F410552

General Info

Members Datasets Scaffolds Average Seq Length
331 171 662 378

Family's Representative Sequence

Representative Sequence 3300031507|Ga0307509_10125174|Ga0307509_101251742
Length 433
Sequence MREQALPKPPRPCSNKESRYHADFNLATKPGCNIQYYPRGVPVASPASPPEDQRQLNRAILALEDGTVFEGDSFGAPVQRAGEVVFNTSLTGYQEIFTDPSYAGQIVVLTNPQIGNYGANEDDNESVRPFIEGLIVRDFSPISSNWRAGESAQEFLTRNGIPAGSGIDTRALVRRLRMQGVMRGVLSSIEGARAEDLIQQARNIPSMAGLDLASRVTTAESYHWSEDVKACSPSEILTASTAAPRHVVAYDFGIKRNILRRLAHIGCHTTVVPASTSAEDVLALKPDGVFLSNGPGDPEPLEFAAAQMRKITGKVPIFGICLGHQVLGLAYGGKTYKLKFGHRGGNHPVLNQLTNKVEITAQNHGFCVDPDSLKSSDIELTHINLNDNTLEGFRHRSEPVFCVQYHPEAAPGPHDSQYLFDDFRKLIDDSKPS

Samples

Sample ID Description Type Environment
1 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
97 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
98 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
99 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
100 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
101 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
102 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
105 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
111 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
113 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
114 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
115 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
116 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
121 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
122 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
123 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
126 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
127 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
128 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
129 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
130 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
131 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
132 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
133 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
134 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
135 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
138 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
139 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
140 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
147 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
148 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
149 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
150 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
151 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
152 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
155 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
159 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
160 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
161 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
162 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
163 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
164 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane
165 2831426010 Nostoc sp. 106C Isolate Unclassified
166 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
167 2849660919 Nostoc sp. T09 Isolate Unclassified
168 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
169 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified
170 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
171 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.28
Metatranscriptomes 0
Isolates 2.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 0.6
Rhizosphere 90.33
Stem 0
Stem Tuber 0
Unclassified 1.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307509_10125174 3300031507 Bacteria 2538
2 JGI25405J52794_10000171 3300003911 Bacteria 8097
3 Ga0065715_10099351 3300005293 Bacteria 3422
4 Ga0070658_10015637 3300005327 Bacteria 6069
5 Ga0070683_100013192 3300005329 Bacteria 7197
6 Ga0070690_100155427 3300005330 Bacteria 1563
7 Ga0070666_10150286 3300005335 Bacteria 1625
8 Ga0070680_100030009 3300005336 Bacteria 4366
9 Ga0068868_100057699 3300005338 Bacteria 3067
10 Ga0070660_100039905 3300005339 Bacteria 3569
11 Ga0070660_100063865 3300005339 Bacteria 2863
12 Ga0070691_10020183 3300005341 Bacteria 3078
13 Ga0070667_100137045 3300005367 Bacteria 2140
14 Ga0070713_100237187 3300005436 Bacteria 1660
15 Ga0070681_10005636 3300005458 Bacteria 12098
16 Ga0070681_10105366 3300005458 Bacteria 2762
17 Ga0070681_10124523 3300005458 Bacteria 2510
18 Ga0070706_100064341 3300005467 Bacteria 3390
19 Ga0070706_100143171 3300005467 Bacteria 2232
20 Ga0070698_100155804 3300005471 Bacteria 2230
21 Ga0070679_100004248 3300005530 Bacteria 13223
22 Ga0070679_100056904 3300005530 Bacteria 3897
23 Ga0070684_100103034 3300005535 Bacteria 2552
24 Ga0070684_100182836 3300005535 Bacteria 1906
25 Ga0068853_100224567 3300005539 Bacteria 1716
26 Ga0070672_100009683 3300005543 Bacteria 6652
27 Ga0068855_100002936 3300005563 Bacteria 20841
28 Ga0068855_100037452 3300005563 Bacteria 5766
29 Ga0068855_100109576 3300005563 Bacteria 3171
30 Ga0068855_100360976 3300005563 Bacteria 1598
31 Ga0068857_100000894 3300005577 Bacteria 22550
32 Ga0068857_100010760 3300005577 Bacteria 7963
33 Ga0068856_100005113 3300005614 Bacteria 12961
34 Ga0068856_100046682 3300005614 Bacteria 4265
35 Ga0068856_100104791 3300005614 Bacteria 2822
36 Ga0068856_100121518 3300005614 Bacteria 2613
37 Ga0070702_100046395 3300005615 Bacteria 2463
38 Ga0068852_100393029 3300005616 Bacteria 1363
39 Ga0068863_100070946 3300005841 Bacteria 3295
40 Ga0068858_100007946 3300005842 Bacteria 10223
41 Ga0068858_100227297 3300005842 Bacteria 1768
42 Ga0068858_100420394 3300005842 Bacteria 1285
43 Ga0081455_10000246 3300005937 Bacteria 70584
44 Ga0081455_10002413 3300005937 Bacteria 22288
45 Ga0081455_10019640 3300005937 Bacteria 6383
46 Ga0081538_10003469 3300005981 Bacteria 14897
47 Ga0081538_10005114 3300005981 Bacteria 11908
48 Ga0081538_10006704 3300005981 Bacteria 10082
49 Ga0081538_10007306 3300005981 Bacteria 9572
50 Ga0081538_10034056 3300005981 Bacteria 3376
51 Ga0081538_10046084 3300005981 Bacteria 2694
52 Ga0081540_1009072 3300005983 Bacteria 6872
53 Ga0081539_10012012 3300005985 Bacteria 6741
54 Ga0081539_10036050 3300005985 Bacteria 2965
55 Ga0070717_10003732 3300006028 Bacteria 10941
56 Ga0070717_10028710 3300006028 Bacteria 4456
57 Ga0097621_100033015 3300006237 Bacteria 4118
58 Ga0097621_100086278 3300006237 Bacteria 2619
59 Ga0097621_100104723 3300006237 Bacteria 2384
60 Ga0097621_100195245 3300006237 Bacteria 1755
61 Ga0068871_100358231 3300006358 Bacteria 1292
62 Ga0075428_100003472 3300006844 Bacteria 17240
63 Ga0075430_100041674 3300006846 Bacteria 3884
64 Ga0075430_100252834 3300006846 Bacteria 1460
65 Ga0075431_100000521 3300006847 Bacteria 32261
66 Ga0075431_100034945 3300006847 Bacteria 5177
67 Ga0075433_10019947 3300006852 Bacteria 5598
68 Ga0075433_10376959 3300006852 Bacteria 1253
69 Ga0075434_100016880 3300006871 Bacteria 7022
70 Ga0075435_100008288 3300007076 Bacteria 7448
71 Ga0105240_10001321 3300009093 Bacteria 42794
72 Ga0105240_10005698 3300009093 Bacteria 18488
73 Ga0105240_10009392 3300009093 Bacteria 13852
74 Ga0105240_10010506 3300009093 Bacteria 13012
75 Ga0105240_10028511 3300009093 Bacteria 7291
76 Ga0105240_10040940 3300009093 Bacteria 5919
77 Ga0105240_10048788 3300009093 Bacteria 5349
78 Ga0105240_10085840 3300009093 Bacteria 3856
79 Ga0111539_10007046 3300009094 Bacteria 14426
80 Ga0105245_10000501 3300009098 Bacteria 35913
81 Ga0105245_10001332 3300009098 Bacteria 22354
82 Ga0105245_10029138 3300009098 Bacteria 4875
83 Ga0105245_10075210 3300009098 Bacteria 3075
84 Ga0105245_10103427 3300009098 Bacteria 2639
85 Ga0105245_10221763 3300009098 Bacteria 1825
86 Ga0114129_10127587 3300009147 Bacteria 3497
87 Ga0114129_10190044 3300009147 Bacteria 2789
88 Ga0114129_10199008 3300009147 Bacteria 2715
89 Ga0105241_10013622 3300009174 Bacteria 5958
90 Ga0105241_10042638 3300009174 Bacteria 3434
91 Ga0105242_10003797 3300009176 Bacteria 11745
92 Ga0105242_10044180 3300009176 Bacteria 3607
93 Ga0105242_10152876 3300009176 Bacteria 2014
94 Ga0105242_10172417 3300009176 Bacteria 1902
95 Ga0105242_10440401 3300009176 Bacteria 1226
96 Ga0105248_10037410 3300009177 Bacteria 5430
97 Ga0105248_10076467 3300009177 Bacteria 3763
98 Ga0105248_10088602 3300009177 Bacteria 3483
99 Ga0105248_10092125 3300009177 Bacteria 3413
100 Ga0105248_10144774 3300009177 Bacteria 2681
101 Ga0105248_10284640 3300009177 Bacteria 1861
102 Ga0105237_10080717 3300009545 Bacteria 3243
103 Ga0105237_10121426 3300009545 Bacteria 2607
104 Ga0105237_10134049 3300009545 Bacteria 2471
105 Ga0105237_10148565 3300009545 Bacteria 2339
106 Ga0105237_10169760 3300009545 Bacteria 2181
107 Ga0105237_10201436 3300009545 Bacteria 1991
108 Ga0105237_10465115 3300009545 Bacteria 1271
109 Ga0105238_10001543 3300009551 Bacteria 23080
110 Ga0105238_10005041 3300009551 Bacteria 13057
111 Ga0105238_10008730 3300009551 Bacteria 10137
112 Ga0105238_10020379 3300009551 Bacteria 6750
113 Ga0105238_10070307 3300009551 Bacteria 3499
114 Ga0105238_10113263 3300009551 Bacteria 2692
115 Ga0105238_10127979 3300009551 Bacteria 2518
116 Ga0105238_10130662 3300009551 Bacteria 2489
117 Ga0099796_10005571 3300010159 Bacteria 3151
118 Ga0105239_10048314 3300010375 Bacteria 4666
119 Ga0105239_10063788 3300010375 Bacteria 4044
120 Ga0105239_10076145 3300010375 Bacteria 3690
121 Ga0105246_10004387 3300011119 Bacteria 8586
122 Ga0105246_10006670 3300011119 Bacteria 7059
123 Ga0105246_10070689 3300011119 Bacteria 2455
124 Ga0157370_10002850 3300013104 Bacteria 20653
125 Ga0157370_10063860 3300013104 Bacteria 3486
126 Ga0157369_10013990 3300013105 Bacteria 9068
127 Ga0157374_10054037 3300013296 Bacteria 3746
128 Ga0157374_10147291 3300013296 Bacteria 2287
129 Ga0157374_10525653 3300013296 Bacteria 1189
130 Ga0157378_10008946 3300013297 Bacteria 8716
131 Ga0163162_10018636 3300013306 Bacteria 6801
132 Ga0163162_10066524 3300013306 Bacteria 3653
133 Ga0163162_10242890 3300013306 Bacteria 1932
134 Ga0163162_10574825 3300013306 Bacteria 1254
135 Ga0157375_10008775 3300013308 Bacteria 8859
136 Ga0163163_10003028 3300014325 Bacteria 14239
137 Ga0163163_10009482 3300014325 Bacteria 8692
138 Ga0163163_10148025 3300014325 Bacteria 2392
139 Ga0163163_10158507 3300014325 Bacteria 2308
140 Ga0163163_10161188 3300014325 Bacteria 2288
141 Ga0163163_10163625 3300014325 Bacteria 2271
142 Ga0157379_10078410 3300014968 Bacteria 2958
143 Ga0157379_10096298 3300014968 Bacteria 2656
144 Ga0157379_10151603 3300014968 Bacteria 2091
145 Ga0157376_10108530 3300014969 Bacteria 2438
146 Ga0157376_10238185 3300014969 Bacteria 1694
147 Ga0213872_10000638 3300021361 Bacteria 26483
148 Ga0213876_10000493 3300021384 Bacteria 30889
149 Ga0213876_10050270 3300021384 Bacteria 2203
150 Ga0213876_10091939 3300021384 Bacteria 1607
151 Ga0213875_10000065 3300021388 Bacteria 128682
152 Ga0213875_10001456 3300021388 Bacteria 15324
153 Ga0213875_10002531 3300021388 Bacteria 10904
154 Ga0213875_10004619 3300021388 Bacteria 7514
155 Ga0207680_10050535 3300025903 Bacteria 2481
156 Ga0207685_10009373 3300025905 Bacteria 2841
157 Ga0207684_10051095 3300025910 Bacteria 3507
158 Ga0207654_10022129 3300025911 Bacteria 3388
159 Ga0207654_10072560 3300025911 Bacteria 2050
160 Ga0207707_10005344 3300025912 Bacteria 11221
161 Ga0207707_10011060 3300025912 Bacteria 7849
162 Ga0207707_10191235 3300025912 Bacteria 1786
163 Ga0207695_10002384 3300025913 Bacteria 27871
164 Ga0207695_10002906 3300025913 Bacteria 24790
165 Ga0207695_10004810 3300025913 Bacteria 18275
166 Ga0207695_10031332 3300025913 Bacteria 5834
167 Ga0207695_10052610 3300025913 Bacteria 4264
168 Ga0207695_10091801 3300025913 Bacteria 3049
169 Ga0207695_10127497 3300025913 Bacteria 2505
170 Ga0207671_10014679 3300025914 Bacteria 6179
171 Ga0207671_10054511 3300025914 Bacteria 2962
172 Ga0207671_10097586 3300025914 Bacteria 2222
173 Ga0207671_10126151 3300025914 Bacteria 1961
174 Ga0207663_10231404 3300025916 Bacteria 1350
175 Ga0207660_10030955 3300025917 Bacteria 3681
176 Ga0207657_10004383 3300025919 Bacteria 14939
177 Ga0207649_10073323 3300025920 Bacteria 2193
178 Ga0207652_10102809 3300025921 Bacteria 2525
179 Ga0207694_10001630 3300025924 Bacteria 18865
180 Ga0207694_10005627 3300025924 Bacteria 9608
181 Ga0207694_10087798 3300025924 Bacteria 2451
182 Ga0207694_10128929 3300025924 Bacteria 2026
183 Ga0207694_10209816 3300025924 Bacteria 1586
184 Ga0207694_10232608 3300025924 Bacteria 1505
185 Ga0207687_10007346 3300025927 Bacteria 7264
186 Ga0207687_10016157 3300025927 Bacteria 4901
187 Ga0207687_10061755 3300025927 Bacteria 2647
188 Ga0207700_10102897 3300025928 Bacteria 2282
189 Ga0207644_10068637 3300025931 Bacteria 2587
190 Ga0207706_10049506 3300025933 Bacteria 3713
191 Ga0207686_10051595 3300025934 Bacteria 2563
192 Ga0207686_10108009 3300025934 Bacteria 1871
193 Ga0207704_10109190 3300025938 Bacteria 1865
194 Ga0207711_10009745 3300025941 Bacteria 7990
195 Ga0207711_10010187 3300025941 Bacteria 7805
196 Ga0207711_10060474 3300025941 Bacteria 3265
197 Ga0207711_10233420 3300025941 Bacteria 1685
198 Ga0207661_10004788 3300025944 Bacteria 9477
199 Ga0207661_10009967 3300025944 Bacteria 6826
200 Ga0207661_10154746 3300025944 Bacteria 1984
201 Ga0207667_10001948 3300025949 Bacteria 25866
202 Ga0207667_10012924 3300025949 Bacteria 9588
203 Ga0207667_10091183 3300025949 Bacteria 3148
204 Ga0207667_10130272 3300025949 Bacteria 2591
205 Ga0207703_10012927 3300026035 Bacteria 6506
206 Ga0207703_10025080 3300026035 Bacteria 4690
207 Ga0207639_10238707 3300026041 Bacteria 1579
208 Ga0207702_10020675 3300026078 Bacteria 5446
209 Ga0207641_10014179 3300026088 Bacteria 6531
210 Ga0207648_10133015 3300026089 Bacteria 2190
211 Ga0207648_10318928 3300026089 Bacteria 1396
212 Ga0207674_10000634 3300026116 Bacteria 45790
213 Ga0207674_10002493 3300026116 Bacteria 23214
214 Ga0207674_10004165 3300026116 Bacteria 17494
215 Ga0207698_10100104 3300026142 Bacteria 2400
216 Ga0268266_10047582 3300028379 Bacteria 3675
217 Ga0268264_10037362 3300028381 Bacteria 4004
218 Ga0265318_10000424 3300028577 Bacteria 32313
219 Ga0265330_10002413 3300031235 Bacteria 10204
220 Ga0265320_10000131 3300031240 Bacteria 64956
221 Ga0265325_10067686 3300031241 Bacteria 1799
222 Ga0265329_10002585 3300031242 Bacteria 8170
223 Ga0265340_10026043 3300031247 Bacteria 2959
224 Ga0265331_10000246 3300031250 Bacteria 64957
225 Ga0265316_10020631 3300031344 Bacteria 5604
226 Ga0265313_10001486 3300031595 Bacteria 21862
227 Ga0265313_10035640 3300031595 Bacteria 2504
228 Ga0316579_10012797 3300031691 Bacteria 3599
229 Ga0265314_10007071 3300031711 Bacteria 9794
230 Ga0265314_10010255 3300031711 Bacteria 7836
231 Ga0265342_10000218 3300031712 Bacteria 64950
232 Ga0307416_100030438 3300032002 Bacteria 4050
233 Ga0307414_10181644 3300032004 Bacteria 1693
234 Ga0373934_0002155 3300035086 Bacteria 7234
235 Ga0373934_0040297 3300035086 Bacteria 1842
236 Ga0373923_0023296 3300035111 Bacteria 2435
237 Ga0373954_0024213 3300035118 Bacteria 2767
238 Ga0373954_0098956 3300035118 Bacteria 1406
239 Ga0373955_0074716 3300035172 Bacteria 1903
240 Ga0373927_0000605 3300035695 Bacteria 27344
241 Ga0373933_0032960 3300035724 Bacteria 3011
242 Ga0373947_0002678 3300035725 Bacteria 10703
243 Ga0373947_0056580 3300035725 Bacteria 2371
244 Ga0373947_0135472 3300035725 Bacteria 1575
245 Ga0373937_0055389 3300036401 Bacteria 3640
246 Ga0373937_0060217 3300036401 Bacteria 3489
247 Ga0373937_0252818 3300036401 Bacteria 1661
248 Ga0316582_0033330 3300036647 Bacteria 3163
249 Ga0373925_0026496 3300037068 Bacteria 4242
250 Ga0373925_0067434 3300037068 Bacteria 2699
251 Ga0436364_0360109 3300037853 Bacteria 8183
252 Ga0436364_0647216 3300037853 Bacteria 2136
253 Ga0436364_0705781 3300037853 Bacteria 1465
254 Ga0436364_0741363 3300037853 Bacteria 50058
255 Ga0436364_0828992 3300037853 Bacteria 61632
256 Ga0436364_1251094 3300037853 Bacteria 3648
257 Ga0400490_06002 3300038726 Bacteria 1665
258 Ga0400490_42392 3300038726 Bacteria 46670
259 Ga0400491_23589 3300038727 Bacteria 2428
260 Ga0400488_00026 3300038741 Bacteria 3361
261 Ga0436365_0020205 3300039437 Bacteria 44037
262 Ga0436365_0175917 3300039437 Bacteria 2533
263 Ga0436365_1771260 3300039437 Bacteria 2501
264 Ga0436361_0267275 3300039447 Bacteria 52358
265 Ga0451577_0000153 3300042876 Bacteria 153271
266 Ga0451577_0000935 3300042876 Bacteria 42928
267 Ga0451577_0034158 3300042876 Bacteria 4586
268 Ga0451577_0321793 3300042876 Bacteria 1402
269 Ga0453683_0002259 3300044673 Bacteria 15215
270 Ga0453684_0000517 3300044712 Bacteria 147598
271 Ga0453684_0000696 3300044712 Bacteria 119520
272 Ga0453684_0002654 3300044712 Bacteria 42704
273 Ga0453684_0302633 3300044712 Bacteria 1817
274 Ga0495580_0001994 3300046472 Bacteria 17957
275 Ga0495580_0056840 3300046472 Bacteria 2755
276 Ga0495580_0143315 3300046472 Bacteria 1656
277 Ga0495630_0141615 3300046517 Unclassified 1829
278 Ga0495652_0010518 3300046529 Bacteria 8384
279 Ga0495586_0120864 3300046535 Bacteria 1463
280 Ga0495587_0017320 3300046536 Bacteria 4477
281 Ga0495657_0009641 3300046675 Bacteria 7309
282 Ga0495657_0051054 3300046675 Unclassified 2778
283 Ga0495613_0094314 3300046689 Bacteria 2166
284 Ga0495674_0314872 3300047319 Bacteria 1276
285 Ga0495680_0078679 3300047322 Unclassified 2495
286 Ga0495684_0147791 3300047471 Bacteria 1759
287 Ga0495684_0207473 3300047471 Bacteria 1442
288 Ga0495602_0007713 3300048088 Bacteria 11251
289 Ga0496115_0319085 3300048918 Bacteria 1271
290 Ga0501036_0020889 3300049572 Bacteria 5499
291 Ga0501037_0168701 3300049573 Bacteria 1557
292 Ga0501038_0077793 3300049574 Bacteria 2800
293 Ga0501039_0049501 3300049575 Bacteria 3248
294 Ga0501039_0122250 3300049575 Bacteria 2041
295 Ga0501042_0039387 3300049578 Bacteria 3358
296 Ga0501071_0024770 3300049587 Bacteria 4198
297 Ga0501075_0025597 3300049591 Bacteria 4335
298 Ga0501076_0010942 3300049592 Bacteria 6748
299 Ga0501076_0024462 3300049592 Bacteria 4668
300 Ga0501076_0098456 3300049592 Bacteria 2356
301 Ga0501257_015345 3300049686 Bacteria 1768
302 Ga0501079_0002293 3300049741 Bacteria 13833
303 Ga0501080_0057053 3300049742 Bacteria 3636
304 Ga0501081_0000465 3300049743 Bacteria 22458
305 nmdc:mga05p37_10536_c1 3300050507 Bacteria 10963
306 nmdc:mga05p37_113598_c1 3300050507 Bacteria 3330
307 nmdc:mga09592_52672_c1 3300050508 Bacteria 3435
308 nmdc:mga0qj67_14564_c1 3300050509 Bacteria 5947
309 nmdc:mga0qj67_310148_c1 3300050509 Bacteria 1278
310 nmdc:mga0qj67_473430_c1 3300050509 Bacteria 1008
311 nmdc:mga0qj67_55433_c1 3300050509 Bacteria 3140
312 nmdc:mga06r32_11232_c1 3300050510 Bacteria 8066
313 nmdc:mga06r32_1595_c1 3300050510 Bacteria 20426
314 nmdc:mga06r32_26269_c1 3300050510 Bacteria 5427
315 nmdc:mga08y16_28481_c1 3300050511 Bacteria 5889
316 nmdc:mga0a205_102899_c1 3300050515 Bacteria 2754
317 nmdc:mga0a205_15744_c1 3300050515 Bacteria 7069
318 Ga0495619_0074617 3300053085 Unclassified 2275
319 Ga0500568_0002107 3300053139 Bacteria 12009
320 Ga0501082_0045661 3300060353 Bacteria 3778
321 Ga0530510_0068844 3300061734 Bacteria 2568
322 Ga0530510_0157496 3300061734 Bacteria 1679
323 2617911913 2617270889 Bacteria 9064343
324 2787438971 2786546517 Bacteria 6614109
325 2831431508 2831426010 Bacteria 8662725
326 2848698902 2848694841 Bacteria 9205737
327 2849667421 2849660919 Bacteria 8251853
328 2913851030 2913844669 Bacteria 8381711
329 2913914659 2913912277 Bacteria 9037797
330 2913944526 2913939268 Bacteria 8559644
331 642600467 642555144 Bacteria 9059191
332 Ga0307509_10125174
333 JGI25405J52794_10000171
334 Ga0065715_10099351
335 Ga0070658_10015637
336 Ga0070683_100013192
337 Ga0070690_100155427
338 Ga0070666_10150286
339 Ga0070680_100030009
340 Ga0068868_100057699
341 Ga0070660_100039905
342 Ga0070660_100063865
343 Ga0070691_10020183
344 Ga0070667_100137045
345 Ga0070713_100237187
346 Ga0070681_10005636
347 Ga0070681_10105366
348 Ga0070681_10124523
349 Ga0070706_100064341
350 Ga0070706_100143171
351 Ga0070698_100155804
352 Ga0070679_100004248
353 Ga0070679_100056904
354 Ga0070684_100103034
355 Ga0070684_100182836
356 Ga0068853_100224567
357 Ga0070672_100009683
358 Ga0068855_100002936
359 Ga0068855_100037452
360 Ga0068855_100109576
361 Ga0068855_100360976
362 Ga0068857_100000894
363 Ga0068857_100010760
364 Ga0068856_100005113
365 Ga0068856_100046682
366 Ga0068856_100104791
367 Ga0068856_100121518
368 Ga0070702_100046395
369 Ga0068852_100393029
370 Ga0068863_100070946
371 Ga0068858_100007946
372 Ga0068858_100227297
373 Ga0068858_100420394
374 Ga0081455_10000246
375 Ga0081455_10002413
376 Ga0081455_10019640
377 Ga0081538_10003469
378 Ga0081538_10005114
379 Ga0081538_10006704
380 Ga0081538_10007306
381 Ga0081538_10034056
382 Ga0081538_10046084
383 Ga0081540_1009072
384 Ga0081539_10012012
385 Ga0081539_10036050
386 Ga0070717_10003732
387 Ga0070717_10028710
388 Ga0097621_100033015
389 Ga0097621_100086278
390 Ga0097621_100104723
391 Ga0097621_100195245
392 Ga0068871_100358231
393 Ga0075428_100003472
394 Ga0075430_100041674
395 Ga0075430_100252834
396 Ga0075431_100000521
397 Ga0075431_100034945
398 Ga0075433_10019947
399 Ga0075433_10376959
400 Ga0075434_100016880
401 Ga0075435_100008288
402 Ga0105240_10001321
403 Ga0105240_10005698
404 Ga0105240_10009392
405 Ga0105240_10010506
406 Ga0105240_10028511
407 Ga0105240_10040940
408 Ga0105240_10048788
409 Ga0105240_10085840
410 Ga0111539_10007046
411 Ga0105245_10000501
412 Ga0105245_10001332
413 Ga0105245_10029138
414 Ga0105245_10075210
415 Ga0105245_10103427
416 Ga0105245_10221763
417 Ga0114129_10127587
418 Ga0114129_10190044
419 Ga0114129_10199008
420 Ga0105241_10013622
421 Ga0105241_10042638
422 Ga0105242_10003797
423 Ga0105242_10044180
424 Ga0105242_10152876
425 Ga0105242_10172417
426 Ga0105242_10440401
427 Ga0105248_10037410
428 Ga0105248_10076467
429 Ga0105248_10088602
430 Ga0105248_10092125
431 Ga0105248_10144774
432 Ga0105248_10284640
433 Ga0105237_10080717
434 Ga0105237_10121426
435 Ga0105237_10134049
436 Ga0105237_10148565
437 Ga0105237_10169760
438 Ga0105237_10201436
439 Ga0105237_10465115
440 Ga0105238_10001543
441 Ga0105238_10005041
442 Ga0105238_10008730
443 Ga0105238_10020379
444 Ga0105238_10070307
445 Ga0105238_10113263
446 Ga0105238_10127979
447 Ga0105238_10130662
448 Ga0099796_10005571
449 Ga0105239_10048314
450 Ga0105239_10063788
451 Ga0105239_10076145
452 Ga0105246_10004387
453 Ga0105246_10006670
454 Ga0105246_10070689
455 Ga0157370_10002850
456 Ga0157370_10063860
457 Ga0157369_10013990
458 Ga0157374_10054037
459 Ga0157374_10147291
460 Ga0157374_10525653
461 Ga0157378_10008946
462 Ga0163162_10018636
463 Ga0163162_10066524
464 Ga0163162_10242890
465 Ga0163162_10574825
466 Ga0157375_10008775
467 Ga0163163_10003028
468 Ga0163163_10009482
469 Ga0163163_10148025
470 Ga0163163_10158507
471 Ga0163163_10161188
472 Ga0163163_10163625
473 Ga0157379_10078410
474 Ga0157379_10096298
475 Ga0157379_10151603
476 Ga0157376_10108530
477 Ga0157376_10238185
478 Ga0213872_10000638
479 Ga0213876_10000493
480 Ga0213876_10050270
481 Ga0213876_10091939
482 Ga0213875_10000065
483 Ga0213875_10001456
484 Ga0213875_10002531
485 Ga0213875_10004619
486 Ga0207680_10050535
487 Ga0207685_10009373
488 Ga0207684_10051095
489 Ga0207654_10022129
490 Ga0207654_10072560
491 Ga0207707_10005344
492 Ga0207707_10011060
493 Ga0207707_10191235
494 Ga0207695_10002384
495 Ga0207695_10002906
496 Ga0207695_10004810
497 Ga0207695_10031332
498 Ga0207695_10052610
499 Ga0207695_10091801
500 Ga0207695_10127497
501 Ga0207671_10014679
502 Ga0207671_10054511
503 Ga0207671_10097586
504 Ga0207671_10126151
505 Ga0207663_10231404
506 Ga0207660_10030955
507 Ga0207657_10004383
508 Ga0207649_10073323
509 Ga0207652_10102809
510 Ga0207694_10001630
511 Ga0207694_10005627
512 Ga0207694_10087798
513 Ga0207694_10128929
514 Ga0207694_10209816
515 Ga0207694_10232608
516 Ga0207687_10007346
517 Ga0207687_10016157
518 Ga0207687_10061755
519 Ga0207700_10102897
520 Ga0207644_10068637
521 Ga0207706_10049506
522 Ga0207686_10051595
523 Ga0207686_10108009
524 Ga0207704_10109190
525 Ga0207711_10009745
526 Ga0207711_10010187
527 Ga0207711_10060474
528 Ga0207711_10233420
529 Ga0207661_10004788
530 Ga0207661_10009967
531 Ga0207661_10154746
532 Ga0207667_10001948
533 Ga0207667_10012924
534 Ga0207667_10091183
535 Ga0207667_10130272
536 Ga0207703_10012927
537 Ga0207703_10025080
538 Ga0207639_10238707
539 Ga0207702_10020675
540 Ga0207641_10014179
541 Ga0207648_10133015
542 Ga0207648_10318928
543 Ga0207674_10000634
544 Ga0207674_10002493
545 Ga0207674_10004165
546 Ga0207698_10100104
547 Ga0268266_10047582
548 Ga0268264_10037362
549 Ga0265318_10000424
550 Ga0265330_10002413
551 Ga0265320_10000131
552 Ga0265325_10067686
553 Ga0265329_10002585
554 Ga0265340_10026043
555 Ga0265331_10000246
556 Ga0265316_10020631
557 Ga0265313_10001486
558 Ga0265313_10035640
559 Ga0316579_10012797
560 Ga0265314_10007071
561 Ga0265314_10010255
562 Ga0265342_10000218
563 Ga0307416_100030438
564 Ga0307414_10181644
565 Ga0373934_0002155
566 Ga0373934_0040297
567 Ga0373923_0023296
568 Ga0373954_0024213
569 Ga0373954_0098956
570 Ga0373955_0074716
571 Ga0373927_0000605
572 Ga0373933_0032960
573 Ga0373947_0002678
574 Ga0373947_0056580
575 Ga0373947_0135472
576 Ga0373937_0055389
577 Ga0373937_0060217
578 Ga0373937_0252818
579 Ga0316582_0033330
580 Ga0373925_0026496
581 Ga0373925_0067434
582 Ga0436364_0360109
583 Ga0436364_0647216
584 Ga0436364_0705781
585 Ga0436364_0741363
586 Ga0436364_0828992
587 Ga0436364_1251094
588 Ga0400490_06002
589 Ga0400490_42392
590 Ga0400491_23589
591 Ga0400488_00026
592 Ga0436365_0020205
593 Ga0436365_0175917
594 Ga0436365_1771260
595 Ga0436361_0267275
596 Ga0451577_0000153
597 Ga0451577_0000935
598 Ga0451577_0034158
599 Ga0451577_0321793
600 Ga0453683_0002259
601 Ga0453684_0000517
602 Ga0453684_0000696
603 Ga0453684_0002654
604 Ga0453684_0302633
605 Ga0495580_0001994
606 Ga0495580_0056840
607 Ga0495580_0143315
608 Ga0495630_0141615
609 Ga0495652_0010518
610 Ga0495586_0120864
611 Ga0495587_0017320
612 Ga0495657_0009641
613 Ga0495657_0051054
614 Ga0495613_0094314
615 Ga0495674_0314872
616 Ga0495680_0078679
617 Ga0495684_0147791
618 Ga0495684_0207473
619 Ga0495602_0007713
620 Ga0496115_0319085
621 Ga0501036_0020889
622 Ga0501037_0168701
623 Ga0501038_0077793
624 Ga0501039_0049501
625 Ga0501039_0122250
626 Ga0501042_0039387
627 Ga0501071_0024770
628 Ga0501075_0025597
629 Ga0501076_0010942
630 Ga0501076_0024462
631 Ga0501076_0098456
632 Ga0501257_015345
633 Ga0501079_0002293
634 Ga0501080_0057053
635 Ga0501081_0000465
636 nmdc:mga05p37_10536_c1
637 nmdc:mga05p37_113598_c1
638 nmdc:mga09592_52672_c1
639 nmdc:mga0qj67_14564_c1
640 nmdc:mga0qj67_310148_c1
641 nmdc:mga0qj67_473430_c1
642 nmdc:mga0qj67_55433_c1
643 nmdc:mga06r32_11232_c1
644 nmdc:mga06r32_1595_c1
645 nmdc:mga06r32_26269_c1
646 nmdc:mga08y16_28481_c1
647 nmdc:mga0a205_102899_c1
648 nmdc:mga0a205_15744_c1
649 Ga0495619_0074617
650 Ga0500568_0002107
651 Ga0501082_0045661
652 Ga0530510_0068844
653 Ga0530510_0157496
654 2617911913
655 2787438971
656 2831431508
657 2848698902
658 2849667421
659 2913851030
660 2913914659
661 2913944526
662 642600467

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00988

CPSase_sm_chain

Carbamoyl-phosphate synthase small chain, CPSase domain

61

186

0.99

PF00117

GATase

Glutamine amidotransferase class-I

248

426

0.96

PF07722

Peptidase_C26

Peptidase C26

300

381

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
1c30-assembly1.cif.gz_B crystal structure of carbamoyl phosphate synthetase: small subunit mutation c269s 0.9466 2 369
1jdb-assembly1.cif.gz_F carbamoyl phosphate synthetase from escherichia coli 0.945 2 369
1t36-assembly1.cif.gz_B crystal structure of e. coli carbamoyl phosphate synthetase small subunit mutant c248d complexed with uridine 5'-monophosphate 0.9437 2 369
1cs0-assembly4.cif.gz_B crystal structure of carbamoyl phosphate synthetase complexed at cys269 in the small subunit with the tetrahedral mimic l-glutamate gamma-semialdehyde 0.9397 2 369
1a9x-assembly1.cif.gz_B carbamoyl phosphate synthetase: caught in the act of glutamine hydrolysis 0.9394 2 369
ID Description Score Start End Superfamily
af_P9WPK5_1_155_3.50.30.20 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Carbamoyl-phosphate synthase small subunit, N-terminal domain 0.9548 2 149 3.50.30.20
af_K7TZS8_259_480_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9484 151 370 3.40.50.880
af_C6TIQ8_51_199_3.50.30.20 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Carbamoyl-phosphate synthase small subunit, N-terminal domain 0.9481 3 146 3.50.30.20
af_P0A6F1_2_151_3.50.30.20 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Carbamoyl-phosphate synthase small subunit, N-terminal domain 0.9471 2 148 3.50.30.20
af_Q58425_140_353_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9413 148 366 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A2S8K3P7-F1-model_v4 deleted 0.9817 206 312
AF-A0A7Z9XQK1-F1-model_v4 carbamoyl-phosphate synthase (ammonia) (EC 6.3.4.16) 0.9799 186 344 GO:0004088
GO:0005524
GO:0005737
GO:0006221
GO:0006541
GO:0046872
AF-X1QMB8-F1-model_v4 carbamoyl-phosphate synthase (glutamine-hydrolyzing) (EC 6.3.5.5) 0.9765 212 315 GO:0005524
GO:0016874
AF-A0A4U5QDU1-F1-model_v4 carbamoyl-phosphate synthase (glutamine-hydrolyzing) (EC 6.3.5.5) 0.9754 183 257 GO:0005524
GO:0016874
AF-A0A5C5YBX8-F1-model_v4 Carbamoyl phosphate synthase small chain (EC 6.3.5.5) (Carbamoyl phosphate synthetase glutamine chain) 0.9693 2 368 GO:0004088
GO:0004359
GO:0005524
GO:0006207
GO:0006526
GO:0006541
GO:0044205

Map