F410686

General Info

Members Datasets Scaffolds Average Seq Length
331 173 662 191

Family's Representative Sequence

Representative Sequence 3300049576|Ga0501040_0148137|Ga0501040_0148137_34_717
Length 227
Sequence VSSVRSSLSFDDGALNIENEPGGIMKLIIKSVRPILFAALFSALGASAAYGQNAKLQIDNLDKFNSTASEMVDVTVDERLLQLAAKFLNPKRSPDEAKIKELIEGLKGVFVKRFGFEQEGQFTDADVEAIRSQLRDPSWSRIVGVRSKKKTTINIDVYIMSEGAIIKGLAVLAVEPKALTVVNVVGPIDIEKLSQLEGKFGIPRLDLITGPDTGEKPAEKKPPDNHE

Samples

Sample ID Description Type Environment
1 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
159 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
167 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
172 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
173 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.11
Rhizosphere 96.07
Stem 0
Stem Tuber 0
Unclassified 26.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501040_0148137 3300049576 Bacteria 1655
2 SwRhRL3b_contig_4565215 2162886006 Bacteria 2042
3 SwRhRL2b_contig_3938580 2162886007 Bacteria 2553
4 JGI25406J46586_10001078 3300003203 Bacteria 12800
5 Ga0065704_10004253 3300005289 Bacteria 4850
6 Ga0065704_10195751 3300005289 Bacteria 1168
7 Ga0065704_10203913 3300005289 Bacteria 1135
8 Ga0065712_10077168 3300005290 Unclassified 3539
9 Ga0065715_10096666 3300005293 Bacteria 3843
10 Ga0065715_10157752 3300005293 Bacteria 1647
11 Ga0065715_10195391 3300005293 Archaea 1328
12 Ga0065715_10278190 3300005293 Bacteria 1091
13 Ga0065707_10006317 3300005295 Bacteria 4196
14 Ga0065707_10273286 3300005295 Unclassified 1066
15 Ga0070690_100023978 3300005330 Unclassified 3749
16 Ga0070690_100167022 3300005330 Bacteria 1512
17 Ga0070670_100218393 3300005331 Bacteria 1658
18 Ga0070670_100510478 3300005331 Bacteria 1070
19 Ga0070670_100811782 3300005331 Unclassified 845
20 Ga0070677_10326851 3300005333 Bacteria 787
21 Ga0068869_100003718 3300005334 Bacteria 9389
22 Ga0068869_100028712 3300005334 Bacteria 3891
23 Ga0068869_100117202 3300005334 Bacteria 2032
24 Ga0068869_100228198 3300005334 Bacteria 1479
25 Ga0068869_100353261 3300005334 Unclassified 1199
26 Ga0070666_10070922 3300005335 Bacteria 2371
27 Ga0070666_10187221 3300005335 Bacteria 1453
28 Ga0070680_100966661 3300005336 Unclassified 735
29 Ga0068868_100203478 3300005338 Bacteria 1652
30 Ga0070689_100051283 3300005340 Bacteria 3189
31 Ga0070691_10242366 3300005341 Unclassified 964
32 Ga0070687_100023918 3300005343 Bacteria 2909
33 Ga0070692_10319006 3300005345 Unclassified 955
34 Ga0070669_100009356 3300005353 Bacteria 6980
35 Ga0070669_100070701 3300005353 Bacteria 2580
36 Ga0070675_100013611 3300005354 Bacteria 6398
37 Ga0070675_100447239 3300005354 Bacteria 1158
38 Ga0070671_100024225 3300005355 Unclassified 4967
39 Ga0070671_100042270 3300005355 Bacteria 3788
40 Ga0070671_100425449 3300005355 Bacteria 1138
41 Ga0070674_100818206 3300005356 Bacteria 806
42 Ga0070673_100086996 3300005364 Viruses 2547
43 Ga0070673_100092812 3300005364 Unclassified 2470
44 Ga0070673_100494301 3300005364 Bacteria 1106
45 Ga0070688_100095489 3300005365 Bacteria 1951
46 Ga0070667_100057747 3300005367 Bacteria 3280
47 Ga0070701_10210497 3300005438 Bacteria 1154
48 Ga0070705_100138933 3300005440 Bacteria 1596
49 Ga0070705_100196671 3300005440 Bacteria 1379
50 Ga0070705_100330324 3300005440 Bacteria 1104
51 Ga0070705_100419393 3300005440 Unclassified 996
52 Ga0070705_100823915 3300005440 Unclassified 740
53 Ga0070700_100563088 3300005441 Unclassified 887
54 Ga0070694_100268871 3300005444 Bacteria 1296
55 Ga0070694_100286359 3300005444 Bacteria 1258
56 Ga0070708_100806634 3300005445 Unclassified 882
57 Ga0070678_100034854 3300005456 Bacteria 3508
58 Ga0070662_100068934 3300005457 Unclassified 2601
59 Ga0070681_10132467 3300005458 Bacteria 2425
60 Ga0068867_100007939 3300005459 Bacteria 7496
61 Ga0068867_100030576 3300005459 Bacteria 3884
62 Ga0070685_10207920 3300005466 Bacteria 1276
63 Ga0070706_100000691 3300005467 Bacteria 38197
64 Ga0070706_100041914 3300005467 Bacteria 4228
65 Ga0070706_100475399 3300005467 Unclassified 1163
66 Ga0070706_100774195 3300005467 Unclassified 889
67 Ga0070707_100000228 3300005468 Bacteria 56180
68 Ga0070707_100017151 3300005468 Bacteria 6804
69 Ga0070707_100061766 3300005468 Bacteria 3594
70 Ga0070707_100197296 3300005468 Bacteria 1962
71 Ga0070707_100507312 3300005468 Bacteria 1168
72 Ga0070698_100017435 3300005471 Bacteria 7570
73 Ga0070698_100027610 3300005471 Bacteria 5900
74 Ga0070698_100064573 3300005471 Unclassified 3687
75 Ga0070698_100216826 3300005471 Bacteria 1848
76 Ga0070698_100280860 3300005471 Unclassified 1596
77 Ga0070698_100718537 3300005471 Bacteria 942
78 Ga0070698_100734649 3300005471 Unclassified 930
79 Ga0070699_100019221 3300005518 Bacteria 5879
80 Ga0070699_100136399 3300005518 Bacteria 2165
81 Ga0070699_100211720 3300005518 Bacteria 1725
82 Ga0070679_100116090 3300005530 Bacteria 2662
83 Ga0070697_100075405 3300005536 Bacteria 2772
84 Ga0070697_100095248 3300005536 Bacteria 2468
85 Ga0070697_100787954 3300005536 Unclassified 841
86 Ga0070672_100609472 3300005543 Unclassified 951
87 Ga0070686_100178365 3300005544 Bacteria 1508
88 Ga0070695_100160858 3300005545 Bacteria 1576
89 Ga0070693_100103537 3300005547 Unclassified 1738
90 Ga0070693_100104861 3300005547 Bacteria 1729
91 Ga0070693_100360980 3300005547 Unclassified 997
92 Ga0070665_100021902 3300005548 Bacteria 6427
93 Ga0070704_100006823 3300005549 Bacteria 6760
94 Ga0070704_100118813 3300005549 Bacteria 2026
95 Ga0070704_100742710 3300005549 Unclassified 873
96 Ga0070704_100743866 3300005549 Bacteria 872
97 Ga0070664_100491601 3300005564 Bacteria 1130
98 Ga0068857_100193953 3300005577 Bacteria 1850
99 Ga0068857_100207409 3300005577 Bacteria 1787
100 Ga0068857_100219529 3300005577 Bacteria 1736
101 Ga0068857_100250753 3300005577 Bacteria 1623
102 Ga0068857_100935328 3300005577 Bacteria 832
103 Ga0068857_101689540 3300005577 Unclassified 619
104 Ga0068854_100687795 3300005578 Unclassified 882
105 Ga0070702_100023590 3300005615 Bacteria 3272
106 Ga0070702_100029187 3300005615 Unclassified 2997
107 Ga0070702_100201142 3300005615 Bacteria 1319
108 Ga0068852_100575952 3300005616 Bacteria 1128
109 Ga0068859_100016651 3300005617 Bacteria 7380
110 Ga0068859_100084640 3300005617 Unclassified 3216
111 Ga0068859_100175783 3300005617 Bacteria 2223
112 Ga0068859_100894424 3300005617 Unclassified 973
113 Ga0068864_100010812 3300005618 Bacteria 7540
114 Ga0068864_100189715 3300005618 Bacteria 1884
115 Ga0068864_100302104 3300005618 Bacteria 1499
116 Ga0068864_100334082 3300005618 Bacteria 1426
117 Ga0068864_100406344 3300005618 Bacteria 1295
118 Ga0068864_100611713 3300005618 Bacteria 1058
119 Ga0068866_10036757 3300005718 Bacteria 2401
120 Ga0068861_100272279 3300005719 Bacteria 1454
121 Ga0068870_10022779 3300005840 Bacteria 3081
122 Ga0068870_10057425 3300005840 Bacteria 2080
123 Ga0068863_100069469 3300005841 Bacteria 3330
124 Ga0068863_100079033 3300005841 Bacteria 3115
125 Ga0068863_100082081 3300005841 Bacteria 3054
126 Ga0068863_100205484 3300005841 Bacteria 1895
127 Ga0068863_100276602 3300005841 Bacteria 1626
128 Ga0068858_100058049 3300005842 Bacteria 3577
129 Ga0068858_100470459 3300005842 Bacteria 1212
130 Ga0068860_100184059 3300005843 Bacteria 2019
131 Ga0068860_100380049 3300005843 Bacteria 1394
132 Ga0081539_10000476 3300005985 Bacteria 84955
133 Ga0081539_10032551 3300005985 Bacteria 3191
134 Ga0075432_10040697 3300006058 Bacteria 1622
135 Ga0070715_10000035 3300006163 Bacteria 78855
136 Ga0070716_100000011 3300006173 Bacteria 143884
137 Ga0070716_100110595 3300006173 Bacteria 1702
138 Ga0097621_100053015 3300006237 Bacteria 3305
139 Ga0097621_100300860 3300006237 Bacteria 1417
140 Ga0097621_100442616 3300006237 Bacteria 1169
141 Ga0068871_100206292 3300006358 Bacteria 1698
142 Ga0068871_100264213 3300006358 Bacteria 1502
143 Ga0068871_100322075 3300006358 Bacteria 1361
144 Ga0068871_100500094 3300006358 Bacteria 1095
145 Ga0075428_100794184 3300006844 Unclassified 1006
146 Ga0075430_100071628 3300006846 Unclassified 2907
147 Ga0075431_100956545 3300006847 Unclassified 824
148 Ga0075433_10052942 3300006852 Bacteria 3537
149 Ga0075433_10106910 3300006852 Bacteria 2480
150 Ga0075433_10122685 3300006852 Unclassified 2308
151 Ga0075429_100078396 3300006880 Unclassified 2879
152 Ga0068865_100179949 3300006881 Bacteria 1627
153 Ga0075436_100516169 3300006914 Unclassified 875
154 Ga0097620_100016651 3300006931 Bacteria 7380
155 Ga0097620_100084641 3300006931 Unclassified 3216
156 Ga0097620_100175783 3300006931 Bacteria 2223
157 Ga0097620_100894473 3300006931 Unclassified 973
158 Ga0099794_10037817 3300007265 Bacteria 2286
159 Ga0105251_10129225 3300009011 Bacteria 1145
160 Ga0105240_10268129 3300009093 Bacteria 1967
161 Ga0111539_10000227 3300009094 Bacteria 67567
162 Ga0111539_10319224 3300009094 Bacteria 1808
163 Ga0105245_10158590 3300009098 Unclassified 2145
164 Ga0105245_10759030 3300009098 Unclassified 1006
165 Ga0105245_11203206 3300009098 Unclassified 806
166 Ga0105245_11468535 3300009098 Unclassified 732
167 Ga0105247_10113480 3300009101 Bacteria 1747
168 Ga0114129_10078527 3300009147 Bacteria 4591
169 Ga0114129_10399593 3300009147 Unclassified 1811
170 Ga0114129_10513132 3300009147 Unclassified 1564
171 Ga0105243_10039298 3300009148 Bacteria 3687
172 Ga0105243_10042131 3300009148 Bacteria 3573
173 Ga0105243_10043236 3300009148 Unclassified 3530
174 Ga0105241_10085785 3300009174 Unclassified 2475
175 Ga0105242_10135954 3300009176 Bacteria 2127
176 Ga0105248_10063890 3300009177 Bacteria 4132
177 Ga0105248_10084685 3300009177 Bacteria 3566
178 Ga0105248_10144384 3300009177 Bacteria 2685
179 Ga0105237_10180030 3300009545 Bacteria 2114
180 Ga0105238_10032971 3300009551 Bacteria 5271
181 Ga0105249_10055572 3300009553 Bacteria 3622
182 Ga0105249_11289892 3300009553 Unclassified 802
183 Ga0105239_10169466 3300010375 Bacteria 2441
184 Ga0105246_10242043 3300011119 Unclassified 1427
185 Ga0105246_10427423 3300011119 Bacteria 1107
186 Ga0157374_10305119 3300013296 Bacteria 1575
187 Ga0157378_10056783 3300013297 Unclassified 3489
188 Ga0157378_10149424 3300013297 Bacteria 2176
189 Ga0157378_10406994 3300013297 Bacteria 1342
190 Ga0157378_10496469 3300013297 Bacteria 1218
191 Ga0163162_10119757 3300013306 Bacteria 2735
192 Ga0163162_10148196 3300013306 Bacteria 2464
193 Ga0157375_11142668 3300013308 Unclassified 912
194 Ga0163163_10000674 3300014325 Bacteria 29178
195 Ga0163163_10083546 3300014325 Unclassified 3198
196 Ga0163163_10199044 3300014325 Bacteria 2052
197 Ga0163163_10285708 3300014325 Bacteria 1702
198 Ga0163163_11089673 3300014325 Unclassified 862
199 Ga0157380_10260204 3300014326 Bacteria 1576
200 Ga0157377_10024111 3300014745 Unclassified 3231
201 Ga0157377_10053516 3300014745 Bacteria 2283
202 Ga0157379_10166791 3300014968 Bacteria 1988
203 Ga0157376_10007435 3300014969 Bacteria 7822
204 Ga0157376_10053857 3300014969 Bacteria 3352
205 Ga0157376_11037210 3300014969 Unclassified 844
206 Ga0163161_10150911 3300017792 Bacteria 1766
207 Ga0213876_10000117 3300021384 Bacteria 86431
208 Ga0213876_10000273 3300021384 Bacteria 47748
209 Ga0213876_10081265 3300021384 Unclassified 1714
210 Ga0207697_10025925 3300025315 Bacteria 2396
211 Ga0207713_1066283 3300025735 Bacteria 1352
212 Ga0207642_10112407 3300025899 Bacteria 1389
213 Ga0207710_10032233 3300025900 Bacteria 2295
214 Ga0207680_10098189 3300025903 Bacteria 1877
215 Ga0207685_10000019 3300025905 Bacteria 145568
216 Ga0207643_10034448 3300025908 Bacteria 2837
217 Ga0207643_10194964 3300025908 Bacteria 1231
218 Ga0207684_10036882 3300025910 Unclassified 4149
219 Ga0207684_10096527 3300025910 Bacteria 2523
220 Ga0207684_10277154 3300025910 Bacteria 1447
221 Ga0207654_10064083 3300025911 Unclassified 2159
222 Ga0207695_10906747 3300025913 Unclassified 761
223 Ga0207662_10096478 3300025918 Unclassified 1826
224 Ga0207646_10001166 3300025922 Bacteria 33336
225 Ga0207646_10085987 3300025922 Bacteria 2813
226 Ga0207646_10115612 3300025922 Unclassified 2410
227 Ga0207646_10139170 3300025922 Bacteria 2186
228 Ga0207646_10169941 3300025922 Bacteria 1969
229 Ga0207681_10418062 3300025923 Bacteria 1086
230 Ga0207650_10005800 3300025925 Bacteria 8428
231 Ga0207650_10277607 3300025925 Bacteria 1363
232 Ga0207650_10370490 3300025925 Bacteria 1181
233 Ga0207650_10718622 3300025925 Unclassified 844
234 Ga0207659_10187873 3300025926 Bacteria 1642
235 Ga0207687_10236356 3300025927 Bacteria 1446
236 Ga0207644_10051406 3300025931 Bacteria 2958
237 Ga0207644_10569938 3300025931 Unclassified 938
238 Ga0207706_10078944 3300025933 Unclassified 2895
239 Ga0207686_10072512 3300025934 Unclassified 2219
240 Ga0207686_10373609 3300025934 Bacteria 1079
241 Ga0207709_10022703 3300025935 Unclassified 3562
242 Ga0207709_10023496 3300025935 Bacteria 3509
243 Ga0207709_10187302 3300025935 Bacteria 1467
244 Ga0207670_10053704 3300025936 Bacteria 2716
245 Ga0207670_10165952 3300025936 Bacteria 1652
246 Ga0207670_10441973 3300025936 Unclassified 1047
247 Ga0207669_10122823 3300025937 Bacteria 1767
248 Ga0207669_10236713 3300025937 Bacteria 1351
249 Ga0207665_10000057 3300025939 Bacteria 73138
250 Ga0207665_10025336 3300025939 Bacteria 3913
251 Ga0207691_10039256 3300025940 Unclassified 4379
252 Ga0207711_10121130 3300025941 Bacteria 2336
253 Ga0207711_10258369 3300025941 Viruses 1600
254 Ga0207689_10002280 3300025942 Bacteria 17952
255 Ga0207689_10061241 3300025942 Bacteria 3094
256 Ga0207689_10166916 3300025942 Bacteria 1814
257 Ga0207689_10329233 3300025942 Unclassified 1268
258 Ga0207679_10907259 3300025945 Bacteria 806
259 Ga0207651_10065726 3300025960 Unclassified 2545
260 Ga0207651_10548626 3300025960 Bacteria 1005
261 Ga0207712_10083448 3300025961 Bacteria 2332
262 Ga0207712_10499460 3300025961 Bacteria 1040
263 Ga0207640_10270163 3300025981 Bacteria 1330
264 Ga0207658_10216652 3300025986 Bacteria 1608
265 Ga0207658_10430625 3300025986 Bacteria 1165
266 Ga0207677_10243923 3300026023 Bacteria 1455
267 Ga0207703_10600238 3300026035 Bacteria 1041
268 Ga0207703_11114765 3300026035 Viruses 758
269 Ga0207678_11381635 3300026067 Unclassified 623
270 Ga0207641_10035696 3300026088 Bacteria 4145
271 Ga0207641_10053871 3300026088 Bacteria 3412
272 Ga0207641_10073680 3300026088 Unclassified 2943
273 Ga0207641_10091530 3300026088 Bacteria 2662
274 Ga0207641_10243719 3300026088 Bacteria 1676
275 Ga0207641_10934316 3300026088 Unclassified 862
276 Ga0207641_11334846 3300026088 Bacteria 718
277 Ga0207648_10016881 3300026089 Bacteria 6656
278 Ga0207648_10156428 3300026089 Unclassified 2012
279 Ga0207648_10302674 3300026089 Bacteria 1434
280 Ga0207676_10016923 3300026095 Bacteria 5279
281 Ga0207676_10223551 3300026095 Bacteria 1678
282 Ga0207676_10417503 3300026095 Bacteria 1257
283 Ga0207674_10170388 3300026116 Bacteria 2130
284 Ga0207674_10172661 3300026116 Bacteria 2115
285 Ga0207674_10260027 3300026116 Bacteria 1683
286 Ga0207674_10547943 3300026116 Bacteria 1117
287 Ga0207674_10616402 3300026116 Bacteria 1048
288 Ga0207675_100029897 3300026118 Bacteria 5072
289 Ga0207675_101151404 3300026118 Unclassified 796
290 Ga0207683_10079174 3300026121 Bacteria 2913
291 Ga0207698_10269449 3300026142 Bacteria 1569
292 Ga0209588_1162224 3300027671 Unclassified 705
293 Ga0207428_10009215 3300027907 Bacteria 8868
294 Ga0268265_10041463 3300028380 Unclassified 3407
295 Ga0268265_11112152 3300028380 Bacteria 785
296 Ga0268264_10120728 3300028381 Bacteria 2309
297 Ga0268264_10478528 3300028381 Bacteria 1211
298 Ga0307408_100522461 3300031548 Bacteria 1043
299 Ga0307408_100837966 3300031548 Bacteria 837
300 Ga0307405_10806220 3300031731 Bacteria 787
301 Ga0307413_10431399 3300031824 Unclassified 1041
302 Ga0307416_100141471 3300032002 Bacteria 2188
303 Ga0373937_0116160 3300036401 Bacteria 2492
304 Ga0395900_0262088 3300037418 Bacteria 1726
305 Ga0395900_0276482 3300037418 Bacteria 1673
306 Ga0395898_0879237 3300037466 Bacteria 835
307 Ga0395901_0567010 3300038443 Bacteria 1149
308 Ga0242420_002624 3300038996 Unclassified 2584
309 Ga0436365_0037272 3300039437 Bacteria 3595
310 Ga0436365_0578117 3300039437 Bacteria 119375
311 Ga0436365_0886749 3300039437 Bacteria 47844
312 Ga0453683_0115088 3300044673 Bacteria 1692
313 Ga0495684_0734516 3300047471 Unclassified 651
314 Ga0496104_0620262 3300048907 Archaea 991
315 Ga0496105_0504234 3300048908 Unclassified 950
316 Ga0496108_1017585 3300048911 Unclassified 707
317 Ga0496110_0702072 3300048913 Unclassified 913
318 Ga0496112_0693923 3300048915 Unclassified 946
319 Ga0496112_0844596 3300048915 Bacteria 839
320 Ga0496113_0807296 3300048916 Unclassified 745
321 Ga0501225_0030237 3300049705 Unclassified 1490
322 Ga0501081_0340097 3300049743 Bacteria 1105
323 nmdc:mga09592_127103_c1 3300050508 Unclassified 2192
324 nmdc:mga0qj67_49022_c1 3300050509 Unclassified 3338
325 nmdc:mga08y16_588811_c1 3300050511 Bacteria 1122
326 nmdc:mga08y16_6445_c1 3300050511 Bacteria 12307
327 nmdc:mga0n895_1553818_c1 3300050512 Unclassified 627
328 nmdc:mga08x19_449734_c1 3300050514 Unclassified 907
329 nmdc:mga0a205_205637_c1 3300050515 Bacteria 1858
330 nmdc:mga0a205_726700_c1 3300050515 Bacteria 842
331 nmdc:mga0a205_787535_c1 3300050515 Archaea 799
332 Ga0501040_0148137
333 SwRhRL3b_contig_4565215
334 SwRhRL2b_contig_3938580
335 JGI25406J46586_10001078
336 Ga0065704_10004253
337 Ga0065704_10195751
338 Ga0065704_10203913
339 Ga0065712_10077168
340 Ga0065715_10096666
341 Ga0065715_10157752
342 Ga0065715_10195391
343 Ga0065715_10278190
344 Ga0065707_10006317
345 Ga0065707_10273286
346 Ga0070690_100023978
347 Ga0070690_100167022
348 Ga0070670_100218393
349 Ga0070670_100510478
350 Ga0070670_100811782
351 Ga0070677_10326851
352 Ga0068869_100003718
353 Ga0068869_100028712
354 Ga0068869_100117202
355 Ga0068869_100228198
356 Ga0068869_100353261
357 Ga0070666_10070922
358 Ga0070666_10187221
359 Ga0070680_100966661
360 Ga0068868_100203478
361 Ga0070689_100051283
362 Ga0070691_10242366
363 Ga0070687_100023918
364 Ga0070692_10319006
365 Ga0070669_100009356
366 Ga0070669_100070701
367 Ga0070675_100013611
368 Ga0070675_100447239
369 Ga0070671_100024225
370 Ga0070671_100042270
371 Ga0070671_100425449
372 Ga0070674_100818206
373 Ga0070673_100086996
374 Ga0070673_100092812
375 Ga0070673_100494301
376 Ga0070688_100095489
377 Ga0070667_100057747
378 Ga0070701_10210497
379 Ga0070705_100138933
380 Ga0070705_100196671
381 Ga0070705_100330324
382 Ga0070705_100419393
383 Ga0070705_100823915
384 Ga0070700_100563088
385 Ga0070694_100268871
386 Ga0070694_100286359
387 Ga0070708_100806634
388 Ga0070678_100034854
389 Ga0070662_100068934
390 Ga0070681_10132467
391 Ga0068867_100007939
392 Ga0068867_100030576
393 Ga0070685_10207920
394 Ga0070706_100000691
395 Ga0070706_100041914
396 Ga0070706_100475399
397 Ga0070706_100774195
398 Ga0070707_100000228
399 Ga0070707_100017151
400 Ga0070707_100061766
401 Ga0070707_100197296
402 Ga0070707_100507312
403 Ga0070698_100017435
404 Ga0070698_100027610
405 Ga0070698_100064573
406 Ga0070698_100216826
407 Ga0070698_100280860
408 Ga0070698_100718537
409 Ga0070698_100734649
410 Ga0070699_100019221
411 Ga0070699_100136399
412 Ga0070699_100211720
413 Ga0070679_100116090
414 Ga0070697_100075405
415 Ga0070697_100095248
416 Ga0070697_100787954
417 Ga0070672_100609472
418 Ga0070686_100178365
419 Ga0070695_100160858
420 Ga0070693_100103537
421 Ga0070693_100104861
422 Ga0070693_100360980
423 Ga0070665_100021902
424 Ga0070704_100006823
425 Ga0070704_100118813
426 Ga0070704_100742710
427 Ga0070704_100743866
428 Ga0070664_100491601
429 Ga0068857_100193953
430 Ga0068857_100207409
431 Ga0068857_100219529
432 Ga0068857_100250753
433 Ga0068857_100935328
434 Ga0068857_101689540
435 Ga0068854_100687795
436 Ga0070702_100023590
437 Ga0070702_100029187
438 Ga0070702_100201142
439 Ga0068852_100575952
440 Ga0068859_100016651
441 Ga0068859_100084640
442 Ga0068859_100175783
443 Ga0068859_100894424
444 Ga0068864_100010812
445 Ga0068864_100189715
446 Ga0068864_100302104
447 Ga0068864_100334082
448 Ga0068864_100406344
449 Ga0068864_100611713
450 Ga0068866_10036757
451 Ga0068861_100272279
452 Ga0068870_10022779
453 Ga0068870_10057425
454 Ga0068863_100069469
455 Ga0068863_100079033
456 Ga0068863_100082081
457 Ga0068863_100205484
458 Ga0068863_100276602
459 Ga0068858_100058049
460 Ga0068858_100470459
461 Ga0068860_100184059
462 Ga0068860_100380049
463 Ga0081539_10000476
464 Ga0081539_10032551
465 Ga0075432_10040697
466 Ga0070715_10000035
467 Ga0070716_100000011
468 Ga0070716_100110595
469 Ga0097621_100053015
470 Ga0097621_100300860
471 Ga0097621_100442616
472 Ga0068871_100206292
473 Ga0068871_100264213
474 Ga0068871_100322075
475 Ga0068871_100500094
476 Ga0075428_100794184
477 Ga0075430_100071628
478 Ga0075431_100956545
479 Ga0075433_10052942
480 Ga0075433_10106910
481 Ga0075433_10122685
482 Ga0075429_100078396
483 Ga0068865_100179949
484 Ga0075436_100516169
485 Ga0097620_100016651
486 Ga0097620_100084641
487 Ga0097620_100175783
488 Ga0097620_100894473
489 Ga0099794_10037817
490 Ga0105251_10129225
491 Ga0105240_10268129
492 Ga0111539_10000227
493 Ga0111539_10319224
494 Ga0105245_10158590
495 Ga0105245_10759030
496 Ga0105245_11203206
497 Ga0105245_11468535
498 Ga0105247_10113480
499 Ga0114129_10078527
500 Ga0114129_10399593
501 Ga0114129_10513132
502 Ga0105243_10039298
503 Ga0105243_10042131
504 Ga0105243_10043236
505 Ga0105241_10085785
506 Ga0105242_10135954
507 Ga0105248_10063890
508 Ga0105248_10084685
509 Ga0105248_10144384
510 Ga0105237_10180030
511 Ga0105238_10032971
512 Ga0105249_10055572
513 Ga0105249_11289892
514 Ga0105239_10169466
515 Ga0105246_10242043
516 Ga0105246_10427423
517 Ga0157374_10305119
518 Ga0157378_10056783
519 Ga0157378_10149424
520 Ga0157378_10406994
521 Ga0157378_10496469
522 Ga0163162_10119757
523 Ga0163162_10148196
524 Ga0157375_11142668
525 Ga0163163_10000674
526 Ga0163163_10083546
527 Ga0163163_10199044
528 Ga0163163_10285708
529 Ga0163163_11089673
530 Ga0157380_10260204
531 Ga0157377_10024111
532 Ga0157377_10053516
533 Ga0157379_10166791
534 Ga0157376_10007435
535 Ga0157376_10053857
536 Ga0157376_11037210
537 Ga0163161_10150911
538 Ga0213876_10000117
539 Ga0213876_10000273
540 Ga0213876_10081265
541 Ga0207697_10025925
542 Ga0207713_1066283
543 Ga0207642_10112407
544 Ga0207710_10032233
545 Ga0207680_10098189
546 Ga0207685_10000019
547 Ga0207643_10034448
548 Ga0207643_10194964
549 Ga0207684_10036882
550 Ga0207684_10096527
551 Ga0207684_10277154
552 Ga0207654_10064083
553 Ga0207695_10906747
554 Ga0207662_10096478
555 Ga0207646_10001166
556 Ga0207646_10085987
557 Ga0207646_10115612
558 Ga0207646_10139170
559 Ga0207646_10169941
560 Ga0207681_10418062
561 Ga0207650_10005800
562 Ga0207650_10277607
563 Ga0207650_10370490
564 Ga0207650_10718622
565 Ga0207659_10187873
566 Ga0207687_10236356
567 Ga0207644_10051406
568 Ga0207644_10569938
569 Ga0207706_10078944
570 Ga0207686_10072512
571 Ga0207686_10373609
572 Ga0207709_10022703
573 Ga0207709_10023496
574 Ga0207709_10187302
575 Ga0207670_10053704
576 Ga0207670_10165952
577 Ga0207670_10441973
578 Ga0207669_10122823
579 Ga0207669_10236713
580 Ga0207665_10000057
581 Ga0207665_10025336
582 Ga0207691_10039256
583 Ga0207711_10121130
584 Ga0207711_10258369
585 Ga0207689_10002280
586 Ga0207689_10061241
587 Ga0207689_10166916
588 Ga0207689_10329233
589 Ga0207679_10907259
590 Ga0207651_10065726
591 Ga0207651_10548626
592 Ga0207712_10083448
593 Ga0207712_10499460
594 Ga0207640_10270163
595 Ga0207658_10216652
596 Ga0207658_10430625
597 Ga0207677_10243923
598 Ga0207703_10600238
599 Ga0207703_11114765
600 Ga0207678_11381635
601 Ga0207641_10035696
602 Ga0207641_10053871
603 Ga0207641_10073680
604 Ga0207641_10091530
605 Ga0207641_10243719
606 Ga0207641_10934316
607 Ga0207641_11334846
608 Ga0207648_10016881
609 Ga0207648_10156428
610 Ga0207648_10302674
611 Ga0207676_10016923
612 Ga0207676_10223551
613 Ga0207676_10417503
614 Ga0207674_10170388
615 Ga0207674_10172661
616 Ga0207674_10260027
617 Ga0207674_10547943
618 Ga0207674_10616402
619 Ga0207675_100029897
620 Ga0207675_101151404
621 Ga0207683_10079174
622 Ga0207698_10269449
623 Ga0209588_1162224
624 Ga0207428_10009215
625 Ga0268265_10041463
626 Ga0268265_11112152
627 Ga0268264_10120728
628 Ga0268264_10478528
629 Ga0307408_100522461
630 Ga0307408_100837966
631 Ga0307405_10806220
632 Ga0307413_10431399
633 Ga0307416_100141471
634 Ga0373937_0116160
635 Ga0395900_0262088
636 Ga0395900_0276482
637 Ga0395898_0879237
638 Ga0395901_0567010
639 Ga0242420_002624
640 Ga0436365_0037272
641 Ga0436365_0578117
642 Ga0436365_0886749
643 Ga0453683_0115088
644 Ga0495684_0734516
645 Ga0496104_0620262
646 Ga0496105_0504234
647 Ga0496108_1017585
648 Ga0496110_0702072
649 Ga0496112_0693923
650 Ga0496112_0844596
651 Ga0496113_0807296
652 Ga0501225_0030237
653 Ga0501081_0340097
654 nmdc:mga09592_127103_c1
655 nmdc:mga0qj67_49022_c1
656 nmdc:mga08y16_588811_c1
657 nmdc:mga08y16_6445_c1
658 nmdc:mga0n895_1553818_c1
659 nmdc:mga08x19_449734_c1
660 nmdc:mga0a205_205637_c1
661 nmdc:mga0a205_726700_c1
662 nmdc:mga0a205_787535_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14060

DUF4252

Domain of unknown function (DUF4252)

64

196

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qh7-assembly1.cif.gz_c cryo-em structure of the human mtlsu assembly intermediate upon mrm2 depletion - class 4 0.6869 111 144
3j6b-assembly1.cif.gz_5 structure of the yeast mitochondrial large ribosomal subunit 0.6811 107 141
8i9r-assembly1.cif.gz_Cy cryo-em structure of a chaetomium thermophilum pre-60s ribosomal subunit - state 5s rnp 0.6582 116 145
7ozs-assembly1.cif.gz_C structure of the hexameric 5s rnp from c. thermophilum 0.6528 116 146
3ue1-assembly1.cif.gz_B crystal strucuture of acinetobacter baumanni pbp1a in complex with mc-1 0.627 125 156
ID Description Score Start End Superfamily
3zg9B02 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.7332 117 158 3.40.710.10
af_O43042_213_298_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.7038 111 141 3.30.160.20
af_Q8IJC0_48_207_3.40.50.10480 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Brix domain 0.6827 110 145 3.40.50.10480
1vw4502 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.6811 107 141 3.30.160.20
af_I6YGX2_294_697_3.40.710.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.5961 125 159 3.40.710.10
ID Description Score Start End GO Terms
AF-A0A534DT32-F1-model_v4 deleted 0.8816 65 179
AF-A0A2V8R0Q7-F1-model_v4 DUF4252 domain-containing protein 0.866 28 189
AF-A0A2V8QH44-F1-model_v4 DUF4252 domain-containing protein 0.861 14 186
AF-A0A534DT32-F1-model_v4 deleted 0.8609 65 179
AF-A0A7W0JVC8-F1-model_v4 DUF4252 domain-containing protein 0.8575 1 186

Map