F410622

General Info

Members Datasets Scaffolds Average Seq Length
331 218 327 301

Family's Representative Sequence

Representative Sequence 3300044765|Ga0466970_0000465|Ga0466970_0000465_15217_16125
Length 302
Sequence MAQMIRMLLPALLLLTGRLFAQNKIVVFQSDFGLKDGAVAAMKGVASGVSADLKLYDLTHDIPAYNIWEAAYRLEQTVPYWPAGTVFVSVVDPGVGTTRKSVVLKTKAGHFIVTPDNGTLTFIAASEGIEEIREIDEAVNRRKDSRNSYTFHGRDVYAYTGARLAAGVIGFDQVGPKLEPQTVVSIPYQKAVLENGVLKGPIDILDVEYGNVWTNIPASLFSRLQLQAGDSMEVVIFHKNRQVYKGTMPYAHTFGDVALQQPLAYLNSLMYLSFALNQGSFAATHHIESGSDWQVQVKAVKK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
3 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
4 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
5 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
6 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
14 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
95 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
97 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
131 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
132 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
142 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
143 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
144 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
145 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
146 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
147 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
148 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
149 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
150 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
151 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
152 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
153 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
154 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
160 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
161 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
162 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
163 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
164 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
169 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
170 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
171 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
172 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
173 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
174 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
175 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
184 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
185 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
188 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
189 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
190 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
191 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
192 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
193 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
194 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
195 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
198 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
199 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
200 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
201 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
202 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
203 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
204 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
205 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
206 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
207 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
208 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
209 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
210 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
211 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
212 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
213 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
214 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
215 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
218 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.19
Metatranscriptomes 0
Isolates 1.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.78
Nodule 0
Rhizoplane 0.3
Rhizosphere 78.25
Stem 0
Stem Tuber 0
Unclassified 9.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_93197 2162886007 Bacteria 1354
2 JGI25153J46596_10001267 3300003215 Bacteria 15175
3 rootH1_10055805 3300003316 Bacteria 10718
4 rootH1_10107511 3300003316 Bacteria 7079
5 rootH1_10107511 3300003323 Bacteria 4757
6 rootH1_10154754 3300003316 Bacteria 1344
7 rootH1_10154754 3300003323 Bacteria 1743
8 rootH2_10018452 3300003320 Bacteria 5148
9 rootH2_10038656 3300003320 Bacteria 13640
10 rootH2_10056077 3300003320 Bacteria 10100
11 rootH2_10060288 3300003320 Bacteria 2089
12 rootH2_10168348 3300003320 Bacteria 3663
13 rootL2_10019931 3300003322 Bacteria 8320
14 rootL2_10109827 3300003322 Bacteria 8158
15 rootL2_10118873 3300003322 Unclassified 1747
16 rootL2_10162948 3300003322 Bacteria 1752
17 rootL2_10172346 3300003322 Bacteria 7689
18 rootL2_10234048 3300003322 Bacteria 1915
19 rootL2_10249253 3300003322 Bacteria 4882
20 rootH1_10016549 3300003323 Bacteria 11717
21 rootH1_10037689 3300003323 Bacteria 7346
22 rootH1_10073882 3300003323 Bacteria 15559
23 rootH1_10075295 3300003323 Bacteria 15921
24 rootH1_10081591 3300003323 Bacteria 20294
25 rootH1_10083702 3300003323 Bacteria 6683
26 rootH1_10115252 3300003323 Bacteria 1443
27 rootH1_10245724 3300003323 Unclassified 4365
28 JGI25160J50197_1008757 3300003354 Bacteria 3829
29 Ga0055535_1003011 3300003761 Bacteria 5150
30 Ga0055542_1003197 3300003762 Bacteria 4606
31 Ga0055526_1005747 3300003771 Bacteria 7000
32 Ga0055528_1000278 3300003790 Bacteria 43601
33 Ga0055530_10000463 3300003791 Bacteria 35675
34 Ga0055531_10041007 3300003794 Bacteria 1347
35 Ga0065165_1000010 3300005262 Bacteria 323737
36 Ga0065165_1020937 3300005262 Unclassified 2285
37 Ga0065704_10000482 3300005289 Bacteria 19209
38 Ga0065704_10071568 3300005289 Bacteria 10667
39 Ga0070676_10114310 3300005328 Bacteria 1685
40 Ga0070683_100002184 3300005329 Bacteria 15475
41 Ga0070683_100201108 3300005329 Unclassified 1892
42 Ga0070683_100472497 3300005329 Bacteria 1197
43 Ga0070690_100016786 3300005330 Bacteria 4394
44 Ga0068869_100075698 3300005334 Bacteria 2501
45 Ga0068869_100135506 3300005334 Bacteria 1897
46 Ga0068869_100276842 3300005334 Bacteria 1348
47 Ga0070666_10008462 3300005335 Bacteria 6391
48 Ga0070680_100163843 3300005336 Bacteria 1869
49 Ga0070682_100005005 3300005337 Bacteria 7366
50 Ga0068868_100013481 3300005338 Bacteria 5994
51 Ga0068868_100018452 3300005338 Bacteria 5217
52 Ga0070689_100028600 3300005340 Bacteria 4215
53 Ga0070689_100565016 3300005340 Bacteria 981
54 Ga0070661_100074267 3300005344 Bacteria 2504
55 Ga0070661_100242917 3300005344 Bacteria 1387
56 Ga0070675_100016538 3300005354 Bacteria 5856
57 Ga0070675_100251873 3300005354 Unclassified 1546
58 Ga0070671_100329749 3300005355 Unclassified 1301
59 Ga0070674_100164689 3300005356 Bacteria 1685
60 Ga0070673_100059752 3300005364 Bacteria 3019
61 Ga0070673_100067847 3300005364 Bacteria 2854
62 Ga0070688_100083817 3300005365 Bacteria 2069
63 Ga0070659_100005333 3300005366 Bacteria 9223
64 Ga0070667_100124299 3300005367 Unclassified 2247
65 Ga0070662_100005009 3300005457 Bacteria 8427
66 Ga0070662_100030165 3300005457 Unclassified 3791
67 Ga0070662_100031154 3300005457 Bacteria 3741
68 Ga0070681_10061851 3300005458 Bacteria 3718
69 Ga0068867_100133808 3300005459 Bacteria 1930
70 Ga0070685_10249718 3300005466 Unclassified 1175
71 Ga0070707_100737537 3300005468 Bacteria 948
72 Ga0070679_100076794 3300005530 Bacteria 3329
73 Ga0070684_100043023 3300005535 Bacteria 3900
74 Ga0070684_100234768 3300005535 Bacteria 1675
75 Ga0068853_100088087 3300005539 Bacteria 2724
76 Ga0070686_100173922 3300005544 Bacteria 1525
77 Ga0070665_100222998 3300005548 Unclassified 1886
78 Ga0070704_100063113 3300005549 Bacteria 2658
79 Ga0068855_100024392 3300005563 Bacteria 7236
80 Ga0068855_100033436 3300005563 Bacteria 6137
81 Ga0070664_100019525 3300005564 Bacteria 5576
82 Ga0070664_100027482 3300005564 Bacteria 4728
83 Ga0070664_100084083 3300005564 Unclassified 2746
84 Ga0070664_100205311 3300005564 Bacteria 1759
85 Ga0068857_100073836 3300005577 Bacteria 3039
86 Ga0068857_100076541 3300005577 Unclassified 2984
87 Ga0068854_100501398 3300005578 Bacteria 1022
88 Ga0068856_100017290 3300005614 Bacteria 6990
89 Ga0068856_100123383 3300005614 Bacteria 2593
90 Ga0068852_100205100 3300005616 Unclassified 1867
91 Ga0068859_100000522 3300005617 Bacteria 38186
92 Ga0068859_100624481 3300005617 Bacteria 1170
93 Ga0068864_100006031 3300005618 Bacteria 9949
94 Ga0068864_100061321 3300005618 Bacteria 3257
95 Ga0068864_100182214 3300005618 Unclassified 1921
96 Ga0068866_10053890 3300005718 Bacteria 2058
97 Ga0068861_100028369 3300005719 Bacteria 4083
98 Ga0068851_10176090 3300005834 Unclassified 1182
99 Ga0068863_100578877 3300005841 Unclassified 1110
100 Ga0068858_100689583 3300005842 Unclassified 994
101 Ga0068860_100013990 3300005843 Bacteria 7870
102 Ga0068860_100411068 3300005843 Bacteria 1340
103 Ga0068860_100546629 3300005843 Bacteria 1160
104 Ga0081539_10000337 3300005985 Bacteria 103868
105 Ga0097621_100001728 3300006237 Bacteria 14930
106 Ga0097621_100008746 3300006237 Bacteria 7315
107 Ga0068871_100041210 3300006358 Bacteria 3701
108 Ga0075428_100022082 3300006844 Bacteria 7045
109 Ga0075433_10242905 3300006852 Bacteria 1598
110 Ga0075434_100080259 3300006871 Bacteria 3259
111 Ga0075434_100177157 3300006871 Bacteria 2152
112 Ga0068865_100058623 3300006881 Bacteria 2690
113 Ga0097620_100000522 3300006931 Bacteria 38186
114 Ga0097620_100624500 3300006931 Bacteria 1170
115 Ga0105240_10368064 3300009093 Bacteria 1626
116 Ga0114129_10010697 3300009147 Bacteria 13085
117 Ga0105242_10051967 3300009176 Bacteria 3342
118 Ga0105242_10083441 3300009176 Bacteria 2676
119 Ga0105249_10061482 3300009553 Unclassified 3447
120 Ga0105239_10002629 3300010375 Bacteria 22688
121 Ga0105239_10197174 3300010375 Bacteria 2255
122 Ga0105239_10440467 3300010375 Unclassified 1477
123 Ga0157373_10066376 3300013100 Bacteria 2553
124 Ga0157371_10001595 3300013102 Bacteria 23267
125 Ga0157371_10002418 3300013102 Bacteria 17861
126 Ga0157371_10117285 3300013102 Bacteria 1892
127 Ga0157370_10024981 3300013104 Bacteria 5913
128 Ga0157370_10251161 3300013104 Bacteria 1636
129 Ga0157369_10010265 3300013105 Bacteria 10685
130 Ga0157374_10002504 3300013296 Bacteria 15509
131 Ga0157374_10027460 3300013296 Bacteria 5136
132 Ga0157374_10046313 3300013296 Bacteria 4027
133 Ga0157374_10069660 3300013296 Bacteria 3312
134 Ga0157374_10134638 3300013296 Unclassified 2394
135 Ga0157378_10082732 3300013297 Bacteria 2903
136 Ga0157378_10450008 3300013297 Bacteria 1278
137 Ga0157378_10894578 3300013297 Bacteria 918
138 Ga0163162_10000361 3300013306 Bacteria 41263
139 Ga0163162_10009874 3300013306 Bacteria 9284
140 Ga0163162_10023561 3300013306 Bacteria 6077
141 Ga0163162_10026323 3300013306 Bacteria 5749
142 Ga0163162_10094538 3300013306 Unclassified 3075
143 Ga0163162_10128835 3300013306 Bacteria 2638
144 Ga0157372_10216594 3300013307 Bacteria 2219
145 Ga0157372_10266504 3300013307 Bacteria 1989
146 Ga0157375_10002992 3300013308 Bacteria 14682
147 Ga0157375_10019921 3300013308 Bacteria 6115
148 Ga0157375_10197245 3300013308 Bacteria 2168
149 Ga0163163_10514436 3300014325 Bacteria 1259
150 Ga0157380_10069871 3300014326 Bacteria 2835
151 Ga0157380_10515719 3300014326 Bacteria 1165
152 Ga0157377_10021368 3300014745 Unclassified 3404
153 Ga0157377_10034267 3300014745 Bacteria 2777
154 Ga0157377_10149162 3300014745 Unclassified 1444
155 Ga0157379_10011716 3300014968 Bacteria 7656
156 Ga0157379_10013019 3300014968 Bacteria 7282
157 Ga0157379_10103564 3300014968 Unclassified 2554
158 Ga0157379_10248081 3300014968 Bacteria 1616
159 Ga0157376_10005100 3300014969 Bacteria 9153
160 Ga0157376_10017165 3300014969 Bacteria 5513
161 Ga0157376_10031040 3300014969 Bacteria 4273
162 Ga0157376_10099826 3300014969 Unclassified 2533
163 Ga0157376_10130098 3300014969 Bacteria 2245
164 Ga0163161_10144615 3300017792 Bacteria 1803
165 Ga0209258_100151 3300025242 Bacteria 160444
166 Ga0209148_1000154 3300025254 Bacteria 145214
167 Ga0209673_1000261 3300025273 Bacteria 99491
168 Ga0209758_1003061 3300025297 Bacteria 15899
169 Ga0209758_1007791 3300025297 Bacteria 7157
170 Ga0209050_1000577 3300025298 Bacteria 59430
171 Ga0207426_1000994 3300025302 Bacteria 27767
172 Ga0207426_1003568 3300025302 Bacteria 8285
173 Ga0207426_1005093 3300025302 Bacteria 6138
174 Ga0209051_1019754 3300025303 Bacteria 2928
175 Ga0209257_1003143 3300025304 Bacteria 14727
176 Ga0207647_10198486 3300025904 Bacteria 1161
177 Ga0207645_10317322 3300025907 Bacteria 1039
178 Ga0207707_10049334 3300025912 Bacteria 3667
179 Ga0207662_10063321 3300025918 Bacteria 2224
180 Ga0207657_10001051 3300025919 Bacteria 29279
181 Ga0207649_10284186 3300025920 Bacteria 1204
182 Ga0207681_10127152 3300025923 Bacteria 1879
183 Ga0207644_10089448 3300025931 Unclassified 2292
184 Ga0207706_10001391 3300025933 Bacteria 24155
185 Ga0207706_10005539 3300025933 Bacteria 11774
186 Ga0207706_10146087 3300025933 Bacteria 2080
187 Ga0207669_10063293 3300025937 Bacteria 2283
188 Ga0207691_10163670 3300025940 Bacteria 1950
189 Ga0207689_10006148 3300025942 Bacteria 10627
190 Ga0207689_10009084 3300025942 Bacteria 8605
191 Ga0207689_10394757 3300025942 Bacteria 1153
192 Ga0207679_10009336 3300025945 Bacteria 6281
193 Ga0207667_10026776 3300025949 Bacteria 6291
194 Ga0207667_10069144 3300025949 Bacteria 3676
195 Ga0207651_10022196 3300025960 Bacteria 3875
196 Ga0207712_10124945 3300025961 Unclassified 1952
197 Ga0207712_10355723 3300025961 Bacteria 1219
198 Ga0207640_10039939 3300025981 Bacteria 2974
199 Ga0207640_10093382 3300025981 Bacteria 2090
200 Ga0207658_10083236 3300025986 Unclassified 2459
201 Ga0207658_10208253 3300025986 Unclassified 1637
202 Ga0207677_10158159 3300026023 Bacteria 1757
203 Ga0207639_10036791 3300026041 Bacteria 3630
204 Ga0207639_10086514 3300026041 Bacteria 2496
205 Ga0207678_10125169 3300026067 Unclassified 2193
206 Ga0207702_10026226 3300026078 Bacteria 4837
207 Ga0207702_10052733 3300026078 Bacteria 3442
208 Ga0207641_10273501 3300026088 Bacteria 1586
209 Ga0207648_10004206 3300026089 Bacteria 14872
210 Ga0207648_10029653 3300026089 Bacteria 4851
211 Ga0207648_10138659 3300026089 Bacteria 2143
212 Ga0207676_10122727 3300026095 Bacteria 2194
213 Ga0207676_10184390 3300026095 Unclassified 1830
214 Ga0207674_10015260 3300026116 Bacteria 8448
215 Ga0207674_10078069 3300026116 Bacteria 3316
216 Ga0207675_100091432 3300026118 Unclassified 2861
217 Ga0207675_100464326 3300026118 Bacteria 1256
218 Ga0207698_10124838 3300026142 Bacteria 2187
219 Ga0207698_10328426 3300026142 Unclassified 1436
220 Ga0209974_10040635 3300027876 Bacteria 1548
221 Ga0207428_10043454 3300027907 Bacteria 3629
222 Ga0268264_10005782 3300028381 Bacteria 10486
223 Ga0268264_10136023 3300028381 Unclassified 2185
224 Ga0268264_10379619 3300028381 Unclassified 1353
225 Ga0268264_10463339 3300028381 Bacteria 1230
226 Ga0307513_10243913 3300031456 Bacteria 1599
227 Ga0307509_10061844 3300031507 Bacteria 3951
228 Ga0307516_10220910 3300031730 Bacteria 1604
229 Ga0307405_10052475 3300031731 Bacteria 2535
230 Ga0307406_10129528 3300031901 Bacteria 1769
231 Ga0307412_10171564 3300031911 Bacteria 1622
232 Ga0307416_100069687 3300032002 Bacteria 2911
233 Ga0307414_10000662 3300032004 Bacteria 17629
234 Ga0307414_10010202 3300032004 Bacteria 5438
235 Ga0307411_10049269 3300032005 Bacteria 2736
236 Ga0373937_0171085 3300036401 Bacteria 2038
237 Ga0436365_1299230 3300039437 Unclassified 1369
238 Ga0439433_0013207 3300041999 Bacteria 1812
239 Ga0439441_003606 3300042001 Bacteria 2294
240 Ga0450923_003596 3300042125 Bacteria 2358
241 Ga0450894_001845 3300042131 Bacteria 2943
242 Ga0439446_0000531 3300042156 Bacteria 7650
243 Ga0439460_0019280 3300042461 Bacteria 1846
244 Ga0450918_007568 3300042531 Bacteria 1919
245 Ga0451577_0002335 3300042876 Bacteria 22848
246 Ga0466969_0000033 3300044656 Bacteria 82227
247 Ga0466972_0000057 3300044658 Bacteria 110775
248 Ga0466972_0000328 3300044658 Bacteria 26748
249 Ga0466966_0000543 3300044684 Bacteria 24041
250 Ga0466964_0080775 3300044706 Bacteria 1395
251 Ga0453684_0049094 3300044712 Bacteria 5570
252 Ga0453684_0051812 3300044712 Bacteria 5374
253 Ga0466970_0000465 3300044765 Bacteria 20048
254 Ga0466957_0000240 3300044842 Bacteria 26156
255 Ga0466960_0030035 3300044901 Bacteria 2499
256 Ga0466959_0000048 3300045049 Bacteria 83528
257 Ga0466959_0011691 3300045049 Bacteria 6314
258 Ga0451576_0048134 3300045051 Bacteria 4480
259 Ga0495638_0000036 3300046460 Bacteria 275731
260 Ga0495653_0120087 3300046463 Unclassified 1875
261 Ga0495650_0000025 3300046471 Bacteria 486001
262 Ga0495606_0000110 3300046507 Bacteria 139007
263 Ga0495616_0003955 3300046513 Bacteria 9437
264 Ga0495618_0070358 3300046514 Unclassified 2225
265 Ga0495628_0018497 3300046516 Bacteria 5770
266 Ga0495630_0213468 3300046517 Unclassified 1473
267 Ga0495587_0105324 3300046536 Bacteria 1623
268 Ga0495633_0000019 3300046558 Bacteria 233769
269 Ga0495668_0003790 3300046616 Bacteria 11075
270 Ga0495634_0006373 3300046642 Bacteria 8974
271 Ga0495625_0000008 3300046660 Bacteria 536165
272 Ga0495625_0016406 3300046660 Bacteria 5831
273 Ga0495661_0003174 3300046665 Bacteria 12298
274 Ga0495599_0031636 3300046678 Bacteria 3321
275 Ga0495658_0125366 3300046683 Bacteria 1558
276 Ga0495649_0000006 3300046694 Bacteria 542188
277 Ga0495674_0109839 3300047319 Bacteria 2339
278 Ga0495674_0352784 3300047319 Unclassified 1194
279 Ga0495674_0496878 3300047319 Unclassified 976
280 Ga0496104_0261941 3300048907 Unclassified 1642
281 Ga0501040_0007208 3300049576 Bacteria 7200
282 Ga0501041_0037426 3300049577 Bacteria 2940
283 Ga0501046_0039577 3300049580 Bacteria 3774
284 Ga0501047_0013082 3300049581 Bacteria 7860
285 Ga0501047_0299340 3300049581 Bacteria 1451
286 Ga0501048_0085729 3300049582 Bacteria 2221
287 Ga0501070_0180880 3300049586 Bacteria 1735
288 Ga0501071_0014506 3300049587 Bacteria 5390
289 Ga0501071_0238378 3300049587 Bacteria 1371
290 Ga0501072_0064212 3300049588 Bacteria 2895
291 Ga0501074_0273535 3300049590 Bacteria 1201
292 Ga0501075_0034306 3300049591 Bacteria 3778
293 Ga0501076_0030880 3300049592 Bacteria 4174
294 Ga0501077_0019590 3300049593 Bacteria 4279
295 Ga0501253_022506 3300049683 Bacteria 1123
296 Ga0501257_025161 3300049686 Bacteria 1416
297 Ga0501225_0010983 3300049705 Unclassified 2554
298 Ga0501079_0048243 3300049741 Bacteria 3286
299 Ga0501241_001437 3300049758 Bacteria 4853
300 Ga0501264_002387 3300049761 Bacteria 1760
301 Ga0501035_0147410 3300049822 Bacteria 2043
302 Ga0501045_0069825 3300049824 Bacteria 2583
303 nmdc:mga05p37_17727_c2 3300050507 Bacteria 6455
304 nmdc:mga05p37_226260_c1 3300050507 Bacteria 2255
305 nmdc:mga0rr50_71624_c1 3300050513 Bacteria 2645
306 nmdc:mga0a205_53765_c1 3300050515 Bacteria 3887
307 Ga0495619_0053924 3300053085 Bacteria 2661
308 Ga0500578_0000097 3300053086 Bacteria 100607
309 Ga0500578_0034958 3300053086 Bacteria 3229
310 Ga0500644_0000133 3300053088 Bacteria 45875
311 Ga0500583_0000031 3300053092 Bacteria 104319
312 Ga0500651_0000143 3300053093 Bacteria 44885
313 Ga0500641_0003113 3300053096 Bacteria 5881
314 Ga0500555_007288 3300053103 Bacteria 3145
315 Ga0500557_003370 3300053105 Bacteria 3162
316 Ga0500608_020296 3300053122 Bacteria 3053
317 Ga0500618_000001 3300053125 Bacteria 538477
318 Ga0500652_015506 3300053131 Bacteria 2752
319 Ga0500589_027269 3300053147 Bacteria 2650
320 Ga0500616_0000004 3300053153 Bacteria 1002714
321 Ga0500622_0000026 3300053156 Bacteria 235660
322 Ga0500622_0000126 3300053156 Bacteria 80480
323 Ga0500622_0001280 3300053156 Bacteria 20467
324 Ga0500622_0005421 3300053156 Bacteria 7669
325 Ga0500633_0040575 3300053160 Unclassified 1562
326 Ga0501084_0027048 3300054114 Bacteria 4793
327 Ga0530510_0013466 3300061734 Bacteria 5750

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049683 Ga0501253_022506 Ga0501253_022506_74_955 265
2 3300049761 Ga0501264_002387 Ga0501264_002387_713_1594 267
3 3300014326 Ga0157380_10515719 Ga0157380_105157192 279
4 3300005330 Ga0070690_100016786 Ga0070690_1000167862 280
5 3300005468 Ga0070707_100737537 Ga0070707_1007375371 282
6 3300009147 Ga0114129_10010697 Ga0114129_1001069711 282
7 3300050507 nmdc:mga05p37_17727_c2 nmdc:mga05p37_17727_c2_1106_2005 282
8 3300005549 Ga0070704_100063113 Ga0070704_1000631132 283
9 3300005563 Ga0068855_100033436 Ga0068855_1000334363 283
10 3300005614 Ga0068856_100017290 Ga0068856_1000172902 283
11 3300005617 Ga0068859_100000522 Ga0068859_10000052225 283
12 3300006844 Ga0075428_100022082 Ga0075428_1000220825 283
13 3300006852 Ga0075433_10242905 Ga0075433_102429051 283
14 3300006871 Ga0075434_100080259 Ga0075434_1000802592 283
15 3300006931 Ga0097620_100000522 Ga0097620_10000052213 283
16 3300010375 Ga0105239_10002629 Ga0105239_1000262913 283
17 3300014326 Ga0157380_10069871 Ga0157380_100698712 283
18 3300025949 Ga0207667_10026776 Ga0207667_100267762 283
19 3300026078 Ga0207702_10052733 Ga0207702_100527332 283
20 3300027876 Ga0209974_10040635 Ga0209974_100406352 283
21 3300027907 Ga0207428_10043454 Ga0207428_100434543 283
22 3300031731 Ga0307405_10052475 Ga0307405_100524752 283
23 3300031901 Ga0307406_10129528 Ga0307406_101295282 283
24 3300031911 Ga0307412_10171564 Ga0307412_101715642 283
25 3300032002 Ga0307416_100069687 Ga0307416_1000696872 283
26 3300032005 Ga0307411_10049269 Ga0307411_100492692 283
27 3300041999 Ga0439433_0013207 Ga0439433_0013207_759_1655 283
28 3300042001 Ga0439441_003606 Ga0439441_003606_639_1523 283
29 3300042125 Ga0450923_003596 Ga0450923_003596_609_1505 283
30 3300042131 Ga0450894_001845 Ga0450894_001845_1357_2253 283
31 3300042156 Ga0439446_0000531 Ga0439446_0000531_4213_5109 283
32 3300042461 Ga0439460_0019280 Ga0439460_0019280_436_1332 283
33 3300042531 Ga0450918_007568 Ga0450918_007568_510_1427 283
34 3300044656 Ga0466969_0000033 Ga0466969_0000033_21917_22819 283
35 3300044684 Ga0466966_0000543 Ga0466966_0000543_20643_21545 283
36 3300045049 Ga0466959_0000048 Ga0466959_0000048_39028_39930 283
37 3300046616 Ga0495668_0003790 Ga0495668_0003790_2088_2987 283
38 3300049587 Ga0501071_0238378 Ga0501071_0238378_80_976 283
39 3300050507 nmdc:mga05p37_226260_c1 nmdc:mga05p37_226260_c1_300_1196 283
40 3300050513 nmdc:mga0rr50_71624_c1 nmdc:mga0rr50_71624_c1_203_1099 283
41 3300050515 nmdc:mga0a205_53765_c1 nmdc:mga0a205_53765_c1_2506_3402 283
42 3300053096 Ga0500641_0003113 Ga0500641_0003113_2670_3566 283
43 3300005843 Ga0068860_100013990 Ga0068860_1000139904 284
44 3300013104 Ga0157370_10251161 Ga0157370_102511612 284
45 3300013297 Ga0157378_10894578 Ga0157378_108945781 284
46 3300013306 Ga0163162_10000361 Ga0163162_1000036137 284
47 3300013306 Ga0163162_10128835 Ga0163162_101288352 284
48 3300028381 Ga0268264_10005782 Ga0268264_100057824 284
49 3300031456 Ga0307513_10243913 Ga0307513_102439132 284
50 3300031507 Ga0307509_10061844 Ga0307509_100618443 284
51 3300042876 Ga0451577_0002335 Ga0451577_0002335_19056_19922 284
52 3300044658 Ga0466972_0000328 Ga0466972_0000328_13151_14062 284
53 3300044712 Ga0453684_0051812 Ga0453684_0051812_2991_3857 284
54 3300044842 Ga0466957_0000240 Ga0466957_0000240_1072_1977 284
55 3300049581 Ga0501047_0299340 Ga0501047_0299340_43_948 284
56 3300053086 Ga0500578_0000097 Ga0500578_0000097_56051_56959 284
57 3300053086 Ga0500578_0034958 Ga0500578_0034958_1625_2536 284
58 3300053092 Ga0500583_0000031 Ga0500583_0000031_93818_94723 284
59 3300053131 Ga0500652_015506 Ga0500652_015506_1286_2191 284
60 3300053147 Ga0500589_027269 Ga0500589_027269_1117_2025 284
61 3300003316 rootH1_10154754 rootH1_101547542 285
62 3300003320 rootH2_10168348 rootH2_101683483 285
63 3300003322 rootL2_10019931 rootL2_100199315 285
64 3300003322 rootL2_10249253 rootL2_102492532 285
65 3300003323 rootH1_10037689 rootH1_100376897 285
66 3300003323 rootH1_10115252 rootH1_101152522 285
67 3300005334 Ga0068869_100276842 Ga0068869_1002768421 285
68 3300005356 Ga0070674_100164689 Ga0070674_1001646892 285
69 3300005539 Ga0068853_100088087 Ga0068853_1000880872 285
70 3300009176 Ga0105242_10083441 Ga0105242_100834411 285
71 3300014969 Ga0157376_10031040 Ga0157376_100310406 285
72 3300025923 Ga0207681_10127152 Ga0207681_101271522 285
73 3300025937 Ga0207669_10063293 Ga0207669_100632932 285
74 3300026089 Ga0207648_10004206 Ga0207648_1000420614 285
75 3300044712 Ga0453684_0049094 Ga0453684_0049094_302_1198 285
76 3300045051 Ga0451576_0048134 Ga0451576_0048134_2677_3573 285
77 3300046558 Ga0495633_0000019 Ga0495633_0000019_161109_161999 285
78 3300046660 Ga0495625_0016406 Ga0495625_0016406_1932_2903 285
79 3300053125 Ga0500618_000001 Ga0500618_000001_235686_236597 285
80 3300053156 Ga0500622_0000126 Ga0500622_0000126_69417_70319 285
81 3300053156 Ga0500622_0005421 Ga0500622_0005421_2434_3324 285
82 3300003215 JGI25153J46596_10001267 JGI25153J46596_100012674 286
83 3300003320 rootH2_10018452 rootH2_100184522 286
84 3300003320 rootH2_10060288 rootH2_100602882 286
85 3300003322 rootL2_10109827 rootL2_101098274 286
86 3300003322 rootL2_10162948 rootL2_101629482 286
87 3300003322 rootL2_10234048 rootL2_102340482 286
88 3300003761 Ga0055535_1003011 Ga0055535_10030115 286
89 3300003762 Ga0055542_1003197 Ga0055542_10031972 286
90 3300005262 Ga0065165_1020937 Ga0065165_10209372 286
91 3300005328 Ga0070676_10114310 Ga0070676_101143101 286
92 3300005329 Ga0070683_100201108 Ga0070683_1002011081 286
93 3300005329 Ga0070683_100472497 Ga0070683_1004724972 286
94 3300005334 Ga0068869_100075698 Ga0068869_1000756982 286
95 3300005334 Ga0068869_100135506 Ga0068869_1001355061 286
96 3300005335 Ga0070666_10008462 Ga0070666_100084623 286
97 3300005338 Ga0068868_100013481 Ga0068868_1000134814 286
98 3300005340 Ga0070689_100028600 Ga0070689_1000286005 286
99 3300005340 Ga0070689_100565016 Ga0070689_1005650161 286
100 3300005344 Ga0070661_100242917 Ga0070661_1002429172 286
101 3300005354 Ga0070675_100251873 Ga0070675_1002518732 286
102 3300005355 Ga0070671_100329749 Ga0070671_1003297491 286
103 3300005364 Ga0070673_100059752 Ga0070673_1000597522 286
104 3300005365 Ga0070688_100083817 Ga0070688_1000838172 286
105 3300005367 Ga0070667_100124299 Ga0070667_1001242991 286
106 3300005457 Ga0070662_100030165 Ga0070662_1000301652 286
107 3300005457 Ga0070662_100031154 Ga0070662_1000311543 286
108 3300005459 Ga0068867_100133808 Ga0068867_1001338082 286
109 3300005466 Ga0070685_10249718 Ga0070685_102497182 286
110 3300005535 Ga0070684_100043023 Ga0070684_1000430232 286
111 3300005535 Ga0070684_100234768 Ga0070684_1002347682 286
112 3300005548 Ga0070665_100222998 Ga0070665_1002229982 286
113 3300005564 Ga0070664_100019525 Ga0070664_1000195253 286
114 3300005564 Ga0070664_100027482 Ga0070664_1000274822 286
115 3300005564 Ga0070664_100084083 Ga0070664_1000840832 286
116 3300005564 Ga0070664_100205311 Ga0070664_1002053112 286
117 3300005577 Ga0068857_100073836 Ga0068857_1000738362 286
118 3300005578 Ga0068854_100501398 Ga0068854_1005013981 286
119 3300005616 Ga0068852_100205100 Ga0068852_1002051002 286
120 3300005617 Ga0068859_100624481 Ga0068859_1006244812 286
121 3300005618 Ga0068864_100006031 Ga0068864_1000060312 286
122 3300005618 Ga0068864_100061321 Ga0068864_1000613212 286
123 3300005618 Ga0068864_100182214 Ga0068864_1001822142 286
124 3300005718 Ga0068866_10053890 Ga0068866_100538902 286
125 3300005719 Ga0068861_100028369 Ga0068861_1000283694 286
126 3300005841 Ga0068863_100578877 Ga0068863_1005788771 286
127 3300005842 Ga0068858_100689583 Ga0068858_1006895831 286
128 3300005843 Ga0068860_100411068 Ga0068860_1004110682 286
129 3300005843 Ga0068860_100546629 Ga0068860_1005466291 286
130 3300006237 Ga0097621_100008746 Ga0097621_1000087463 286
131 3300006871 Ga0075434_100177157 Ga0075434_1001771572 286
132 3300006881 Ga0068865_100058623 Ga0068865_1000586232 286
133 3300006931 Ga0097620_100624500 Ga0097620_1006245002 286
134 3300009093 Ga0105240_10368064 Ga0105240_103680642 286
135 3300009176 Ga0105242_10051967 Ga0105242_100519673 286
136 3300009553 Ga0105249_10061482 Ga0105249_100614822 286
137 3300010375 Ga0105239_10197174 Ga0105239_101971742 286
138 3300010375 Ga0105239_10440467 Ga0105239_104404671 286
139 3300013102 Ga0157371_10117285 Ga0157371_101172852 286
140 3300013296 Ga0157374_10002504 Ga0157374_1000250414 286
141 3300013296 Ga0157374_10027460 Ga0157374_100274602 286
142 3300013296 Ga0157374_10069660 Ga0157374_100696602 286
143 3300013297 Ga0157378_10450008 Ga0157378_104500082 286
144 3300013306 Ga0163162_10009874 Ga0163162_1000987413 286
145 3300013306 Ga0163162_10023561 Ga0163162_100235612 286
146 3300013306 Ga0163162_10026323 Ga0163162_100263232 286
147 3300013306 Ga0163162_10094538 Ga0163162_100945382 286
148 3300013307 Ga0157372_10266504 Ga0157372_102665042 286
149 3300013308 Ga0157375_10002992 Ga0157375_100029923 286
150 3300013308 Ga0157375_10019921 Ga0157375_100199212 286
151 3300014325 Ga0163163_10514436 Ga0163163_105144362 286
152 3300014745 Ga0157377_10021368 Ga0157377_100213682 286
153 3300014745 Ga0157377_10149162 Ga0157377_101491622 286
154 3300014968 Ga0157379_10011716 Ga0157379_100117164 286
155 3300014968 Ga0157379_10013019 Ga0157379_100130197 286
156 3300014968 Ga0157379_10103564 Ga0157379_101035642 286
157 3300014968 Ga0157379_10248081 Ga0157379_102480812 286
158 3300014969 Ga0157376_10005100 Ga0157376_1000510011 286
159 3300014969 Ga0157376_10017165 Ga0157376_100171652 286
160 3300014969 Ga0157376_10099826 Ga0157376_100998261 286
161 3300017792 Ga0163161_10144615 Ga0163161_101446152 286
162 3300025242 Ga0209258_100151 Ga0209258_10015175 286
163 3300025254 Ga0209148_1000154 Ga0209148_100015427 286
164 3300025297 Ga0209758_1003061 Ga0209758_100306111 286
165 3300025904 Ga0207647_10198486 Ga0207647_101984861 286
166 3300025907 Ga0207645_10317322 Ga0207645_103173221 286
167 3300025918 Ga0207662_10063321 Ga0207662_100633213 286
168 3300025920 Ga0207649_10284186 Ga0207649_102841861 286
169 3300025931 Ga0207644_10089448 Ga0207644_100894482 286
170 3300025933 Ga0207706_10005539 Ga0207706_100055398 286
171 3300025933 Ga0207706_10146087 Ga0207706_101460872 286
172 3300025940 Ga0207691_10163670 Ga0207691_101636702 286
173 3300025942 Ga0207689_10006148 Ga0207689_100061484 286
174 3300025942 Ga0207689_10009084 Ga0207689_1000908410 286
175 3300025942 Ga0207689_10394757 Ga0207689_103947572 286
176 3300025945 Ga0207679_10009336 Ga0207679_100093364 286
177 3300025961 Ga0207712_10124945 Ga0207712_101249451 286
178 3300025961 Ga0207712_10355723 Ga0207712_103557231 286
179 3300025981 Ga0207640_10093382 Ga0207640_100933821 286
180 3300025986 Ga0207658_10083236 Ga0207658_100832364 286
181 3300025986 Ga0207658_10208253 Ga0207658_102082531 286
182 3300026023 Ga0207677_10158159 Ga0207677_101581592 286
183 3300026067 Ga0207678_10125169 Ga0207678_101251692 286
184 3300026088 Ga0207641_10273501 Ga0207641_102735012 286
185 3300026089 Ga0207648_10029653 Ga0207648_100296533 286
186 3300026089 Ga0207648_10138659 Ga0207648_101386592 286
187 3300026095 Ga0207676_10122727 Ga0207676_101227272 286
188 3300026095 Ga0207676_10184390 Ga0207676_101843902 286
189 3300026116 Ga0207674_10015260 Ga0207674_100152605 286
190 3300026118 Ga0207675_100091432 Ga0207675_1000914324 286
191 3300026118 Ga0207675_100464326 Ga0207675_1004643261 286
192 3300026142 Ga0207698_10124838 Ga0207698_101248382 286
193 3300026142 Ga0207698_10328426 Ga0207698_103284261 286
194 3300028381 Ga0268264_10136023 Ga0268264_101360231 286
195 3300028381 Ga0268264_10379619 Ga0268264_103796191 286
196 3300028381 Ga0268264_10463339 Ga0268264_104633391 286
197 3300031730 Ga0307516_10220910 Ga0307516_102209101 286
198 3300036401 Ga0373937_0171085 Ga0373937_0171085_195_1103 286
199 3300044901 Ga0466960_0030035 Ga0466960_0030035_675_1592 286
200 3300045049 Ga0466959_0011691 Ga0466959_0011691_5180_6085 286
201 3300046463 Ga0495653_0120087 Ga0495653_0120087_736_1644 286
202 3300046471 Ga0495650_0000025 Ga0495650_0000025_293847_294758 286
203 3300046507 Ga0495606_0000110 Ga0495606_0000110_50363_51274 286
204 3300046513 Ga0495616_0003955 Ga0495616_0003955_7413_8324 286
205 3300046514 Ga0495618_0070358 Ga0495618_0070358_829_1737 286
206 3300046516 Ga0495628_0018497 Ga0495628_0018497_824_1732 286
207 3300046517 Ga0495630_0213468 Ga0495630_0213468_528_1433 286
208 3300046536 Ga0495587_0105324 Ga0495587_0105324_31_939 286
209 3300046642 Ga0495634_0006373 Ga0495634_0006373_7497_8405 286
210 3300046660 Ga0495625_0000008 Ga0495625_0000008_9454_10365 286
211 3300046665 Ga0495661_0003174 Ga0495661_0003174_4506_5417 286
212 3300046678 Ga0495599_0031636 Ga0495599_0031636_32_940 286
213 3300046694 Ga0495649_0000006 Ga0495649_0000006_234954_235865 286
214 3300047319 Ga0495674_0109839 Ga0495674_0109839_96_1001 286
215 3300047319 Ga0495674_0352784 Ga0495674_0352784_32_940 286
216 3300048907 Ga0496104_0261941 Ga0496104_0261941_84_980 286
217 3300049576 Ga0501040_0007208 Ga0501040_0007208_890_1816 286
218 3300049577 Ga0501041_0037426 Ga0501041_0037426_455_1381 286
219 3300049580 Ga0501046_0039577 Ga0501046_0039577_1106_2032 286
220 3300049581 Ga0501047_0013082 Ga0501047_0013082_1577_2473 286
221 3300049582 Ga0501048_0085729 Ga0501048_0085729_336_1262 286
222 3300049586 Ga0501070_0180880 Ga0501070_0180880_543_1469 286
223 3300049587 Ga0501071_0014506 Ga0501071_0014506_2785_3711 286
224 3300049588 Ga0501072_0064212 Ga0501072_0064212_254_1180 286
225 3300049590 Ga0501074_0273535 Ga0501074_0273535_196_1122 286
226 3300049591 Ga0501075_0034306 Ga0501075_0034306_1839_2765 286
227 3300049592 Ga0501076_0030880 Ga0501076_0030880_435_1361 286
228 3300049593 Ga0501077_0019590 Ga0501077_0019590_1667_2593 286
229 3300049686 Ga0501257_025161 Ga0501257_025161_391_1305 286
230 3300049705 Ga0501225_0010983 Ga0501225_0010983_1342_2253 286
231 3300049741 Ga0501079_0048243 Ga0501079_0048243_816_1742 286
232 3300049758 Ga0501241_001437 Ga0501241_001437_769_1662 286
233 3300049822 Ga0501035_0147410 Ga0501035_0147410_586_1482 286
234 3300049824 Ga0501045_0069825 Ga0501045_0069825_121_1047 286
235 3300053088 Ga0500644_0000133 Ga0500644_0000133_8004_8906 286
236 3300053122 Ga0500608_020296 Ga0500608_020296_1992_2903 286
237 3300053156 Ga0500622_0000026 Ga0500622_0000026_168862_169767 286
238 3300053160 Ga0500633_0040575 Ga0500633_0040575_428_1330 286
239 3300054114 Ga0501084_0027048 Ga0501084_0027048_1529_2455 286
240 3300061734 Ga0530510_0013466 Ga0530510_0013466_3165_4091 286
241 iso_pu_bacteria 8003151029 8003154425 286
242 3300003316 rootH1_10055805 rootH1_1005580510 287
243 3300003316 rootH1_10107511 rootH1_101075112 287
244 3300003320 rootH2_10056077 rootH2_1005607710 287
245 3300003322 rootL2_10118873 rootL2_101188732 287
246 3300003322 rootL2_10172346 rootL2_101723464 287
247 3300003323 rootH1_10016549 rootH1_100165497 287
248 3300003323 rootH1_10073882 rootH1_100738825 287
249 3300003323 rootH1_10075295 rootH1_1007529510 287
250 3300003323 rootH1_10081591 rootH1_1008159114 287
251 3300003323 rootH1_10083702 rootH1_100837026 287
252 3300003323 rootH1_10245724 rootH1_102457244 287
253 3300013296 Ga0157374_10134638 Ga0157374_101346382 287
254 3300013297 Ga0157378_10082732 Ga0157378_100827321 287
255 3300026041 Ga0207639_10086514 Ga0207639_100865141 287
256 3300039437 Ga0436365_1299230 Ga0436365_1299230_365_1276 287
257 3300044706 Ga0466964_0080775 Ga0466964_0080775_395_1300 287
258 3300046683 Ga0495658_0125366 Ga0495658_0125366_500_1399 287
259 3300047319 Ga0495674_0496878 Ga0495674_0496878_54_953 287
260 3300053085 Ga0495619_0053924 Ga0495619_0053924_382_1281 287
261 3300053156 Ga0500622_0001280 Ga0500622_0001280_5281_6186 287
262 iso_pu_bacteria 2884791551 2884793667 287
263 iso_pu_bacteria 2884933994 2884937459 287
264 2162886007 SwRhRL2b_contig_93197 SwRhRL2b_0563.00000290 288
265 3300003320 rootH2_10038656 rootH2_100386562 288
266 3300003354 JGI25160J50197_1008757 JGI25160J50197_10087574 288
267 3300003771 Ga0055526_1005747 Ga0055526_10057474 288
268 3300003790 Ga0055528_1000278 Ga0055528_100027821 288
269 3300003791 Ga0055530_10000463 Ga0055530_1000046310 288
270 3300003794 Ga0055531_10041007 Ga0055531_100410072 288
271 3300005262 Ga0065165_1000010 Ga0065165_10000108 288
272 3300005289 Ga0065704_10000482 Ga0065704_1000048213 288
273 3300005289 Ga0065704_10071568 Ga0065704_100715688 288
274 3300005329 Ga0070683_100002184 Ga0070683_1000021849 288
275 3300005336 Ga0070680_100163843 Ga0070680_1001638431 288
276 3300005337 Ga0070682_100005005 Ga0070682_1000050052 288
277 3300005338 Ga0068868_100018452 Ga0068868_1000184523 288
278 3300005344 Ga0070661_100074267 Ga0070661_1000742674 288
279 3300005354 Ga0070675_100016538 Ga0070675_1000165383 288
280 3300005364 Ga0070673_100067847 Ga0070673_1000678474 288
281 3300005366 Ga0070659_100005333 Ga0070659_1000053337 288
282 3300005457 Ga0070662_100005009 Ga0070662_1000050093 288
283 3300005458 Ga0070681_10061851 Ga0070681_100618513 288
284 3300005530 Ga0070679_100076794 Ga0070679_1000767945 288
285 3300005544 Ga0070686_100173922 Ga0070686_1001739221 288
286 3300005563 Ga0068855_100024392 Ga0068855_1000243926 288
287 3300005577 Ga0068857_100076541 Ga0068857_1000765414 288
288 3300005614 Ga0068856_100123383 Ga0068856_1001233834 288
289 3300005834 Ga0068851_10176090 Ga0068851_101760902 288
290 3300005985 Ga0081539_10000337 Ga0081539_1000033756 288
291 3300006237 Ga0097621_100001728 Ga0097621_1000017287 288
292 3300006358 Ga0068871_100041210 Ga0068871_1000412101 288
293 3300013100 Ga0157373_10066376 Ga0157373_100663763 288
294 3300013102 Ga0157371_10001595 Ga0157371_100015959 288
295 3300013102 Ga0157371_10002418 Ga0157371_1000241815 288
296 3300013104 Ga0157370_10024981 Ga0157370_100249812 288
297 3300013105 Ga0157369_10010265 Ga0157369_100102652 288
298 3300013296 Ga0157374_10046313 Ga0157374_100463133 288
299 3300013307 Ga0157372_10216594 Ga0157372_102165942 288
300 3300013308 Ga0157375_10197245 Ga0157375_101972452 288
301 3300014745 Ga0157377_10034267 Ga0157377_100342674 288
302 3300014969 Ga0157376_10130098 Ga0157376_101300982 288
303 3300025273 Ga0209673_1000261 Ga0209673_100026111 288
304 3300025297 Ga0209758_1007791 Ga0209758_10077914 288
305 3300025298 Ga0209050_1000577 Ga0209050_100057743 288
306 3300025302 Ga0207426_1000994 Ga0207426_10009945 288
307 3300025302 Ga0207426_1003568 Ga0207426_10035684 288
308 3300025302 Ga0207426_1005093 Ga0207426_10050933 288
309 3300025303 Ga0209051_1019754 Ga0209051_10197542 288
310 3300025304 Ga0209257_1003143 Ga0209257_100314310 288
311 3300025912 Ga0207707_10049334 Ga0207707_100493342 288
312 3300025919 Ga0207657_10001051 Ga0207657_1000105120 288
313 3300025933 Ga0207706_10001391 Ga0207706_1000139111 288
314 3300025949 Ga0207667_10069144 Ga0207667_100691442 288
315 3300025960 Ga0207651_10022196 Ga0207651_100221962 288
316 3300025981 Ga0207640_10039939 Ga0207640_100399394 288
317 3300026041 Ga0207639_10036791 Ga0207639_100367911 288
318 3300026078 Ga0207702_10026226 Ga0207702_100262264 288
319 3300026116 Ga0207674_10078069 Ga0207674_100780693 288
320 3300032004 Ga0307414_10000662 Ga0307414_100006623 288
321 3300032004 Ga0307414_10010202 Ga0307414_100102022 288
322 3300044658 Ga0466972_0000057 Ga0466972_0000057_17342_18250 288
323 3300044765 Ga0466970_0000465 Ga0466970_0000465_15217_16125 288
324 3300046460 Ga0495638_0000036 Ga0495638_0000036_34996_35901 288
325 3300053093 Ga0500651_0000143 Ga0500651_0000143_7678_8589 288
326 3300053103 Ga0500555_007288 Ga0500555_007288_504_1421 288
327 3300053105 Ga0500557_003370 Ga0500557_003370_2169_3074 288
328 3300053153 Ga0500616_0000004 Ga0500616_0000004_581561_582466 288
329 iso_pu_bacteria 2775506987 2776612958 288
330 iso_pu_bacteria 2821136567 2821138370 288
331 iso_pu_bacteria 2904467357 2904469166 288

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01887

SAM_HAT_N

SAM hydroxide adenosyltransferase N-terminal domain

26

175

0.96

PF20257

SAM_HAT_C

SAM hydroxide adenosyltransferase C-terminal domain

200

294

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zbv-assembly1.cif.gz_C crystal structure of uncharacterized conserved protein from thermotoga maritima 0.9142 13 283
2zbv-assembly1.cif.gz_B crystal structure of uncharacterized conserved protein from thermotoga maritima 0.9051 12 284
2zbv-assembly1.cif.gz_C crystal structure of uncharacterized conserved protein from thermotoga maritima 0.9043 13 283
7ccg-assembly1.cif.gz_A crystal structure of cla1, a kind of a chlorinase from soil bacteria 0.8989 12 286
6rz2-assembly1.cif.gz_B sall with chloroadenosine 0.8968 11 284
ID Description Score Start End Superfamily
af_Q2FUT0_167_281_2.40.30.90 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Bacterial fluorinating enzyme like 0.9767 175 288 2.40.30.90
af_Q2FUT0_167_281_2.40.30.90 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Bacterial fluorinating enzyme like 0.9601 175 288 2.40.30.90
af_Q2FUT0_2_166_3.40.50.10790 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 0.9588 11 172 3.40.50.10790
af_Q2FUT0_2_166_3.40.50.10790 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 0.9363 11 172 3.40.50.10790
2zbvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 0.9352 14 172 3.40.50.10790
ID Description Score Start End GO Terms
AF-A0A7W8KTF6-F1-model_v4 deleted 0.989 184 287
AF-A0A658J9H5-F1-model_v4 deleted 0.9877 213 286
AF-A0A1J5P396-F1-model_v4 Adenosyl-chloride synthase (EC 2.5.1.94) 0.9824 13 286 GO:0016740
AF-A0A4U9XIH2-F1-model_v4 S-adenosyl-l-methionine hydroxide adenosyltransferase 0.9778 185 287 GO:0016740
AF-A0A522DQW5-F1-model_v4 DNA-directed RNA polymerase subunit delta 0.9773 39 284 GO:0000428

Feature Viewer

pLDDT pTM Quality
91.57 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map