F410560

General Info

Members Datasets Scaffolds Average Seq Length
331 192 662 403

Family's Representative Sequence

Representative Sequence 3300031727|Ga0316576_10034419|Ga0316576_100344193
Length 449
Sequence LTRHVVRDRAELEAEEARRLAPWAIRSTEAVRLRAADREGPSARPDFQRDRDRILHARAFRRLKHKTQVFVPHIADHPRTRLTHTLEVSQLARSIARALGLNEDLTEAVALGHDLGHTAFGHTGEKVIDEILRGRSSELRLPDEVVDAVGAFKHNYQSVRVVDLLEWRYDHPGLNLCNQVREGILKHTGWTPDFDFPLPERDGLALDRPCHLEGQAVAVADEIAQQTHDLEDGLRAGSVAFEAVEELAVSQRVIDALGDRYRSEPRRWLRQSTLIRELIGLFVTDAIDASGRRLGAFVEDHGIDDHEQWLAHAHDVPRNTIWFSEEIADDFNRLKSFIYQFIINHIDVNRQDWRARKVVTALFRAFWTNPLTLPSYVLLRAKTELGFPYLRDVPLAAVADEVAGRYHTSAGFARLIADHIAGMSDRFALEEYGSLEMPAPNQRFGGPRT

Samples

Sample ID Description Type Environment
1 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
124 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
125 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
126 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
127 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
128 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
129 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
130 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
131 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
132 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
133 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
134 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
135 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
138 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
152 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
153 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
154 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
155 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
167 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
168 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
169 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
170 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
171 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
172 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
173 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
183 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
184 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
185 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
186 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
187 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
189 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
190 2738543013 Variovorax sp. BT01 Isolate Unclassified
191 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
192 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.79
Metatranscriptomes 0
Isolates 1.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.21
Nodule 0.3
Rhizoplane 4.23
Rhizosphere 89.73
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316576_10034419 3300031727 Bacteria 3610
2 JGI24752J21851_1000513 3300001976 Bacteria 5186
3 JGI24750J21931_1000683 3300002070 Bacteria 4930
4 JGI24738J21930_10002354 3300002075 Bacteria 4977
5 JGI26128J50194_1000225 3300003347 Bacteria 2721
6 Ga0065165_1022730 3300005262 Bacteria 2142
7 Ga0070658_10000504 3300005327 Bacteria 33858
8 Ga0070658_10002607 3300005327 Bacteria 15023
9 Ga0070658_10012910 3300005327 Bacteria 6705
10 Ga0070676_10009093 3300005328 Bacteria 5373
11 Ga0070690_100000338 3300005330 Bacteria 24029
12 Ga0070690_100000377 3300005330 Bacteria 22770
13 Ga0070670_100001551 3300005331 Bacteria 18530
14 Ga0070670_100007393 3300005331 Bacteria 9328
15 Ga0070670_100039742 3300005331 Bacteria 4045
16 Ga0070670_100095844 3300005331 Bacteria 2552
17 Ga0070666_10000069 3300005335 Bacteria 75768
18 Ga0070666_10003257 3300005335 Bacteria 9854
19 Ga0070666_10059794 3300005335 Bacteria 2578
20 Ga0068868_100319857 3300005338 Bacteria 1322
21 Ga0070660_100000376 3300005339 Bacteria 29679
22 Ga0070660_100007375 3300005339 Bacteria 7660
23 Ga0070660_100138049 3300005339 Bacteria 1954
24 Ga0070660_100144030 3300005339 Bacteria 1913
25 Ga0070689_100002547 3300005340 Bacteria 11947
26 Ga0070661_100045361 3300005344 Bacteria 3213
27 Ga0070661_100067092 3300005344 Bacteria 2637
28 Ga0070692_10000313 3300005345 Bacteria 13879
29 Ga0070692_10002941 3300005345 Bacteria 6767
30 Ga0070692_10038669 3300005345 Bacteria 2433
31 Ga0070692_10076083 3300005345 Bacteria 1798
32 Ga0070668_100020865 3300005347 Bacteria 4949
33 Ga0070668_100197229 3300005347 Bacteria 1651
34 Ga0070669_100000167 3300005353 Bacteria 57589
35 Ga0070669_100188441 3300005353 Bacteria 1617
36 Ga0070675_100179567 3300005354 Bacteria 1829
37 Ga0070671_100016427 3300005355 Bacteria 5985
38 Ga0070674_100047800 3300005356 Bacteria 2934
39 Ga0070673_100172124 3300005364 Bacteria 1849
40 Ga0070688_100022345 3300005365 Bacteria 3705
41 Ga0070688_100036928 3300005365 Bacteria 2974
42 Ga0070659_100152567 3300005366 Bacteria 1885
43 Ga0070667_100001637 3300005367 Bacteria 20034
44 Ga0070667_100082712 3300005367 Bacteria 2749
45 Ga0070667_100277573 3300005367 Bacteria 1504
46 Ga0070694_100025019 3300005444 Bacteria 3858
47 Ga0070708_100004799 3300005445 Bacteria 10664
48 Ga0070708_100020161 3300005445 Bacteria 5616
49 Ga0070708_100082507 3300005445 Bacteria 2912
50 Ga0070663_100000840 3300005455 Bacteria 16645
51 Ga0070663_100009303 3300005455 Bacteria 6081
52 Ga0070663_100129714 3300005455 Bacteria 1913
53 Ga0070662_100001750 3300005457 Bacteria 13370
54 Ga0070662_100053031 3300005457 Bacteria 2934
55 Ga0068867_100001886 3300005459 Bacteria 14585
56 Ga0070685_10000036 3300005466 Bacteria 80641
57 Ga0070706_100001720 3300005467 Bacteria 22739
58 Ga0070706_100005085 3300005467 Bacteria 12556
59 Ga0070706_100005384 3300005467 Bacteria 12192
60 Ga0070706_100027046 3300005467 Bacteria 5279
61 Ga0070707_100000742 3300005468 Bacteria 32317
62 Ga0070698_100002977 3300005471 Bacteria 18634
63 Ga0070698_100019339 3300005471 Bacteria 7153
64 Ga0070698_100136467 3300005471 Bacteria 2407
65 Ga0070699_100165002 3300005518 Bacteria 1961
66 Ga0070679_100108418 3300005530 Bacteria 2763
67 Ga0070697_100015114 3300005536 Bacteria 6062
68 Ga0070697_100054287 3300005536 Bacteria 3257
69 Ga0070697_100077174 3300005536 Bacteria 2740
70 Ga0070686_100000045 3300005544 Bacteria 101988
71 Ga0070695_100011774 3300005545 Bacteria 5236
72 Ga0070696_100029842 3300005546 Bacteria 3730
73 Ga0070665_100000042 3300005548 Bacteria 292582
74 Ga0070665_100010339 3300005548 Bacteria 9441
75 Ga0070665_100067963 3300005548 Bacteria 3573
76 Ga0070665_100075735 3300005548 Bacteria 3372
77 Ga0070665_100087031 3300005548 Bacteria 3130
78 Ga0070664_100004998 3300005564 Bacteria 10625
79 Ga0070664_100022547 3300005564 Bacteria 5192
80 Ga0070664_100177188 3300005564 Bacteria 1893
81 Ga0068856_100003084 3300005614 Bacteria 17018
82 Ga0068856_100398511 3300005614 Bacteria 1396
83 Ga0070702_100023267 3300005615 Bacteria 3290
84 Ga0068859_100005586 3300005617 Bacteria 12808
85 Ga0068859_100013033 3300005617 Bacteria 8353
86 Ga0068859_100021076 3300005617 Bacteria 6540
87 Ga0068859_100042976 3300005617 Bacteria 4541
88 Ga0068859_100087959 3300005617 Bacteria 3155
89 Ga0068864_100005713 3300005618 Bacteria 10198
90 Ga0068864_100017449 3300005618 Bacteria 5985
91 Ga0068866_10016756 3300005718 Bacteria 3283
92 Ga0068861_100046865 3300005719 Bacteria 3261
93 Ga0068863_100069007 3300005841 Bacteria 3343
94 Ga0068858_100002954 3300005842 Bacteria 17077
95 Ga0068860_100000182 3300005843 Bacteria 100888
96 Ga0068860_100006694 3300005843 Bacteria 11569
97 Ga0068860_100010832 3300005843 Bacteria 9000
98 Ga0068862_100010302 3300005844 Bacteria 7714
99 Ga0068862_100054086 3300005844 Bacteria 3437
100 Ga0068862_100076054 3300005844 Bacteria 2905
101 Ga0081455_10028908 3300005937 Bacteria 5059
102 Ga0075433_10001645 3300006852 Bacteria 16597
103 Ga0075434_100001071 3300006871 Bacteria 22374
104 Ga0075434_100008103 3300006871 Bacteria 9745
105 Ga0075436_100094873 3300006914 Bacteria 2075
106 Ga0097620_100005587 3300006931 Bacteria 12808
107 Ga0097620_100013033 3300006931 Bacteria 8353
108 Ga0097620_100021076 3300006931 Bacteria 6540
109 Ga0097620_100042976 3300006931 Bacteria 4541
110 Ga0097620_100087955 3300006931 Bacteria 3155
111 Ga0075435_100106875 3300007076 Bacteria 2324
112 Ga0105240_10005506 3300009093 Bacteria 18868
113 Ga0105240_10271895 3300009093 Bacteria 1950
114 Ga0105240_10313152 3300009093 Bacteria 1792
115 Ga0111539_10097748 3300009094 Bacteria 3449
116 Ga0105245_10193542 3300009098 Bacteria 1949
117 Ga0105247_10083056 3300009101 Bacteria 2022
118 Ga0114129_10003576 3300009147 Bacteria 21870
119 Ga0114129_10027443 3300009147 Bacteria 8060
120 Ga0105248_10000735 3300009177 Bacteria 36877
121 Ga0105248_10025403 3300009177 Bacteria 6586
122 Ga0105248_10338162 3300009177 Bacteria 1695
123 Ga0105249_10000012 3300009553 Bacteria 292640
124 Ga0105249_10019903 3300009553 Bacteria 5993
125 Ga0157373_10025666 3300013100 Bacteria 4260
126 Ga0157370_10120503 3300013104 Bacteria 2449
127 Ga0157370_10183049 3300013104 Bacteria 1946
128 Ga0157370_10184602 3300013104 Bacteria 1937
129 Ga0157369_10004588 3300013105 Bacteria 16235
130 Ga0157374_10101254 3300013296 Bacteria 2762
131 Ga0157378_10357063 3300013297 Bacteria 1429
132 Ga0163162_10009294 3300013306 Bacteria 9560
133 Ga0163162_10052252 3300013306 Bacteria 4104
134 Ga0157375_10003169 3300013308 Bacteria 14283
135 Ga0157375_10049308 3300013308 Bacteria 4124
136 Ga0163163_10002101 3300014325 Bacteria 16816
137 Ga0163163_10023254 3300014325 Bacteria 5880
138 Ga0163163_10091845 3300014325 Bacteria 3051
139 Ga0157380_10003404 3300014326 Bacteria 10918
140 Ga0157380_10008670 3300014326 Bacteria 7269
141 Ga0157379_10002857 3300014968 Bacteria 14559
142 Ga0157376_10028089 3300014969 Bacteria 4468
143 Ga0157376_10163239 3300014969 Bacteria 2021
144 Ga0207697_10027260 3300025315 Bacteria 2336
145 Ga0207656_10003545 3300025321 Bacteria 5376
146 Ga0207642_10010989 3300025899 Bacteria 3214
147 Ga0207710_10043383 3300025900 Bacteria 2000
148 Ga0207688_10109010 3300025901 Bacteria 1606
149 Ga0207680_10000012 3300025903 Bacteria 293810
150 Ga0207680_10003249 3300025903 Bacteria 7654
151 Ga0207680_10034291 3300025903 Bacteria 2903
152 Ga0207680_10167767 3300025903 Bacteria 1476
153 Ga0207645_10004007 3300025907 Bacteria 10981
154 Ga0207643_10012156 3300025908 Bacteria 4652
155 Ga0207705_10000135 3300025909 Bacteria 79350
156 Ga0207705_10000469 3300025909 Bacteria 34559
157 Ga0207705_10034001 3300025909 Bacteria 3644
158 Ga0207705_10096414 3300025909 Bacteria 2171
159 Ga0207684_10013715 3300025910 Bacteria 6999
160 Ga0207684_10029738 3300025910 Bacteria 4651
161 Ga0207684_10064352 3300025910 Bacteria 3114
162 Ga0207654_10001493 3300025911 Bacteria 12355
163 Ga0207707_10342099 3300025912 Bacteria 1290
164 Ga0207695_10009881 3300025913 Bacteria 11726
165 Ga0207671_10000358 3300025914 Bacteria 65072
166 Ga0207663_10056316 3300025916 Bacteria 2471
167 Ga0207657_10000864 3300025919 Bacteria 31944
168 Ga0207657_10001741 3300025919 Bacteria 23460
169 Ga0207657_10032890 3300025919 Bacteria 4680
170 Ga0207657_10129272 3300025919 Bacteria 2072
171 Ga0207657_10154114 3300025919 Bacteria 1870
172 Ga0207681_10000076 3300025923 Bacteria 89353
173 Ga0207681_10085230 3300025923 Bacteria 2242
174 Ga0207659_10021871 3300025926 Bacteria 4252
175 Ga0207706_10002985 3300025933 Bacteria 16318
176 Ga0207706_10006284 3300025933 Bacteria 11038
177 Ga0207706_10044794 3300025933 Bacteria 3920
178 Ga0207670_10049179 3300025936 Bacteria 2819
179 Ga0207704_10035087 3300025938 Bacteria 2870
180 Ga0207691_10015698 3300025940 Bacteria 7199
181 Ga0207691_10074059 3300025940 Bacteria 3071
182 Ga0207691_10129574 3300025940 Bacteria 2229
183 Ga0207711_10001922 3300025941 Bacteria 18874
184 Ga0207711_10077870 3300025941 Bacteria 2891
185 Ga0207711_10121695 3300025941 Bacteria 2330
186 Ga0207711_10232197 3300025941 Bacteria 1690
187 Ga0207679_10031064 3300025945 Bacteria 3736
188 Ga0207667_10000829 3300025949 Bacteria 39957
189 Ga0207712_10000021 3300025961 Bacteria 292649
190 Ga0207640_10067936 3300025981 Bacteria 2387
191 Ga0207658_10003747 3300025986 Bacteria 10705
192 Ga0207658_10171351 3300025986 Bacteria 1788
193 Ga0207658_10271262 3300025986 Bacteria 1450
194 Ga0207703_10004856 3300026035 Bacteria 10938
195 Ga0207703_10004859 3300026035 Bacteria 10936
196 Ga0207678_10004264 3300026067 Bacteria 12822
197 Ga0207678_10014924 3300026067 Bacteria 6834
198 Ga0207678_10017323 3300026067 Bacteria 6324
199 Ga0207678_10075550 3300026067 Bacteria 2886
200 Ga0207708_10109963 3300026075 Bacteria 2138
201 Ga0207708_10284730 3300026075 Bacteria 1340
202 Ga0207702_10003254 3300026078 Bacteria 15003
203 Ga0207702_10009981 3300026078 Bacteria 7961
204 Ga0207648_10004318 3300026089 Bacteria 14636
205 Ga0207676_10078955 3300026095 Bacteria 2667
206 Ga0207676_10118582 3300026095 Bacteria 2227
207 Ga0207676_10235891 3300026095 Bacteria 1638
208 Ga0207675_100004395 3300026118 Bacteria 13613
209 Ga0207675_100028787 3300026118 Bacteria 5175
210 Ga0207683_10002553 3300026121 Bacteria 15885
211 Ga0207683_10046287 3300026121 Bacteria 3807
212 Ga0207698_10008213 3300026142 Bacteria 6586
213 Ga0209999_1002672 3300027543 Bacteria 3152
214 Ga0209970_1000120 3300027614 Bacteria 11609
215 Ga0209983_1000916 3300027665 Bacteria 6466
216 Ga0209971_1000399 3300027682 Bacteria 11748
217 Ga0209966_1000547 3300027695 Bacteria 9440
218 Ga0209974_10008879 3300027876 Bacteria 3425
219 Ga0268266_10000054 3300028379 Bacteria 292717
220 Ga0268266_10023176 3300028379 Bacteria 5286
221 Ga0268266_10038961 3300028379 Bacteria 4047
222 Ga0268266_10156980 3300028379 Bacteria 2056
223 Ga0268265_10012378 3300028380 Bacteria 5780
224 Ga0268265_10028067 3300028380 Bacteria 4027
225 Ga0268265_10249397 3300028380 Bacteria 1571
226 Ga0268264_10000074 3300028381 Bacteria 259555
227 Ga0268264_10001881 3300028381 Bacteria 19065
228 Ga0268264_10020358 3300028381 Bacteria 5421
229 Ga0265328_10039572 3300031239 Bacteria 1739
230 Ga0307513_10033806 3300031456 Bacteria 5744
231 Ga0307513_10109989 3300031456 Bacteria 2752
232 Ga0307509_10034168 3300031507 Bacteria 5588
233 Ga0316575_10009764 3300031665 Bacteria 3518
234 Ga0316579_10028812 3300031691 Bacteria 2530
235 Ga0316576_10000138 3300031727 Bacteria 28438
236 Ga0316576_10010080 3300031727 Bacteria 6120
237 Ga0316576_10012147 3300031727 Bacteria 5680
238 Ga0316576_10039854 3300031727 Bacteria 3374
239 Ga0316576_10103029 3300031727 Bacteria 2135
240 Ga0316576_10106381 3300031727 Bacteria 2100
241 Ga0316578_10001764 3300031728 Bacteria 9067
242 Ga0316578_10037615 3300031728 Bacteria 2788
243 Ga0316578_10039931 3300031728 Bacteria 2711
244 Ga0316577_10028073 3300031733 Bacteria 3139
245 Ga0316583_10002285 3300032133 Bacteria 6599
246 Ga0316583_10002759 3300032133 Bacteria 6145
247 Ga0316583_10024163 3300032133 Bacteria 2170
248 Ga0316585_10007174 3300032137 Bacteria 3205
249 Ga0316580_10005151 3300032139 Bacteria 3804
250 Ga0307510_10011297 3300033180 Bacteria 10610
251 Ga0373945_0021214 3300035116 Bacteria 2231
252 Ga0316574_0001673 3300035398 Bacteria 10690
253 Ga0316574_0061015 3300035398 Bacteria 2367
254 Ga0316574_0095455 3300035398 Bacteria 1900
255 Ga0373937_0005781 3300036401 Bacteria 10634
256 Ga0316582_0006613 3300036647 Bacteria 6108
257 Ga0316582_0011107 3300036647 Bacteria 4969
258 Ga0316582_0011962 3300036647 Bacteria 4825
259 Ga0316584_0015602 3300036712 Bacteria 5434
260 Ga0316584_0101050 3300036712 Bacteria 2159
261 Ga0395899_0000352 3300037312 Bacteria 56166
262 Ga0395899_0064766 3300037312 Bacteria 2686
263 Ga0395900_0001013 3300037418 Bacteria 36249
264 Ga0395900_0290259 3300037418 Bacteria 1624
265 Ga0395898_0008246 3300037466 Bacteria 11016
266 Ga0395905_0136028 3300037471 Bacteria 2311
267 Ga0436364_0551532 3300037853 Bacteria 2762
268 Ga0436364_0825804 3300037853 Bacteria 3969
269 Ga0436364_1364659 3300037853 Bacteria 1684
270 Ga0395901_0000047 3300038443 Bacteria 175221
271 Ga0395901_0049650 3300038443 Bacteria 4359
272 Ga0395901_0180052 3300038443 Bacteria 2217
273 Ga0395901_0321347 3300038443 Bacteria 1601
274 Ga0451577_0225145 3300042876 Bacteria 1695
275 Ga0453684_0009339 3300044712 Bacteria 17191
276 Ga0453684_0094182 3300044712 Bacteria 3686
277 Ga0453684_0101290 3300044712 Bacteria 3524
278 Ga0453684_0117873 3300044712 Bacteria 3212
279 Ga0451576_0298197 3300045051 Bacteria 1685
280 Ga0466967_0078957 3300045976 Bacteria 2966
281 Ga0495629_0039847 3300046459 Bacteria 3306
282 Ga0495580_0000256 3300046472 Bacteria 42387
283 Ga0495580_0059344 3300046472 Bacteria 2689
284 Ga0495585_0078208 3300046492 Bacteria 1795
285 Ga0495648_0040563 3300046524 Bacteria 2951
286 Ga0495625_0000722 3300046660 Bacteria 46349
287 Ga0495625_0006027 3300046660 Bacteria 10890
288 Ga0495669_0009978 3300046684 Bacteria 4015
289 Ga0495602_0008240 3300048088 Bacteria 10885
290 Ga0496101_0019280 3300048904 Bacteria 4654
291 Ga0496102_0014270 3300048905 Bacteria 6903
292 Ga0496102_0115003 3300048905 Bacteria 2510
293 Ga0496103_0000845 3300048906 Bacteria 22406
294 Ga0496104_0079788 3300048907 Bacteria 3120
295 Ga0496105_0004376 3300048908 Bacteria 10634
296 Ga0496106_0040684 3300048909 Bacteria 3481
297 Ga0496107_0038803 3300048910 Bacteria 3415
298 Ga0496107_0097094 3300048910 Bacteria 2157
299 Ga0496108_0001656 3300048911 Bacteria 17657
300 Ga0496110_0007777 3300048913 Bacteria 8587
301 Ga0496110_0029849 3300048913 Bacteria 4698
302 Ga0496112_0045363 3300048915 Bacteria 4309
303 Ga0496115_0005068 3300048918 Bacteria 9579
304 Ga0496117_0023987 3300048920 Bacteria 4842
305 Ga0496118_0070705 3300048921 Bacteria 2517
306 Ga0496121_0010120 3300048924 Bacteria 10689
307 Ga0496122_0006779 3300048925 Bacteria 13015
308 Ga0496123_0010015 3300048926 Bacteria 8444
309 Ga0496126_0003513 3300048929 Bacteria 19729
310 Ga0501037_0109400 3300049573 Bacteria 1991
311 Ga0501072_0189677 3300049588 Bacteria 1640
312 Ga0501079_0062280 3300049741 Bacteria 2878
313 Ga0501080_0097093 3300049742 Bacteria 2736
314 nmdc:mga05p37_23466_c1 3300050507 Bacteria 7485
315 nmdc:mga05p37_6665_c1 3300050507 Bacteria 13619
316 nmdc:mga0n895_15265_c1 3300050512 Bacteria 6998
317 nmdc:mga0rr50_63860_c1 3300050513 Bacteria 2782
318 nmdc:mga08x19_85219_c1 3300050514 Bacteria 2079
319 nmdc:mga0a205_25419_c1 3300050515 Bacteria 5642
320 nmdc:mga0a205_5264_c1 3300050515 Bacteria 11649
321 Ga0495601_0045081 3300053077 Bacteria 2772
322 Ga0495595_0011534 3300053084 Bacteria 3696
323 Ga0495619_0039388 3300053085 Bacteria 3085
324 Ga0500566_0008672 3300053094 Bacteria 6013
325 Ga0500595_000990 3300053119 Bacteria 15942
326 Ga0500645_000005 3300053730 Bacteria 284466
327 Ga0501082_0216041 3300060353 Bacteria 1668
328 2513593480 2513237087 Bacteria 5817514
329 2739250147 2738543013 Bacteria 5618633
330 2828309140 2828305725 Bacteria 4916900
331 2885430565 2885429604 Bacteria 3642894
332 Ga0316576_10034419
333 JGI24752J21851_1000513
334 JGI24750J21931_1000683
335 JGI24738J21930_10002354
336 JGI26128J50194_1000225
337 Ga0065165_1022730
338 Ga0070658_10000504
339 Ga0070658_10002607
340 Ga0070658_10012910
341 Ga0070676_10009093
342 Ga0070690_100000338
343 Ga0070690_100000377
344 Ga0070670_100001551
345 Ga0070670_100007393
346 Ga0070670_100039742
347 Ga0070670_100095844
348 Ga0070666_10000069
349 Ga0070666_10003257
350 Ga0070666_10059794
351 Ga0068868_100319857
352 Ga0070660_100000376
353 Ga0070660_100007375
354 Ga0070660_100138049
355 Ga0070660_100144030
356 Ga0070689_100002547
357 Ga0070661_100045361
358 Ga0070661_100067092
359 Ga0070692_10000313
360 Ga0070692_10002941
361 Ga0070692_10038669
362 Ga0070692_10076083
363 Ga0070668_100020865
364 Ga0070668_100197229
365 Ga0070669_100000167
366 Ga0070669_100188441
367 Ga0070675_100179567
368 Ga0070671_100016427
369 Ga0070674_100047800
370 Ga0070673_100172124
371 Ga0070688_100022345
372 Ga0070688_100036928
373 Ga0070659_100152567
374 Ga0070667_100001637
375 Ga0070667_100082712
376 Ga0070667_100277573
377 Ga0070694_100025019
378 Ga0070708_100004799
379 Ga0070708_100020161
380 Ga0070708_100082507
381 Ga0070663_100000840
382 Ga0070663_100009303
383 Ga0070663_100129714
384 Ga0070662_100001750
385 Ga0070662_100053031
386 Ga0068867_100001886
387 Ga0070685_10000036
388 Ga0070706_100001720
389 Ga0070706_100005085
390 Ga0070706_100005384
391 Ga0070706_100027046
392 Ga0070707_100000742
393 Ga0070698_100002977
394 Ga0070698_100019339
395 Ga0070698_100136467
396 Ga0070699_100165002
397 Ga0070679_100108418
398 Ga0070697_100015114
399 Ga0070697_100054287
400 Ga0070697_100077174
401 Ga0070686_100000045
402 Ga0070695_100011774
403 Ga0070696_100029842
404 Ga0070665_100000042
405 Ga0070665_100010339
406 Ga0070665_100067963
407 Ga0070665_100075735
408 Ga0070665_100087031
409 Ga0070664_100004998
410 Ga0070664_100022547
411 Ga0070664_100177188
412 Ga0068856_100003084
413 Ga0068856_100398511
414 Ga0070702_100023267
415 Ga0068859_100005586
416 Ga0068859_100013033
417 Ga0068859_100021076
418 Ga0068859_100042976
419 Ga0068859_100087959
420 Ga0068864_100005713
421 Ga0068864_100017449
422 Ga0068866_10016756
423 Ga0068861_100046865
424 Ga0068863_100069007
425 Ga0068858_100002954
426 Ga0068860_100000182
427 Ga0068860_100006694
428 Ga0068860_100010832
429 Ga0068862_100010302
430 Ga0068862_100054086
431 Ga0068862_100076054
432 Ga0081455_10028908
433 Ga0075433_10001645
434 Ga0075434_100001071
435 Ga0075434_100008103
436 Ga0075436_100094873
437 Ga0097620_100005587
438 Ga0097620_100013033
439 Ga0097620_100021076
440 Ga0097620_100042976
441 Ga0097620_100087955
442 Ga0075435_100106875
443 Ga0105240_10005506
444 Ga0105240_10271895
445 Ga0105240_10313152
446 Ga0111539_10097748
447 Ga0105245_10193542
448 Ga0105247_10083056
449 Ga0114129_10003576
450 Ga0114129_10027443
451 Ga0105248_10000735
452 Ga0105248_10025403
453 Ga0105248_10338162
454 Ga0105249_10000012
455 Ga0105249_10019903
456 Ga0157373_10025666
457 Ga0157370_10120503
458 Ga0157370_10183049
459 Ga0157370_10184602
460 Ga0157369_10004588
461 Ga0157374_10101254
462 Ga0157378_10357063
463 Ga0163162_10009294
464 Ga0163162_10052252
465 Ga0157375_10003169
466 Ga0157375_10049308
467 Ga0163163_10002101
468 Ga0163163_10023254
469 Ga0163163_10091845
470 Ga0157380_10003404
471 Ga0157380_10008670
472 Ga0157379_10002857
473 Ga0157376_10028089
474 Ga0157376_10163239
475 Ga0207697_10027260
476 Ga0207656_10003545
477 Ga0207642_10010989
478 Ga0207710_10043383
479 Ga0207688_10109010
480 Ga0207680_10000012
481 Ga0207680_10003249
482 Ga0207680_10034291
483 Ga0207680_10167767
484 Ga0207645_10004007
485 Ga0207643_10012156
486 Ga0207705_10000135
487 Ga0207705_10000469
488 Ga0207705_10034001
489 Ga0207705_10096414
490 Ga0207684_10013715
491 Ga0207684_10029738
492 Ga0207684_10064352
493 Ga0207654_10001493
494 Ga0207707_10342099
495 Ga0207695_10009881
496 Ga0207671_10000358
497 Ga0207663_10056316
498 Ga0207657_10000864
499 Ga0207657_10001741
500 Ga0207657_10032890
501 Ga0207657_10129272
502 Ga0207657_10154114
503 Ga0207681_10000076
504 Ga0207681_10085230
505 Ga0207659_10021871
506 Ga0207706_10002985
507 Ga0207706_10006284
508 Ga0207706_10044794
509 Ga0207670_10049179
510 Ga0207704_10035087
511 Ga0207691_10015698
512 Ga0207691_10074059
513 Ga0207691_10129574
514 Ga0207711_10001922
515 Ga0207711_10077870
516 Ga0207711_10121695
517 Ga0207711_10232197
518 Ga0207679_10031064
519 Ga0207667_10000829
520 Ga0207712_10000021
521 Ga0207640_10067936
522 Ga0207658_10003747
523 Ga0207658_10171351
524 Ga0207658_10271262
525 Ga0207703_10004856
526 Ga0207703_10004859
527 Ga0207678_10004264
528 Ga0207678_10014924
529 Ga0207678_10017323
530 Ga0207678_10075550
531 Ga0207708_10109963
532 Ga0207708_10284730
533 Ga0207702_10003254
534 Ga0207702_10009981
535 Ga0207648_10004318
536 Ga0207676_10078955
537 Ga0207676_10118582
538 Ga0207676_10235891
539 Ga0207675_100004395
540 Ga0207675_100028787
541 Ga0207683_10002553
542 Ga0207683_10046287
543 Ga0207698_10008213
544 Ga0209999_1002672
545 Ga0209970_1000120
546 Ga0209983_1000916
547 Ga0209971_1000399
548 Ga0209966_1000547
549 Ga0209974_10008879
550 Ga0268266_10000054
551 Ga0268266_10023176
552 Ga0268266_10038961
553 Ga0268266_10156980
554 Ga0268265_10012378
555 Ga0268265_10028067
556 Ga0268265_10249397
557 Ga0268264_10000074
558 Ga0268264_10001881
559 Ga0268264_10020358
560 Ga0265328_10039572
561 Ga0307513_10033806
562 Ga0307513_10109989
563 Ga0307509_10034168
564 Ga0316575_10009764
565 Ga0316579_10028812
566 Ga0316576_10000138
567 Ga0316576_10010080
568 Ga0316576_10012147
569 Ga0316576_10039854
570 Ga0316576_10103029
571 Ga0316576_10106381
572 Ga0316578_10001764
573 Ga0316578_10037615
574 Ga0316578_10039931
575 Ga0316577_10028073
576 Ga0316583_10002285
577 Ga0316583_10002759
578 Ga0316583_10024163
579 Ga0316585_10007174
580 Ga0316580_10005151
581 Ga0307510_10011297
582 Ga0373945_0021214
583 Ga0316574_0001673
584 Ga0316574_0061015
585 Ga0316574_0095455
586 Ga0373937_0005781
587 Ga0316582_0006613
588 Ga0316582_0011107
589 Ga0316582_0011962
590 Ga0316584_0015602
591 Ga0316584_0101050
592 Ga0395899_0000352
593 Ga0395899_0064766
594 Ga0395900_0001013
595 Ga0395900_0290259
596 Ga0395898_0008246
597 Ga0395905_0136028
598 Ga0436364_0551532
599 Ga0436364_0825804
600 Ga0436364_1364659
601 Ga0395901_0000047
602 Ga0395901_0049650
603 Ga0395901_0180052
604 Ga0395901_0321347
605 Ga0451577_0225145
606 Ga0453684_0009339
607 Ga0453684_0094182
608 Ga0453684_0101290
609 Ga0453684_0117873
610 Ga0451576_0298197
611 Ga0466967_0078957
612 Ga0495629_0039847
613 Ga0495580_0000256
614 Ga0495580_0059344
615 Ga0495585_0078208
616 Ga0495648_0040563
617 Ga0495625_0000722
618 Ga0495625_0006027
619 Ga0495669_0009978
620 Ga0495602_0008240
621 Ga0496101_0019280
622 Ga0496102_0014270
623 Ga0496102_0115003
624 Ga0496103_0000845
625 Ga0496104_0079788
626 Ga0496105_0004376
627 Ga0496106_0040684
628 Ga0496107_0038803
629 Ga0496107_0097094
630 Ga0496108_0001656
631 Ga0496110_0007777
632 Ga0496110_0029849
633 Ga0496112_0045363
634 Ga0496115_0005068
635 Ga0496117_0023987
636 Ga0496118_0070705
637 Ga0496121_0010120
638 Ga0496122_0006779
639 Ga0496123_0010015
640 Ga0496126_0003513
641 Ga0501037_0109400
642 Ga0501072_0189677
643 Ga0501079_0062280
644 Ga0501080_0097093
645 nmdc:mga05p37_23466_c1
646 nmdc:mga05p37_6665_c1
647 nmdc:mga0n895_15265_c1
648 nmdc:mga0rr50_63860_c1
649 nmdc:mga08x19_85219_c1
650 nmdc:mga0a205_25419_c1
651 nmdc:mga0a205_5264_c1
652 Ga0495601_0045081
653 Ga0495595_0011534
654 Ga0495619_0039388
655 Ga0500566_0008672
656 Ga0500595_000990
657 Ga0500645_000005
658 Ga0501082_0216041
659 2513593480
660 2739250147
661 2828309140
662 2885430565

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13286

HD_assoc

Phosphohydrolase-associated domain

321

434

0.88

PF01966

HD

HD domain

81

225

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dqb-assembly1.cif.gz_E crystal structure of dntp triphosphohydrolase from thermus thermophilus hb8, which is homologous to dgtp triphosphohydrolase 0.8426 24 373
2dqb-assembly1.cif.gz_B crystal structure of dntp triphosphohydrolase from thermus thermophilus hb8, which is homologous to dgtp triphosphohydrolase 0.8318 24 373
2dqb-assembly1.cif.gz_F crystal structure of dntp triphosphohydrolase from thermus thermophilus hb8, which is homologous to dgtp triphosphohydrolase 0.8312 22 373
2dqb-assembly1.cif.gz_A crystal structure of dntp triphosphohydrolase from thermus thermophilus hb8, which is homologous to dgtp triphosphohydrolase 0.8295 24 373
2dqb-assembly1.cif.gz_C crystal structure of dntp triphosphohydrolase from thermus thermophilus hb8, which is homologous to dgtp triphosphohydrolase 0.8275 24 373
ID Description Score Start End Superfamily
2dqbE00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.8436 24 373 1.10.3210.10
2dqbE00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.8056 24 373 1.10.3210.10
af_P15723_1_151_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6617 41 133 1.10.3210.10
af_P9WNY7_7_418_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6597 15 367 1.10.3210.10
af_Q2FZ08_320_474_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6341 65 196 1.10.3210.10
ID Description Score Start End GO Terms
AF-A0A527Y376-F1-model_v4 Deoxyguanosinetriphosphate triphosphohydrolase 0.9802 137 319 GO:0016787
AF-A0A520I2P8-F1-model_v4 Deoxyguanosinetriphosphate triphosphohydrolase 0.975 184 384 GO:0016787
AF-A0A7Y2XZC4-F1-model_v4 Deoxyguanosinetriphosphate triphosphohydrolase 0.9642 193 376 GO:0016787
AF-A0A7V0RL90-F1-model_v4 Deoxyguanosinetriphosphate triphosphohydrolase 0.9641 144 373
AF-A0A520I2P8-F1-model_v4 Deoxyguanosinetriphosphate triphosphohydrolase 0.9608 184 384 GO:0016787

Map