Bacteria 5291
123 Ga0105249_10002979 3300009553 Bacteria 14608
124 Ga0105249_10011892 3300009553 Bacteria 7655
125 Ga0105249_10015498 3300009553 Bacteria 6747
126 Ga0105249_10028006 3300009553 Bacteria 5086
127 Ga0105239_10000048 3300010375 Bacteria 177855
128 Ga0105239_10000863 3300010375 Bacteria 43069
129 Ga0105239_10003203 3300010375 Bacteria 20233
130 Ga0105239_10008174 3300010375 Bacteria 11935
131 Ga0105239_10153535 3300010375 Bacteria 2570
132 Ga0105239_10165432 3300010375 Bacteria 2473
133 Ga0157373_10004686 3300013100 Bacteria 10283
134 Ga0157373_10050229 3300013100 Bacteria 2970
135 Ga0157371_10021718 3300013102 Bacteria 4709
136 Ga0157370_10002875 3300013104 Bacteria 20517
137 Ga0157370_10004121 3300013104 Bacteria 16850
138 Ga0157370_10017507 3300013104 Bacteria 7230
139 Ga0157370_10047147 3300013104 Bacteria 4131
140 Ga0157369_10012667 3300013105 Bacteria 9563
141 Ga0157369_10025207 3300013105 Bacteria 6603
142 Ga0157369_10134152 3300013105 Bacteria 2622
143 Ga0157374_10000001 3300013296 Bacteria 1077351
144 Ga0157378_10029071 3300013297 Unclassified 4878
145 Ga0157378_10304990 3300013297 Bacteria 1542
146 Ga0163162_10000038 3300013306 Bacteria 138065
147 Ga0163162_10054605 3300013306 Bacteria 4019
148 Ga0163162_10065768 3300013306 Bacteria 3673
149 Ga0157372_10000596 3300013307 Bacteria 39416
150 Ga0157372_10002035 3300013307 Bacteria 21994
151 Ga0157372_10551032 3300013307 Bacteria 1344
152 Ga0157375_10093191 3300013308 Bacteria 3077
153 Ga0157375_10480215 3300013308 Bacteria 1408
154 Ga0157375_10527082 3300013308 Bacteria 1344
155 Ga0163163_10100874 3300014325 Bacteria 2909
156 Ga0163163_10275970 3300014325 Bacteria 1732
157 Ga0157380_10001009 3300014326 Bacteria 17898
158 Ga0157380_10197852 3300014326 Bacteria 1780
159 Ga0157377_10002331 3300014745 Bacteria 8363
160 Ga0157379_10004872 3300014968 Bacteria 11529
161 Ga0157376_10002300 3300014969 Bacteria 12901
162 Ga0157376_10073364 3300014969 Bacteria 2914
163 Ga0157376_10182585 3300014969 Bacteria 1919
164 Ga0157376_10291910 3300014969 Unclassified 1540
165 Ga0206352_11195613 3300020078 Bacteria 2061
166 Ga0207653_10009024 3300025885 Bacteria 3113
167 Ga0207710_10000852 3300025900 Bacteria 16442
168 Ga0207688_10006945 3300025901 Bacteria 6161
169 Ga0207645_10001579 3300025907 Bacteria 18601
170 Ga0207645_10042095 3300025907 Bacteria 2923
171 Ga0207643_10012158 3300025908 Bacteria 4652
172 Ga0207705_10085369 3300025909 Bacteria 2306
173 Ga0207654_10012613 3300025911 Bacteria 4334
174 Ga0207695_10000023 3300025913 Bacteria 657903
175 Ga0207695_10000110 3300025913 Bacteria 250079
176 Ga0207695_10000229 3300025913 Bacteria 149313
177 Ga0207695_10001408 3300025913 Bacteria 40540
178 Ga0207695_10007565 3300025913 Bacteria 13773
179 Ga0207695_10011405 3300025913 Bacteria 10773
180 Ga0207695_10025984 3300025913 Bacteria 6543
181 Ga0207695_10146043 3300025913 Unclassified 2309
182 Ga0207671_10002462 3300025914 Bacteria 19787
183 Ga0207671_10005499 3300025914 Bacteria 11657
184 Ga0207671_10013408 3300025914 Bacteria 6527
185 Ga0207671_10021960 3300025914 Bacteria 4834
186 Ga0207671_10022391 3300025914 Bacteria 4779
187 Ga0207671_10139433 3300025914 Bacteria 1867
188 Ga0207660_10285977 3300025917 Unclassified 1310
189 Ga0207657_10079916 3300025919 Bacteria 2750
190 Ga0207649_10081890 3300025920 Bacteria 2091
191 Ga0207646_10008332 3300025922 Bacteria 10404
192 Ga0207646_10012308 3300025922 Bacteria 8228
193 Ga0207681_10065240 3300025923 Bacteria 2516
194 Ga0207694_10032074 3300025924 Bacteria 4019
195 Ga0207694_10124260 3300025924 Bacteria 2063
196 Ga0207650_10081324 3300025925 Bacteria 2457
197 Ga0207650_10082114 3300025925 Bacteria 2446
198 Ga0207659_10011139 3300025926 Bacteria 5673
199 Ga0207659_10052219 3300025926 Bacteria 2911
200 Ga0207690_10100756 3300025932 Bacteria 2062
201 Ga0207706_10004345 3300025933 Bacteria 13309
202 Ga0207686_10000956 3300025934 Bacteria 17240
203 Ga0207670_10139781 3300025936 Bacteria 1784
204 Ga0207691_10030171 3300025940 Bacteria 5068
205 Ga0207691_10080771 3300025940 Bacteria 2924
206 Ga0207691_10320169 3300025940 Bacteria 1330
207 Ga0207689_10015850 3300025942 Bacteria 6384
208 Ga0207689_10020109 3300025942 Bacteria 5622
209 Ga0207689_10022438 3300025942 Bacteria 5308
210 Ga0207689_10032139 3300025942 Bacteria 4365
211 Ga0207689_10087261 3300025942 Bacteria 2563
212 Ga0207661_10023156 3300025944 Bacteria 4690
213 Ga0207679_10056832 3300025945 Bacteria 2891
214 Ga0207667_10000700 3300025949 Bacteria 43461
215 Ga0207667_10000791 3300025949 Bacteria 41085
216 Ga0207667_10016480 3300025949 Bacteria 8349
217 Ga0207667_10019225 3300025949 Bacteria 7636
218 Ga0207667_10035184 3300025949 Bacteria 5373
219 Ga0207667_10068860 3300025949 Unclassified 3684
220 Ga0207712_10002195 3300025961 Bacteria 12716
221 Ga0207712_10042119 3300025961 Unclassified 3143
222 Ga0207640_10371818 3300025981 Bacteria 1155
223 Ga0207658_10137385 3300025986 Bacteria 1973
224 Ga0207677_10018033 3300026023 Bacteria 4228
225 Ga0207677_10160836 3300026023 Bacteria 1744
226 Ga0207639_10011306 3300026041 Bacteria 6196
227 Ga0207639_10034823 3300026041 Bacteria 3724
228 Ga0207639_10056429 3300026041 Bacteria 3010
229 Ga0207639_10195273 3300026041 Bacteria 1732
230 Ga0207708_10106878 3300026075 Bacteria 2170
231 Ga0207702_10014437 3300026078 Bacteria 6558
232 Ga0207702_10067414 3300026078 Bacteria 3071
233 Ga0207641_10030181 3300026088 Unclassified 4489
234 Ga0207641_10051906 3300026088 Bacteria 3472
235 Ga0207641_10336682 3300026088 Unclassified 1435
236 Ga0207641_10440929 3300026088 Unclassified 1257
237 Ga0207648_10001165 3300026089 Bacteria 29395
238 Ga0207648_10231894 3300026089 Bacteria 1642
239 Ga0207676_10449067 3300026095 Bacteria 1215
240 Ga0207674_10009204 3300026116 Bacteria 11321
241 Ga0207674_10020666 3300026116 Bacteria 7107
242 Ga0207674_10066147 3300026116 Bacteria 3642
243 Ga0207674_10083870 3300026116 Bacteria 3185
244 Ga0207675_100001010 3300026118 Bacteria 27839
245 Ga0207675_100064194 3300026118 Unclassified 3432
246 Ga0207675_100194412 3300026118 Unclassified 1947
247 Ga0207675_100371834 3300026118 Bacteria 1404
248 Ga0207683_10031586 3300026121 Bacteria 4596
249 Ga0207698_10075417 3300026142 Bacteria 2695
250 Ga0207698_10174265 3300026142 Bacteria 1898
251 Ga0207428_10019203 3300027907 Bacteria 5828
252 Ga0268266_10050957 3300028379 Unclassified 3552
253 Ga0268265_10017994 3300028380 Bacteria 4890
254 Ga0268265_10107948 3300028380 Bacteria 2265
255 Ga0268265_10456567 3300028380 Bacteria 1195
256 Ga0268264_10000072 3300028381 Bacteria 260791
257 Ga0268264_10033350 3300028381 Bacteria 4229
258 Ga0268264_10039638 3300028381 Bacteria 3892
259 Ga0268264_10149434 3300028381 Bacteria 2093
260 Ga0307511_10000353 3300030521 Bacteria 48689
261 Ga0265320_10084002 3300031240 Unclassified 1483
262 Ga0307513_10225529 3300031456 Bacteria 1691
263 Ga0307513_10238251 3300031456 Bacteria 1627
264 Ga0307509_10139860 3300031507 Bacteria 2359
265 Ga0307516_10100454 3300031730 Unclassified 2709
266 Ga0373954_0005243 3300035118 Bacteria 5600
267 Ga0373956_0019333 3300035119 Bacteria 2887
268 Ga0373933_0065336 3300035724 Bacteria 2203
269 Ga0373937_0104240 3300036401 Bacteria 2635
270 Ga0451791_1905626 3300041451 Bacteria 1833
271 Ga0451798_1086472 3300041458 Bacteria 1350
272 Ga0439431_0016035 3300041997 Unclassified 1750
273 Ga0439442_015602 3300042002 Unclassified 1565
274 Ga0450898_002180 3300042134 Unclassified 2714
275 Ga0439434_0035013 3300042435 Bacteria 1534
276 Ga0466969_0000051 3300044656 Bacteria 61557
277 Ga0466972_0000235 3300044658 Bacteria 38259
278 Ga0466972_0021143 3300044658 Bacteria 3247
279 Ga0466961_0067967 3300044693 Bacteria 2263
280 Ga0453684_0037941 3300044712 Bacteria 6602
281 Ga0466957_0005831 3300044842 Bacteria 6934
282 Ga0466957_0007403 3300044842 Bacteria 6204
283 Ga0466957_0044959 3300044842 Unclassified 2677
284 Ga0466959_0000264 3300045049 Bacteria 32164
285 Ga0466959_0085327 3300045049 Bacteria 2272
286 Ga0451576_0004708 3300045051 Bacteria 17540
287 Ga0466958_0181608 3300045836 Unclassified 1335
288 Ga0466967_0069842 3300045976 Bacteria 3141
289 Ga0495650_0017823 3300046471 Unclassified 3549
290 Ga0495668_0000639 3300046616 Bacteria 42159
291 Ga0495625_0192784 3300046660 Bacteria 1349
292 Ga0495672_0092649 3300047320 Bacteria 1656
293 Ga0495687_000004 3300047443 Bacteria 779298
294 Ga0496102_0002147 3300048905 Bacteria 16928
295 Ga0496103_0035981 3300048906 Bacteria 3031
296 Ga0496104_0016406 3300048907 Bacteria 6727
297 Ga0496105_0025987 3300048908 Bacteria 4771
298 Ga0496106_0074118 3300048909 Bacteria 2605
299 Ga0496107_0023378 3300048910 Bacteria 4371
300 Ga0496107_0263140 3300048910 Bacteria 1283
301 Ga0496108_0010923 3300048911 Bacteria 7372
302 Ga0496111_0016746 3300048914 Bacteria 5057
303 Ga0496126_0217929 3300048929 Unclassified 1605
304 Ga0501043_0291904 3300049579 Bacteria 1248
305 Ga0501047_0027376 3300049581 Bacteria 5492
306 Ga0501047_0033610 3300049581 Bacteria 4949
307 Ga0501047_0115321 3300049581 Bacteria 2568
308 Ga0501048_0091078 3300049582 Bacteria 2151
309 Ga0501067_0009580 3300049583 Bacteria 5365
310 Ga0501069_0015521 3300049585 Bacteria 4084
311 Ga0501072_0221136 3300049588 Bacteria 1509
312 Ga0501035_0257564 3300049822 Bacteria 1480
313 Ga0501044_0004181 3300049823 Bacteria 16227
314 nmdc:mga05p37_1176_c1 3300050507 Bacteria 30185
315 nmdc:mga05p37_13837_c1 3300050507 Bacteria 9667
316 nmdc:mga09592_21265_c1 3300050508 Bacteria 5347
317 nmdc:mga09592_25072_c1 3300050508 Bacteria 4934
318 nmdc:mga09592_321134_c1 3300050508 Bacteria 1341
319 nmdc:mga0qj67_74737_c1 3300050509 Bacteria 2708
320 nmdc:mga06r32_37034_c1 3300050510 Bacteria 4614
321 nmdc:mga06r32_72463_c1 3300050510 Bacteria 3335
322 nmdc:mga08y16_22800_c1 3300050511 Bacteria 6607
323 nmdc:mga08y16_329773_c1 3300050511 Unclassified 1570
324 nmdc:mga0a205_29434_c1 3300050515 Bacteria 5255
325 Ga0500578_0052230 3300053086 Bacteria 2618
326 Ga0500583_0000122 3300053092 Bacteria 36660
327 Ga0500604_0025966 3300053151 Unclassified 1686
328 Ga0500622_0024229 3300053156 Bacteria 3210
329 Ga0466962_0012547 3300061719 Bacteria 4075
330 Ga0530510_0201628 3300061734 Bacteria 1478
331 2738730031 2738541278 Bacteria 9755573
332 Ga0500578_0000024
333 rootH2_10049481
334 rootH2_10132053
335 rootH1_10006977
336 rootH1_10096535
337 Ga0070676_10042177
338 Ga0070683_100029539
339 Ga0070683_100072554
340 Ga0070670_100072488
341 Ga0070670_100129010
342 Ga0070670_100155474
343 Ga0068869_100041730
344 Ga0068869_100117946
345 Ga0068869_100185073
346 Ga0070666_10010917
347 Ga0070666_10094246
348 Ga0070682_100051453
349 Ga0068868_100085294
350 Ga0070660_100061902
351 Ga0070689_100128161
352 Ga0070668_100044002
353 Ga0070668_100059722
354 Ga0070668_100059897
355 Ga0070669_100054294
356 Ga0070675_100012317
357 Ga0070675_100060880
358 Ga0070673_100003940
359 Ga0070673_100012390
360 Ga0070673_100111033
361 Ga0070688_100003740
362 Ga0070659_100042687
363 Ga0070667_100073817
364 Ga0070700_100189278
365 Ga0070708_100047850
366 Ga0070678_100025209
367 Ga0070662_100027676
368 Ga0070706_100138747
369 Ga0070698_100008358
370 Ga0070698_100196842
371 Ga0070698_100326773
372 Ga0070699_100033283
373 Ga0070679_100012329
374 Ga0070684_100014418
375 Ga0070684_100018387
376 Ga0070697_100012673
377 Ga0068853_100001343
378 Ga0068853_100065383
379 Ga0068853_100072235
380 Ga0068853_100113272
381 Ga0068853_100359492
382 Ga0070695_100014921
383 Ga0070695_100069907
384 Ga0070695_100087783
385 Ga0070696_100018447
386 Ga0070696_100086204
387 Ga0070665_100001425
388 Ga0070704_100036657
389 Ga0068855_100000630
390 Ga0068855_100037238
391 Ga0068855_100037672
392 Ga0068855_100098296
393 Ga0070664_100134259
394 Ga0068857_100004171
395 Ga0068857_100058126
396 Ga0068854_100069907
397 Ga0068854_100101573
398 Ga0068856_100217060
399 Ga0068852_100011415
400 Ga0068852_100120953
401 Ga0068859_100386781
402 Ga0068864_100069753
403 Ga0068861_100006797
404 Ga0068861_100013945
405 Ga0068870_10029939
406 Ga0068870_10037546
407 Ga0068863_100035472
408 Ga0068860_100000029
409 Ga0068860_100003906
410 Ga0068860_100017189
411 Ga0068860_100031293
412 Ga0068860_100201535
413 Ga0068862_100013235
414 Ga0068862_100025051
415 Ga0068862_100111386
416 Ga0081539_10027587
417 Ga0068871_100054329
418 Ga0068871_100094521
419 Ga0075428_100016346
420 Ga0075428_100018798
421 Ga0075428_100059356
422 Ga0075431_100026148
423 Ga0075429_100031585
424 Ga0075429_100092304
425 Ga0075429_100242403
426 Ga0068865_100110737
427 Ga0097620_100386796
428 Ga0105240_10001435
429 Ga0105240_10001517
430 Ga0105240_10002716
431 Ga0105240_10002823
432 Ga0105240_10015666
433 Ga0105240_10021041
434 Ga0105240_10081433
435 Ga0105240_10104936
436 Ga0111539_10005858
437 Ga0114129_10001177
438 Ga0114129_10121930
439 Ga0105243_10398388
440 Ga0105241_10000801
441 Ga0105241_10008168
442 Ga0105241_10103912
443 Ga0105241_10153762
444 Ga0105242_10056672
445 Ga0105237_10003140
446 Ga0105237_10005413
447 Ga0105237_10018813
448 Ga0105237_10023757
449 Ga0105237_10027549
450 Ga0105237_10131036
451 Ga0105237_10261811
452 Ga0105238_10006137
453 Ga0105238_10032732
454 Ga0105249_10002979
455 Ga0105249_10011892
456 Ga0105249_10015498
457 Ga0105249_10028006
458 Ga0105239_10000048
459 Ga0105239_10000863
460 Ga0105239_10003203
461 Ga0105239_10008174
462 Ga0105239_10153535
463 Ga0105239_10165432
464 Ga0157373_10004686
465 Ga0157373_10050229
466 Ga0157371_10021718
467 Ga0157370_10002875
468 Ga0157370_10004121
469 Ga0157370_10017507
470 Ga0157370_10047147
471 Ga0157369_10012667
472 Ga0157369_10025207
473 Ga0157369_10134152
474 Ga0157374_10000001
475 Ga0157378_10029071
476 Ga0157378_10304990
477 Ga0163162_10000038
478 Ga0163162_10054605
479 Ga0163162_10065768
480 Ga0157372_10000596
481 Ga0157372_10002035
482 Ga0157372_10551032
483 Ga0157375_10093191
484 Ga0157375_10480215
485 Ga0157375_10527082
486 Ga0163163_10100874
487 Ga0163163_10275970
488 Ga0157380_10001009
489 Ga0157380_10197852
490 Ga0157377_10002331
491 Ga0157379_10004872
492 Ga0157376_10002300
493 Ga0157376_10073364
494 Ga0157376_10182585
495 Ga0157376_10291910
496 Ga0206352_11195613
497 Ga0207653_10009024
498 Ga0207710_10000852
499 Ga0207688_10006945
500 Ga0207645_10001579
501 Ga0207645_10042095
502 Ga0207643_10012158
503 Ga0207705_10085369
504 Ga0207654_10012613
505 Ga0207695_10000023
506 Ga0207695_10000110
507 Ga0207695_10000229
508 Ga0207695_10001408
509 Ga0207695_10007565
510 Ga0207695_10011405
511 Ga0207695_10025984
512 Ga0207695_10146043
513 Ga0207671_10002462
514 Ga0207671_10005499
515 Ga0207671_10013408
516 Ga0207671_10021960
517 Ga0207671_10022391
518 Ga0207671_10139433
519 Ga0207660_10285977
520 Ga0207657_10079916
521 Ga0207649_10081890
522 Ga0207646_10008332
523 Ga0207646_10012308
524 Ga0207681_10065240
525 Ga0207694_10032074
526 Ga0207694_10124260
527 Ga0207650_10081324
528 Ga0207650_10082114
529 Ga0207659_10011139
530 Ga0207659_10052219
531 Ga0207690_10100756
532 Ga0207706_10004345
533 Ga0207686_10000956
534 Ga0207670_10139781
535 Ga0207691_10030171
536 Ga0207691_10080771
537 Ga0207691_10320169
538 Ga0207689_10015850
539 Ga0207689_10020109
540 Ga0207689_10022438
541 Ga0207689_10032139
542 Ga0207689_10087261
543 Ga0207661_10023156
544 Ga0207679_10056832
545 Ga0207667_10000700
546 Ga0207667_10000791
547 Ga0207667_10016480
548 Ga0207667_10019225
549 Ga0207667_10035184
550 Ga0207667_10068860
551 Ga0207712_10002195
552 Ga0207712_10042119
553 Ga0207640_10371818
554 Ga0207658_10137385
555 Ga0207677_10018033
556 Ga0207677_10160836
557 Ga0207639_10011306
558 Ga0207639_10034823
559 Ga0207639_10056429
560 Ga0207639_10195273
561 Ga0207708_10106878
562 Ga0207702_10014437
563 Ga0207702_10067414
564 Ga0207641_10030181
565 Ga0207641_10051906
566 Ga0207641_10336682
567 Ga0207641_10440929
568 Ga0207648_10001165
569 Ga0207648_10231894
570 Ga0207676_10449067
571 Ga0207674_10009204
572 Ga0207674_10020666
573 Ga0207674_10066147
574 Ga0207674_10083870
575 Ga0207675_100001010
576 Ga0207675_100064194
577 Ga0207675_100194412
578 Ga0207675_100371834
579 Ga0207683_10031586
580 Ga0207698_10075417
581 Ga0207698_10174265
582 Ga0207428_10019203
583 Ga0268266_10050957
584 Ga0268265_10017994
585 Ga0268265_10107948
586 Ga0268265_10456567
587 Ga0268264_10000072
588 Ga0268264_10033350
589 Ga0268264_10039638
590 Ga0268264_10149434
591 Ga0307511_10000353
592 Ga0265320_10084002
593 Ga0307513_10225529
594 Ga0307513_10238251
595 Ga0307509_10139860
596 Ga0307516_10100454
597 Ga0373954_0005243
598 Ga0373956_0019333
599 Ga0373933_0065336
600 Ga0373937_0104240
601 Ga0451791_1905626
602 Ga0451798_1086472
603 Ga0439431_0016035
604 Ga0439442_015602
605 Ga0450898_002180
606 Ga0439434_0035013
607 Ga0466969_0000051
608 Ga0466972_0000235
609 Ga0466972_0021143
610 Ga0466961_0067967
611 Ga0453684_0037941
612 Ga0466957_0005831
613 Ga0466957_0007403
614 Ga0466957_0044959
615 Ga0466959_0000264
616 Ga0466959_0085327
617 Ga0451576_0004708
618 Ga0466958_0181608
619 Ga0466967_0069842
620 Ga0495650_0017823
621 Ga0495668_0000639
622 Ga0495625_0192784
623 Ga0495672_0092649
624 Ga0495687_000004
625 Ga0496102_0002147
626 Ga0496103_0035981
627 Ga0496104_0016406
628 Ga0496105_0025987
629 Ga0496106_0074118
630 Ga0496107_0023378
631 Ga0496107_0263140
632 Ga0496108_0010923
633 Ga0496111_0016746
634 Ga0496126_0217929
635 Ga0501043_0291904
636 Ga0501047_0027376
637 Ga0501047_0033610
638 Ga0501047_0115321
639 Ga0501048_0091078
640 Ga0501067_0009580
641 Ga0501069_0015521
642 Ga0501072_0221136
643 Ga0501035_0257564
644 Ga0501044_0004181
645 nmdc:mga05p37_1176_c1
646 nmdc:mga05p37_13837_c1
647 nmdc:mga09592_21265_c1
648 nmdc:mga09592_25072_c1
649 nmdc:mga09592_321134_c1
650 nmdc:mga0qj67_74737_c1
651 nmdc:mga06r32_37034_c1
652 nmdc:mga06r32_72463_c1
653 nmdc:mga08y16_22800_c1
654 nmdc:mga08y16_329773_c1
655 nmdc:mga0a205_29434_c1
656 Ga0500578_0052230
657 Ga0500583_0000122
658 Ga0500604_0025966
659 Ga0500622_0024229
660 Ga0466962_0012547
661 Ga0530510_0201628
662 2738730031

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF15899

BNR_6

BNR-Asp box repeat

90

103

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3b7f-assembly1.cif.gz_A crystal structure of a putative glycosyl hydrolase with bnr repeats (reut_b4987) from ralstonia eutropha jmp134 at 2.20 a resolution 0.9185 2 351
3b7f-assembly1.cif.gz_A crystal structure of a putative glycosyl hydrolase with bnr repeats (reut_b4987) from ralstonia eutropha jmp134 at 2.20 a resolution 0.901 2 351
5t2a-assembly1.cif.gz_7 cryoem structure of the leishmania donovani 80s ribosome at 2.9 angstrom resolution 0.7863 2 264
8a3w-assembly1.cif.gz_Sg cryo-em structure of leishmania major 80s ribosome : wild type 0.743 3 332
1u4c-assembly1.cif.gz_A structure of spindle checkpoint protein bub3 0.7405 2 326
ID Description Score Start End Superfamily
3b7fA00 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9101 2 351 2.130.10.10
3b7fA00 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8757 2 351 2.130.10.10
af_O16318_194_311_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.765 29 176 2.130.10.10
af_A0A1D6LLW6_250_394_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7577 1 174 2.130.10.10
af_P34529_1834_1897_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.7538 29 61 3.30.160.20
ID Description Score Start End GO Terms
AF-A0A3B8IFU9-F1-model_v4 Glycosyl hydrolase 0.9918 201 356 GO:0016787
AF-A0A3B9XSY9-F1-model_v4 Glycosyl hydrolase 0.9896 229 354
AF-A0A522DGF9-F1-model_v4 Glycosyl hydrolase 0.9867 228 356 GO:0016787
AF-A0A7V7X9P6-F1-model_v4 deleted 0.9866 258 354
AF-A0A535S0R6-F1-model_v4 Exo-alpha-sialidase 0.9819 253 356

Map