F410573

General Info

Members Datasets Scaffolds Average Seq Length
331 209 662 99

Family's Representative Sequence

Representative Sequence 3300035695|Ga0373927_0633839|Ga0373927_0633839_257_607
Length 116
Sequence MGRLRLSDGRRGNSLKEYEMKKKIPMLAILLSLAIATSAWAQSLTNGLVTKVDAPSGKITIKHGPMKKFDMNDGMTMVYRAQDSAMLQSVKAGDKVKFDAENVNGQFVVTKIQKDK

Samples

Sample ID Description Type Environment
1 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
57 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
58 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
59 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
78 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
79 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
80 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
81 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
82 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
83 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
84 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
85 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
86 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
87 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
88 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
89 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
90 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
91 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
92 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
93 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
94 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
95 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
96 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
106 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
107 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
108 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
109 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
110 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
111 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
112 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
113 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
114 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
115 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
116 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
117 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
118 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
119 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
120 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
121 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
122 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
123 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
126 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
127 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
128 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
129 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
130 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
131 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
132 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
133 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
134 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
135 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
136 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
137 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
138 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
139 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
140 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
141 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
142 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
143 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
144 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
145 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
146 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
149 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
150 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
151 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
152 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
159 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
168 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
171 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
172 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
173 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
174 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
175 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
176 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
180 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
181 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
182 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
183 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
184 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
185 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
186 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
189 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
190 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
193 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
194 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
195 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
196 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
197 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
198 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
199 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
200 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
201 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
202 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
203 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
204 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
205 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
208 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
209 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.79
Metatranscriptomes 0.6
Isolates 0.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.9
Nodule 0.3
Rhizoplane 1.81
Rhizosphere 82.48
Stem 0
Stem Tuber 0
Unclassified 6.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373927_0633839 3300035695 Bacteria 706
2 JGI25406J46586_10035738 3300003203 Bacteria 1811
3 Ga0065704_10720906 3300005289 Bacteria 553
4 Ga0065715_10457017 3300005293 Bacteria 820
5 Ga0070683_101826026 3300005329 Bacteria 584
6 Ga0070680_100573298 3300005336 Bacteria 968
7 Ga0070660_100319292 3300005339 Bacteria 1276
8 Ga0070689_101547726 3300005340 Bacteria 601
9 Ga0070661_101799339 3300005344 Bacteria 520
10 Ga0070674_102212985 3300005356 Bacteria 502
11 Ga0070673_102285664 3300005364 Bacteria 514
12 Ga0070709_10490736 3300005434 Bacteria 931
13 Ga0070714_100071963 3300005435 Bacteria 2991
14 Ga0070714_102174106 3300005435 Bacteria 540
15 Ga0070681_10203090 3300005458 Bacteria 1900
16 Ga0070681_11401915 3300005458 Bacteria 622
17 Ga0070698_100542596 3300005471 Bacteria 1102
18 Ga0070698_101931657 3300005471 Bacteria 543
19 Ga0070679_100311125 3300005530 Bacteria 1525
20 Ga0070679_100486959 3300005530 Bacteria 1178
21 Ga0070679_101993664 3300005530 Bacteria 529
22 Ga0070684_100481459 3300005535 Bacteria 1149
23 Ga0068855_100036879 3300005563 Bacteria 5816
24 Ga0068855_100211460 3300005563 Bacteria 2179
25 Ga0068855_100590672 3300005563 Bacteria 1198
26 Ga0070664_100696376 3300005564 Bacteria 946
27 Ga0068856_101026937 3300005614 Bacteria 843
28 Ga0070702_100614220 3300005615 Bacteria 817
29 Ga0068852_100063909 3300005616 Bacteria 3206
30 Ga0068852_101039011 3300005616 Bacteria 839
31 Ga0068852_101059014 3300005616 Bacteria 831
32 Ga0068858_101959643 3300005842 Bacteria 579
33 Ga0081539_10002952 3300005985 Bacteria 22377
34 Ga0081539_10171759 3300005985 Bacteria 1024
35 Ga0070717_10914617 3300006028 Unclassified 799
36 Ga0070717_10967143 3300006028 Unclassified 775
37 Ga0075368_10346187 3300006042 Bacteria 647
38 Ga0075363_100274095 3300006048 Bacteria 975
39 Ga0075364_10055186 3300006051 Bacteria 2599
40 Ga0075364_10543061 3300006051 Bacteria 795
41 Ga0075364_10704295 3300006051 Bacteria 689
42 Ga0070712_100312653 3300006175 Bacteria 1275
43 Ga0075362_10246989 3300006177 Bacteria 877
44 Ga0075367_10376275 3300006178 Bacteria 897
45 Ga0075367_10441084 3300006178 Bacteria 825
46 Ga0075369_10084014 3300006186 Bacteria 1414
47 Ga0075366_10110333 3300006195 Unclassified 1654
48 Ga0075366_10191039 3300006195 Bacteria 1244
49 Ga0075366_10720709 3300006195 Bacteria 619
50 Ga0075366_10830793 3300006195 Bacteria 575
51 Ga0075366_11071922 3300006195 Bacteria 503
52 Ga0075370_10007447 3300006353 Bacteria 5576
53 Ga0075370_10309927 3300006353 Bacteria 939
54 Ga0075428_100179390 3300006844 Bacteria 2293
55 Ga0075430_101512698 3300006846 Unclassified 551
56 Ga0075431_100064389 3300006847 Bacteria 3785
57 Ga0075431_100149667 3300006847 Bacteria 2404
58 Ga0075434_102395103 3300006871 Bacteria 530
59 Ga0105240_11349326 3300009093 Bacteria 751
60 Ga0111539_10026391 3300009094 Bacteria 7102
61 Ga0105245_11540587 3300009098 Bacteria 716
62 Ga0105245_12901394 3300009098 Bacteria 531
63 Ga0105247_10494624 3300009101 Bacteria 890
64 Ga0114129_10000425 3300009147 Bacteria 50146
65 Ga0114129_10006029 3300009147 Bacteria 17182
66 Ga0114129_11020275 3300009147 Bacteria 1041
67 Ga0105243_11897089 3300009148 Bacteria 629
68 Ga0105248_12210784 3300009177 Bacteria 626
69 Ga0105238_10008680 3300009551 Bacteria 10168
70 Ga0105238_13048698 3300009551 Bacteria 503
71 Ga0105249_11249060 3300009553 Bacteria 814
72 Ga0157371_10133741 3300013102 Bacteria 1765
73 Ga0157370_10060083 3300013104 Bacteria 3610
74 Ga0163162_11373831 3300013306 Bacteria 803
75 Ga0157372_10136716 3300013307 Bacteria 2823
76 Ga0157372_11598783 3300013307 Bacteria 750
77 Ga0157379_12524904 3300014968 Bacteria 514
78 Ga0157376_10993172 3300014969 Bacteria 861
79 Ga0163161_10853687 3300017792 Bacteria 768
80 Ga0206353_10607164 3300020082 Bacteria 1453
81 Ga0154015_1292326 3300020610 Bacteria 593
82 Ga0209758_1057313 3300025297 Bacteria 1310
83 Ga0207426_1147602 3300025302 Bacteria 552
84 Ga0207688_10306795 3300025901 Bacteria 971
85 Ga0207699_10423349 3300025906 Bacteria 951
86 Ga0207705_10129756 3300025909 Bacteria 1875
87 Ga0207695_10393320 3300025913 Bacteria 1271
88 Ga0207693_10375219 3300025915 Bacteria 1113
89 Ga0207660_10201555 3300025917 Bacteria 1554
90 Ga0207660_10363326 3300025917 Bacteria 1161
91 Ga0207660_10715415 3300025917 Bacteria 817
92 Ga0207657_10073429 3300025919 Bacteria 2891
93 Ga0207657_10639464 3300025919 Bacteria 829
94 Ga0207694_10284269 3300025924 Bacteria 1359
95 Ga0207664_10160038 3300025929 Bacteria 1920
96 Ga0207690_10499837 3300025932 Bacteria 983
97 Ga0207689_10937444 3300025942 Bacteria 730
98 Ga0207661_11085406 3300025944 Bacteria 737
99 Ga0207667_10243456 3300025949 Bacteria 1840
100 Ga0207667_10281265 3300025949 Bacteria 1700
101 Ga0207667_10525281 3300025949 Bacteria 1199
102 Ga0207651_11593473 3300025960 Bacteria 588
103 Ga0207702_10300011 3300026078 Bacteria 1524
104 Ga0207674_11583123 3300026116 Bacteria 624
105 Ga0207698_10296800 3300026142 Bacteria 1502
106 Ga0207698_10708658 3300026142 Bacteria 1002
107 Ga0209998_10024607 3300027717 Bacteria 1307
108 Ga0209813_10115826 3300027866 Bacteria 928
109 Ga0209974_10070931 3300027876 Bacteria 1189
110 Ga0265325_10029411 3300031241 Bacteria 2954
111 Ga0265331_10078671 3300031250 Bacteria 1535
112 Ga0265316_10151399 3300031344 Bacteria 1738
113 Ga0307513_10435173 3300031456 Bacteria 1039
114 Ga0373926_0006590 3300035083 Bacteria 3853
115 Ga0373926_0132870 3300035083 Bacteria 943
116 Ga0373926_0142896 3300035083 Bacteria 909
117 Ga0373934_0269365 3300035086 Bacteria 705
118 Ga0373923_0096330 3300035111 Bacteria 1300
119 Ga0373936_0008904 3300035113 Bacteria 3783
120 Ga0373945_0011756 3300035116 Bacteria 2898
121 Ga0373953_0034019 3300035117 Bacteria 1996
122 Ga0373953_0279821 3300035117 Bacteria 727
123 Ga0373954_0043906 3300035118 Bacteria 2085
124 Ga0373956_0172524 3300035119 Bacteria 1021
125 Ga0373946_0001050 3300035171 Bacteria 9500
126 Ga0373946_0124888 3300035171 Bacteria 1178
127 Ga0373946_0537737 3300035171 Bacteria 602
128 Ga0373955_0068953 3300035172 Bacteria 1972
129 Ga0373942_0275966 3300035207 Bacteria 578
130 Ga0373935_0022798 3300035692 Bacteria 3843
131 Ga0373935_0057928 3300035692 Bacteria 2473
132 Ga0373935_0086459 3300035692 Bacteria 2046
133 Ga0373935_1101398 3300035692 Bacteria 591
134 Ga0373927_0025323 3300035695 Bacteria 3878
135 Ga0373927_0195821 3300035695 Bacteria 1326
136 Ga0373927_0738111 3300035695 Unclassified 650
137 Ga0373933_0022811 3300035724 Bacteria 3569
138 Ga0373947_0010792 3300035725 Bacteria 5240
139 Ga0373947_0029317 3300035725 Bacteria 3229
140 Ga0373947_0680764 3300035725 Bacteria 701
141 Ga0373947_1196717 3300035725 Unclassified 517
142 Ga0373937_0074976 3300036401 Bacteria 3123
143 Ga0373937_0178492 3300036401 Bacteria 1994
144 Ga0373937_0438268 3300036401 Bacteria 1240
145 Ga0373937_0870957 3300036401 Bacteria 849
146 Ga0373937_1920440 3300036401 Unclassified 538
147 Ga0373925_0032102 3300037068 Bacteria 3863
148 Ga0373925_0045252 3300037068 Bacteria 3269
149 Ga0373925_0819072 3300037068 Unclassified 767
150 Ga0373925_0997886 3300037068 Bacteria 689
151 Ga0395899_0006840 3300037312 Bacteria 8833
152 Ga0395899_0145060 3300037312 Bacteria 1686
153 Ga0395900_0001715 3300037418 Bacteria 25336
154 Ga0395900_0112986 3300037418 Bacteria 2788
155 Ga0395898_0086616 3300037466 Bacteria 3018
156 Ga0395898_0125829 3300037466 Bacteria 2455
157 Ga0436364_0147076 3300037853 Bacteria 2105
158 Ga0395901_0007678 3300038443 Bacteria 10879
159 Ga0395901_0462303 3300038443 Bacteria 1296
160 Ga0436365_0377218 3300039437 Bacteria 2166
161 Ga0436363_0187248 3300039450 Bacteria 819
162 Ga0439450_132079 3300042008 Bacteria 648
163 Ga0439464_0140592 3300042439 Bacteria 751
164 Ga0466968_0483854 3300044735 Bacteria 615
165 Ga0495592_0029972 3300046454 Bacteria 4116
166 Ga0495603_0004316 3300046455 Bacteria 8477
167 Ga0495603_0010666 3300046455 Bacteria 5571
168 Ga0495603_0040315 3300046455 Bacteria 2795
169 Ga0495629_0031641 3300046459 Bacteria 3745
170 Ga0495629_0229684 3300046459 Bacteria 1279
171 Ga0495641_0004647 3300046461 Bacteria 9596
172 Ga0495641_0161332 3300046461 Unclassified 1003
173 Ga0495651_0147747 3300046462 Unclassified 1698
174 Ga0495580_0007073 3300046472 Bacteria 9043
175 Ga0495580_0647941 3300046472 Bacteria 695
176 Ga0495580_0924183 3300046472 Bacteria 560
177 Ga0495582_0135456 3300046473 Bacteria 1393
178 Ga0495639_0000740 3300046475 Bacteria 14930
179 Ga0495662_0076734 3300046476 Bacteria 1623
180 Ga0495662_0165810 3300046476 Unclassified 1088
181 Ga0495664_0091267 3300046477 Bacteria 1831
182 Ga0495584_0003590 3300046491 Bacteria 8465
183 Ga0495585_0271676 3300046492 Bacteria 840
184 Ga0495594_0294729 3300046499 Bacteria 924
185 Ga0495594_0351381 3300046499 Bacteria 839
186 Ga0495594_0699906 3300046499 Unclassified 573
187 Ga0495608_0679086 3300046511 Bacteria 614
188 Ga0495618_0026421 3300046514 Bacteria 3609
189 Ga0495618_0053012 3300046514 Bacteria 2565
190 Ga0495630_0081634 3300046517 Bacteria 2440
191 Ga0495630_0084066 3300046517 Bacteria 2403
192 Ga0495630_0203248 3300046517 Bacteria 1512
193 Ga0495666_0004533 3300046526 Bacteria 7019
194 Ga0495666_0484950 3300046526 Unclassified 553
195 Ga0495652_0106072 3300046529 Bacteria 2269
196 Ga0495652_0208536 3300046529 Bacteria 1477
197 Ga0495652_0605338 3300046529 Bacteria 747
198 Ga0495665_0001368 3300046531 Bacteria 13041
199 Ga0495665_0171158 3300046531 Unclassified 1131
200 Ga0495665_0518450 3300046531 Bacteria 600
201 Ga0495640_0006840 3300046533 Bacteria 8986
202 Ga0495640_0068718 3300046533 Bacteria 2383
203 Ga0495587_0814779 3300046536 Bacteria 509
204 Ga0495609_0154541 3300046538 Bacteria 975
205 Ga0495645_0132745 3300046543 Bacteria 1744
206 Ga0495645_0797588 3300046543 Unclassified 567
207 Ga0495622_0225366 3300046557 Bacteria 829
208 Ga0495656_0334598 3300046615 Bacteria 782
209 Ga0495634_0107686 3300046642 Bacteria 1795
210 Ga0495634_0251281 3300046642 Bacteria 1081
211 Ga0495635_0316773 3300046663 Bacteria 1044
212 Ga0495635_0843084 3300046663 Unclassified 589
213 Ga0495588_0009828 3300046674 Bacteria 4435
214 Ga0495588_0285905 3300046674 Bacteria 869
215 Ga0495657_0542500 3300046675 Bacteria 676
216 Ga0495599_0210543 3300046678 Bacteria 1192
217 Ga0495599_0462636 3300046678 Archaea 750
218 Ga0495646_0268538 3300046680 Bacteria 909
219 Ga0495647_0001233 3300046681 Bacteria 7889
220 Ga0495647_0293635 3300046681 Bacteria 731
221 Ga0495658_0502582 3300046683 Bacteria 775
222 Ga0495658_0508010 3300046683 Bacteria 771
223 Ga0495613_0033067 3300046689 Bacteria 3843
224 Ga0495613_0248361 3300046689 Bacteria 1242
225 Ga0495624_0147360 3300046690 Bacteria 1440
226 Ga0495600_0378316 3300046809 Bacteria 884
227 Ga0495581_0025167 3300047315 Bacteria 3451
228 Ga0495604_0235966 3300047317 Bacteria 1253
229 Ga0495674_0034160 3300047319 Bacteria 4600
230 Ga0495674_0052342 3300047319 Bacteria 3593
231 Ga0495674_0114625 3300047319 Unclassified 2282
232 Ga0495674_0488162 3300047319 Bacteria 986
233 Ga0495680_0036949 3300047322 Bacteria 3915
234 Ga0495680_0077880 3300047322 Bacteria 2510
235 Ga0495680_0303567 3300047322 Bacteria 1120
236 Ga0495684_0712357 3300047471 Bacteria 664
237 Ga0495593_0044902 3300047673 Bacteria 2361
238 Ga0495593_0061816 3300047673 Bacteria 1959
239 Ga0495602_0755273 3300048088 Bacteria 656
240 Ga0495614_0340857 3300048089 Bacteria 697
241 Ga0496102_1580007 3300048905 Bacteria 574
242 Ga0496104_0003334 3300048907 Bacteria 13862
243 Ga0496105_0077199 3300048908 Bacteria 2751
244 Ga0496108_0624381 3300048911 Bacteria 938
245 Ga0496109_0043548 3300048912 Bacteria 4069
246 Ga0496110_0491719 3300048913 Unclassified 1117
247 Ga0501032_0029992 3300049569 Bacteria 3731
248 Ga0501033_0131165 3300049570 Bacteria 1815
249 Ga0501034_0193780 3300049571 Bacteria 1993
250 Ga0501036_0355881 3300049572 Bacteria 1222
251 Ga0501037_0199451 3300049573 Bacteria 1414
252 Ga0501038_0236620 3300049574 Bacteria 1451
253 Ga0501038_0758911 3300049574 Bacteria 723
254 Ga0501047_0092068 3300049581 Bacteria 2910
255 Ga0501047_0318195 3300049581 Bacteria 1396
256 Ga0501048_0894102 3300049582 Unclassified 639
257 Ga0501068_0061160 3300049584 Bacteria 2288
258 Ga0501069_0111877 3300049585 Bacteria 1555
259 Ga0501070_0021296 3300049586 Bacteria 5441
260 Ga0501070_0528893 3300049586 Bacteria 945
261 Ga0501071_0234224 3300049587 Bacteria 1384
262 Ga0501072_0031134 3300049588 Bacteria 4174
263 Ga0501073_0303501 3300049589 Bacteria 1101
264 Ga0501074_0839651 3300049590 Bacteria 647
265 Ga0501075_0427309 3300049591 Bacteria 1010
266 Ga0501080_0159462 3300049742 Bacteria 2084
267 Ga0501080_1113020 3300049742 Bacteria 681
268 Ga0501083_0470547 3300049744 Bacteria 818
269 Ga0501083_0503324 3300049744 Bacteria 788
270 Ga0501083_1064167 3300049744 Bacteria 526
271 Ga0501035_0554741 3300049822 Unclassified 941
272 Ga0501044_0026609 3300049823 Bacteria 6123
273 Ga0501044_0237331 3300049823 Bacteria 1768
274 Ga0501044_0298422 3300049823 Bacteria 1541
275 Ga0501044_1438477 3300049823 Bacteria 555
276 nmdc:mga03683_614551_c1 3300050489 Bacteria 533
277 nmdc:mga03n38_363380_c1 3300050490 Bacteria 790
278 nmdc:mga03n38_901585_c1 3300050490 Bacteria 519
279 nmdc:mga00v17_884431_c1 3300050491 Bacteria 566
280 nmdc:mga0yw44_706039_c1 3300050492 Bacteria 685
281 nmdc:mga0yw44_89534_c1 3300050492 Bacteria 1942
282 nmdc:mga0k408_346764_c1 3300050493 Bacteria 885
283 nmdc:mga0k408_900552_c1 3300050493 Bacteria 513
284 nmdc:mga06z11_14903_c1 3300050494 Bacteria 3456
285 nmdc:mga06z11_267054_c1 3300050494 Bacteria 1011
286 nmdc:mga04h51_251014_c1 3300050495 Bacteria 709
287 nmdc:mga07m45_418373_c1 3300050496 Bacteria 778
288 nmdc:mga07m45_846546_c1 3300050496 Bacteria 524
289 nmdc:mga05p37_22118_c1 3300050507 Bacteria 7708
290 nmdc:mga05p37_268_c1 3300050507 Bacteria 53897
291 nmdc:mga09592_263535_c1 3300050508 Bacteria 1495
292 nmdc:mga0qj67_258982_c1 3300050509 Bacteria 1411
293 nmdc:mga0qj67_457008_c1 3300050509 Bacteria 1028
294 nmdc:mga0qj67_81862_c1 3300050509 Bacteria 2588
295 nmdc:mga06r32_133_c1 3300050510 Bacteria 53973
296 nmdc:mga06r32_146795_c1 3300050510 Bacteria 2336
297 nmdc:mga06r32_465028_c1 3300050510 Bacteria 1244
298 nmdc:mga08y16_21146_c1 3300050511 Bacteria 6869
299 nmdc:mga0sz30_132576_c1 3300050516 Bacteria 1098
300 Ga0495601_0001161 3300053077 Bacteria 14400
301 Ga0495601_0017585 3300053077 Bacteria 4342
302 Ga0495601_0126277 3300053077 Bacteria 1664
303 Ga0495601_0941782 3300053077 Bacteria 544
304 Ga0495612_0000874 3300053078 Bacteria 12293
305 Ga0495612_0013745 3300053078 Bacteria 3261
306 Ga0495612_0067819 3300053078 Bacteria 1484
307 Ga0495595_0055973 3300053084 Bacteria 1837
308 Ga0495595_0231339 3300053084 Bacteria 924
309 Ga0495619_0003201 3300053085 Bacteria 10603
310 Ga0495619_0072962 3300053085 Bacteria 2299
311 Ga0495619_0222174 3300053085 Unclassified 1308
312 Ga0500641_0009554 3300053096 Bacteria 3488
313 Ga0500641_0102123 3300053096 Bacteria 1230
314 Ga0500654_165839 3300053099 Bacteria 738
315 Ga0500652_014355 3300053131 Bacteria 2829
316 Ga0500568_0009652 3300053139 Bacteria 4571
317 Ga0500568_0243019 3300053139 Bacteria 656
318 Ga0500573_0502835 3300053140 Bacteria 547
319 Ga0500577_0162076 3300053142 Bacteria 953
320 Ga0500577_0330545 3300053142 Bacteria 666
321 Ga0500588_0073767 3300053146 Bacteria 1126
322 Ga0500616_0071667 3300053153 Bacteria 1764
323 Ga0500645_000109 3300053730 Bacteria 65892
324 Ga0500645_213566 3300053730 Bacteria 518
325 Ga0501084_0528348 3300054114 Bacteria 997
326 Ga0501084_0539856 3300054114 Bacteria 985
327 Ga0501084_0743859 3300054114 Bacteria 826
328 Ga0501082_0098537 3300060353 Bacteria 2528
329 Ga0501082_0583667 3300060353 Bacteria 978
330 2876763249 2876761206 Bacteria 10111113
331 2885409641 2885409591 Bacteria 9235467
332 Ga0373927_0633839
333 JGI25406J46586_10035738
334 Ga0065704_10720906
335 Ga0065715_10457017
336 Ga0070683_101826026
337 Ga0070680_100573298
338 Ga0070660_100319292
339 Ga0070689_101547726
340 Ga0070661_101799339
341 Ga0070674_102212985
342 Ga0070673_102285664
343 Ga0070709_10490736
344 Ga0070714_100071963
345 Ga0070714_102174106
346 Ga0070681_10203090
347 Ga0070681_11401915
348 Ga0070698_100542596
349 Ga0070698_101931657
350 Ga0070679_100311125
351 Ga0070679_100486959
352 Ga0070679_101993664
353 Ga0070684_100481459
354 Ga0068855_100036879
355 Ga0068855_100211460
356 Ga0068855_100590672
357 Ga0070664_100696376
358 Ga0068856_101026937
359 Ga0070702_100614220
360 Ga0068852_100063909
361 Ga0068852_101039011
362 Ga0068852_101059014
363 Ga0068858_101959643
364 Ga0081539_10002952
365 Ga0081539_10171759
366 Ga0070717_10914617
367 Ga0070717_10967143
368 Ga0075368_10346187
369 Ga0075363_100274095
370 Ga0075364_10055186
371 Ga0075364_10543061
372 Ga0075364_10704295
373 Ga0070712_100312653
374 Ga0075362_10246989
375 Ga0075367_10376275
376 Ga0075367_10441084
377 Ga0075369_10084014
378 Ga0075366_10110333
379 Ga0075366_10191039
380 Ga0075366_10720709
381 Ga0075366_10830793
382 Ga0075366_11071922
383 Ga0075370_10007447
384 Ga0075370_10309927
385 Ga0075428_100179390
386 Ga0075430_101512698
387 Ga0075431_100064389
388 Ga0075431_100149667
389 Ga0075434_102395103
390 Ga0105240_11349326
391 Ga0111539_10026391
392 Ga0105245_11540587
393 Ga0105245_12901394
394 Ga0105247_10494624
395 Ga0114129_10000425
396 Ga0114129_10006029
397 Ga0114129_11020275
398 Ga0105243_11897089
399 Ga0105248_12210784
400 Ga0105238_10008680
401 Ga0105238_13048698
402 Ga0105249_11249060
403 Ga0157371_10133741
404 Ga0157370_10060083
405 Ga0163162_11373831
406 Ga0157372_10136716
407 Ga0157372_11598783
408 Ga0157379_12524904
409 Ga0157376_10993172
410 Ga0163161_10853687
411 Ga0206353_10607164
412 Ga0154015_1292326
413 Ga0209758_1057313
414 Ga0207426_1147602
415 Ga0207688_10306795
416 Ga0207699_10423349
417 Ga0207705_10129756
418 Ga0207695_10393320
419 Ga0207693_10375219
420 Ga0207660_10201555
421 Ga0207660_10363326
422 Ga0207660_10715415
423 Ga0207657_10073429
424 Ga0207657_10639464
425 Ga0207694_10284269
426 Ga0207664_10160038
427 Ga0207690_10499837
428 Ga0207689_10937444
429 Ga0207661_11085406
430 Ga0207667_10243456
431 Ga0207667_10281265
432 Ga0207667_10525281
433 Ga0207651_11593473
434 Ga0207702_10300011
435 Ga0207674_11583123
436 Ga0207698_10296800
437 Ga0207698_10708658
438 Ga0209998_10024607
439 Ga0209813_10115826
440 Ga0209974_10070931
441 Ga0265325_10029411
442 Ga0265331_10078671
443 Ga0265316_10151399
444 Ga0307513_10435173
445 Ga0373926_0006590
446 Ga0373926_0132870
447 Ga0373926_0142896
448 Ga0373934_0269365
449 Ga0373923_0096330
450 Ga0373936_0008904
451 Ga0373945_0011756
452 Ga0373953_0034019
453 Ga0373953_0279821
454 Ga0373954_0043906
455 Ga0373956_0172524
456 Ga0373946_0001050
457 Ga0373946_0124888
458 Ga0373946_0537737
459 Ga0373955_0068953
460 Ga0373942_0275966
461 Ga0373935_0022798
462 Ga0373935_0057928
463 Ga0373935_0086459
464 Ga0373935_1101398
465 Ga0373927_0025323
466 Ga0373927_0195821
467 Ga0373927_0738111
468 Ga0373933_0022811
469 Ga0373947_0010792
470 Ga0373947_0029317
471 Ga0373947_0680764
472 Ga0373947_1196717
473 Ga0373937_0074976
474 Ga0373937_0178492
475 Ga0373937_0438268
476 Ga0373937_0870957
477 Ga0373937_1920440
478 Ga0373925_0032102
479 Ga0373925_0045252
480 Ga0373925_0819072
481 Ga0373925_0997886
482 Ga0395899_0006840
483 Ga0395899_0145060
484 Ga0395900_0001715
485 Ga0395900_0112986
486 Ga0395898_0086616
487 Ga0395898_0125829
488 Ga0436364_0147076
489 Ga0395901_0007678
490 Ga0395901_0462303
491 Ga0436365_0377218
492 Ga0436363_0187248
493 Ga0439450_132079
494 Ga0439464_0140592
495 Ga0466968_0483854
496 Ga0495592_0029972
497 Ga0495603_0004316
498 Ga0495603_0010666
499 Ga0495603_0040315
500 Ga0495629_0031641
501 Ga0495629_0229684
502 Ga0495641_0004647
503 Ga0495641_0161332
504 Ga0495651_0147747
505 Ga0495580_0007073
506 Ga0495580_0647941
507 Ga0495580_0924183
508 Ga0495582_0135456
509 Ga0495639_0000740
510 Ga0495662_0076734
511 Ga0495662_0165810
512 Ga0495664_0091267
513 Ga0495584_0003590
514 Ga0495585_0271676
515 Ga0495594_0294729
516 Ga0495594_0351381
517 Ga0495594_0699906
518 Ga0495608_0679086
519 Ga0495618_0026421
520 Ga0495618_0053012
521 Ga0495630_0081634
522 Ga0495630_0084066
523 Ga0495630_0203248
524 Ga0495666_0004533
525 Ga0495666_0484950
526 Ga0495652_0106072
527 Ga0495652_0208536
528 Ga0495652_0605338
529 Ga0495665_0001368
530 Ga0495665_0171158
531 Ga0495665_0518450
532 Ga0495640_0006840
533 Ga0495640_0068718
534 Ga0495587_0814779
535 Ga0495609_0154541
536 Ga0495645_0132745
537 Ga0495645_0797588
538 Ga0495622_0225366
539 Ga0495656_0334598
540 Ga0495634_0107686
541 Ga0495634_0251281
542 Ga0495635_0316773
543 Ga0495635_0843084
544 Ga0495588_0009828
545 Ga0495588_0285905
546 Ga0495657_0542500
547 Ga0495599_0210543
548 Ga0495599_0462636
549 Ga0495646_0268538
550 Ga0495647_0001233
551 Ga0495647_0293635
552 Ga0495658_0502582
553 Ga0495658_0508010
554 Ga0495613_0033067
555 Ga0495613_0248361
556 Ga0495624_0147360
557 Ga0495600_0378316
558 Ga0495581_0025167
559 Ga0495604_0235966
560 Ga0495674_0034160
561 Ga0495674_0052342
562 Ga0495674_0114625
563 Ga0495674_0488162
564 Ga0495680_0036949
565 Ga0495680_0077880
566 Ga0495680_0303567
567 Ga0495684_0712357
568 Ga0495593_0044902
569 Ga0495593_0061816
570 Ga0495602_0755273
571 Ga0495614_0340857
572 Ga0496102_1580007
573 Ga0496104_0003334
574 Ga0496105_0077199
575 Ga0496108_0624381
576 Ga0496109_0043548
577 Ga0496110_0491719
578 Ga0501032_0029992
579 Ga0501033_0131165
580 Ga0501034_0193780
581 Ga0501036_0355881
582 Ga0501037_0199451
583 Ga0501038_0236620
584 Ga0501038_0758911
585 Ga0501047_0092068
586 Ga0501047_0318195
587 Ga0501048_0894102
588 Ga0501068_0061160
589 Ga0501069_0111877
590 Ga0501070_0021296
591 Ga0501070_0528893
592 Ga0501071_0234224
593 Ga0501072_0031134
594 Ga0501073_0303501
595 Ga0501074_0839651
596 Ga0501075_0427309
597 Ga0501080_0159462
598 Ga0501080_1113020
599 Ga0501083_0470547
600 Ga0501083_0503324
601 Ga0501083_1064167
602 Ga0501035_0554741
603 Ga0501044_0026609
604 Ga0501044_0237331
605 Ga0501044_0298422
606 Ga0501044_1438477
607 nmdc:mga03683_614551_c1
608 nmdc:mga03n38_363380_c1
609 nmdc:mga03n38_901585_c1
610 nmdc:mga00v17_884431_c1
611 nmdc:mga0yw44_706039_c1
612 nmdc:mga0yw44_89534_c1
613 nmdc:mga0k408_346764_c1
614 nmdc:mga0k408_900552_c1
615 nmdc:mga06z11_14903_c1
616 nmdc:mga06z11_267054_c1
617 nmdc:mga04h51_251014_c1
618 nmdc:mga07m45_418373_c1
619 nmdc:mga07m45_846546_c1
620 nmdc:mga05p37_22118_c1
621 nmdc:mga05p37_268_c1
622 nmdc:mga09592_263535_c1
623 nmdc:mga0qj67_258982_c1
624 nmdc:mga0qj67_457008_c1
625 nmdc:mga0qj67_81862_c1
626 nmdc:mga06r32_133_c1
627 nmdc:mga06r32_146795_c1
628 nmdc:mga06r32_465028_c1
629 nmdc:mga08y16_21146_c1
630 nmdc:mga0sz30_132576_c1
631 Ga0495601_0001161
632 Ga0495601_0017585
633 Ga0495601_0126277
634 Ga0495601_0941782
635 Ga0495612_0000874
636 Ga0495612_0013745
637 Ga0495612_0067819
638 Ga0495595_0055973
639 Ga0495595_0231339
640 Ga0495619_0003201
641 Ga0495619_0072962
642 Ga0495619_0222174
643 Ga0500641_0009554
644 Ga0500641_0102123
645 Ga0500654_165839
646 Ga0500652_014355
647 Ga0500568_0009652
648 Ga0500568_0243019
649 Ga0500573_0502835
650 Ga0500577_0162076
651 Ga0500577_0330545
652 Ga0500588_0073767
653 Ga0500616_0071667
654 Ga0500645_000109
655 Ga0500645_213566
656 Ga0501084_0528348
657 Ga0501084_0539856
658 Ga0501084_0743859
659 Ga0501082_0098537
660 Ga0501082_0583667
661 2876763249
662 2885409641

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11604

CusF_Ec

Copper binding periplasmic protein CusF

47

114

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zeq-assembly1.cif.gz_X 1.5 a structure of apo-cusf residues 6-88 from escherichia coli 0.8098 25 94
2vb3-assembly1.cif.gz_X crystal structure of ag(i)cusf 0.7991 25 93
2qcp-assembly1.cif.gz_X 1.0 a structure of cusf-ag(i) residues 10-88 from escherichia coli 0.7894 25 94
8bhu-assembly4.cif.gz_DDD crystal structure of silf (ag(i) form 0.7614 25 94
2l55-assembly1.cif.gz_A solution structure of the c-terminal domain of silb from cupriavidus metallidurans 0.7597 25 94
ID Description Score Start End Superfamily
2vb2X01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Copper binding periplasmic protein CusF 0.7727 25 94 2.40.50.320
2l55A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Copper binding periplasmic protein CusF 0.7597 25 94 2.40.50.320
2vb2X01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Copper binding periplasmic protein CusF 0.7168 25 94 2.40.50.320
af_G5EG68_31_129_2.40.50.120 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.7159 24 94 2.40.50.120
af_Q54Q32_6_126_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7136 24 94 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A0Q7APJ1-F1-model_v4 Metal transporter 0.9624 23 94
AF-A0A254TGQ5-F1-model_v4 RND transporter 0.9585 24 94
AF-A0A1G0D4I3-F1-model_v4 RND transporter 0.9579 21 94
AF-A0A127PF03-F1-model_v4 Copper binding periplasmic CusF family protein 0.9536 24 94
AF-A0A0K8NWE2-F1-model_v4 Cobalt-zinc-cadmium resistance protein CzcA 0.9506 23 94

Map