F410493

General Info

Members Datasets Scaffolds Average Seq Length
331 246 662 200

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10391353|Ga0105249_103913533
Length 209
Sequence MSAAFGRDALLDAFDQIGRAAVLAGTKLQIAVYGGSALMLASNFRFGTEDVDIAELGTPWPRWLQDVVHKIALRNGWSEEWLNDGVTFHLSVHAVAARDLVSFGTFPRRSGQTGITVFVPTARYMLALKLKALRVSDFAKGSKDIGDVRNLLGVLGITEIEPAVAILTEFFPRSGADADKQRFVLKNILSKGATGDAPRYPRGSDPENC

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
3 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
76 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
78 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
80 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
119 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
120 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
121 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
122 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
123 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
124 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
125 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
126 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
127 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
128 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
129 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
130 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
131 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
132 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
135 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
136 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
137 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
138 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
139 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
148 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
149 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
150 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
151 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
152 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
159 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
160 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
161 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
162 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
163 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
164 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
165 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
166 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
167 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
168 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
169 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
170 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
171 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
172 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
173 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
174 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
175 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
176 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
177 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
178 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
179 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
180 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
181 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
192 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
193 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
194 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
195 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
196 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
197 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
198 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
205 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
206 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
209 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
210 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
211 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
212 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
213 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
214 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
215 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
216 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
217 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
218 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
219 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
220 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
221 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
222 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
223 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
224 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
225 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
226 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
227 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
228 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
229 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
230 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
231 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
232 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
233 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
234 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
235 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
236 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
237 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
238 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
239 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
240 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
241 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
242 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
243 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
244 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
245 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
246 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.49
Metatranscriptomes 0
Isolates 1.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.05
Nodule 0.6
Rhizoplane 4.23
Rhizosphere 61.93
Stem 0
Stem Tuber 0
Unclassified 3.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_10391353 3300009553 Bacteria 1418
2 Ga0055524_1024788 3300003775 Bacteria 1892
3 Ga0055531_10007516 3300003794 Bacteria 5927
4 Ga0065165_1013317 3300005262 Bacteria 3279
5 Ga0065165_1018088 3300005262 Bacteria 2568
6 Ga0065712_10227598 3300005290 Bacteria 1021
7 Ga0070676_10401141 3300005328 Bacteria 954
8 Ga0070666_10216557 3300005335 Bacteria 1350
9 Ga0070680_100115858 3300005336 Bacteria 2233
10 Ga0070682_100283950 3300005337 Bacteria 1208
11 Ga0068868_100741311 3300005338 Bacteria 882
12 Ga0070660_100148268 3300005339 Bacteria 1885
13 Ga0070691_10045606 3300005341 Bacteria 2080
14 Ga0070687_100204456 3300005343 Bacteria 1199
15 Ga0070661_100110788 3300005344 Bacteria 2049
16 Ga0070668_100185876 3300005347 Bacteria 1699
17 Ga0070668_100651411 3300005347 Bacteria 925
18 Ga0070669_100712317 3300005353 Unclassified 848
19 Ga0070674_100143084 3300005356 Bacteria 1797
20 Ga0070659_100237087 3300005366 Bacteria 1508
21 Ga0070713_100039703 3300005436 Bacteria 3822
22 Ga0070711_100439405 3300005439 Bacteria 1066
23 Ga0070711_100643254 3300005439 Bacteria 888
24 Ga0070678_100509809 3300005456 Bacteria 1063
25 Ga0070662_100042407 3300005457 Bacteria 3250
26 Ga0070681_10084213 3300005458 Bacteria 3132
27 Ga0070681_10442035 3300005458 Bacteria 1212
28 Ga0070679_100082985 3300005530 Bacteria 3194
29 Ga0070679_100823334 3300005530 Bacteria 871
30 Ga0070684_100021696 3300005535 Bacteria 5349
31 Ga0068853_100023871 3300005539 Bacteria 5125
32 Ga0070672_100433980 3300005543 Bacteria 1130
33 Ga0070693_100534657 3300005547 Bacteria 837
34 Ga0070665_100027084 3300005548 Bacteria 5773
35 Ga0070665_100078433 3300005548 Bacteria 3309
36 Ga0068855_100063760 3300005563 Bacteria 4299
37 Ga0068855_100295278 3300005563 Bacteria 1796
38 Ga0068857_100101800 3300005577 Bacteria 2578
39 Ga0068857_101003174 3300005577 Bacteria 804
40 Ga0068854_100540219 3300005578 Bacteria 987
41 Ga0068856_100001207 3300005614 Bacteria 27136
42 Ga0068856_101065804 3300005614 Bacteria 826
43 Ga0068852_100168682 3300005616 Bacteria 2050
44 Ga0068852_100206522 3300005616 Bacteria 1861
45 Ga0068852_100687321 3300005616 Bacteria 1033
46 Ga0068859_100377410 3300005617 Bacteria 1513
47 Ga0068859_101213101 3300005617 Bacteria 831
48 Ga0068866_10750045 3300005718 Bacteria 674
49 Ga0068861_100457835 3300005719 Bacteria 1145
50 Ga0068851_10031612 3300005834 Bacteria 2630
51 Ga0068870_10160467 3300005840 Bacteria 1333
52 Ga0068858_100203720 3300005842 Bacteria 1872
53 Ga0068860_100001803 3300005843 Bacteria 22784
54 Ga0068860_100074683 3300005843 Bacteria 3224
55 Ga0068862_100148023 3300005844 Bacteria 2088
56 Ga0081455_10023231 3300005937 Bacteria 5775
57 Ga0081455_10024051 3300005937 Bacteria 5651
58 Ga0081540_1009953 3300005983 Bacteria 6483
59 Ga0081540_1015427 3300005983 Bacteria 4839
60 Ga0081539_10190096 3300005985 Bacteria 956
61 Ga0070717_10002820 3300006028 Bacteria 12295
62 Ga0075368_10076419 3300006042 Bacteria 1359
63 Ga0075363_100159184 3300006048 Bacteria 1278
64 Ga0070712_100206408 3300006175 Bacteria 1547
65 Ga0075362_10232197 3300006177 Bacteria 904
66 Ga0075369_10026120 3300006186 Bacteria 2432
67 Ga0097621_100201095 3300006237 Bacteria 1730
68 Ga0097621_100630837 3300006237 Bacteria 982
69 Ga0097621_100824159 3300006237 Bacteria 861
70 Ga0075428_100505939 3300006844 Bacteria 1292
71 Ga0075430_100021752 3300006846 Bacteria 5451
72 Ga0075431_100341250 3300006847 Bacteria 1507
73 Ga0075429_100204677 3300006880 Bacteria 1729
74 Ga0097620_100377413 3300006931 Bacteria 1513
75 Ga0097620_100392415 3300006931 Bacteria 1484
76 Ga0097620_101212684 3300006931 Bacteria 831
77 Ga0099794_10083215 3300007265 Bacteria 1581
78 Ga0105240_10180669 3300009093 Bacteria 2490
79 Ga0105240_10393795 3300009093 Bacteria 1562
80 Ga0105245_10243607 3300009098 Bacteria 1744
81 Ga0105247_10400462 3300009101 Bacteria 978
82 Ga0114129_10610315 3300009147 Bacteria 1412
83 Ga0105243_10813714 3300009148 Bacteria 922
84 Ga0105242_10346958 3300009176 Bacteria 1370
85 Ga0105248_11728730 3300009177 Bacteria 709
86 Ga0105237_10040307 3300009545 Bacteria 4710
87 Ga0105237_11005252 3300009545 Bacteria 841
88 Ga0105238_10141224 3300009551 Bacteria 2385
89 Ga0105238_10506937 3300009551 Bacteria 1208
90 Ga0105238_10617147 3300009551 Bacteria 1093
91 Ga0099796_10065554 3300010159 Bacteria 1299
92 Ga0105239_10162176 3300010375 Bacteria 2498
93 Ga0105239_10266314 3300010375 Bacteria 1927
94 Ga0105239_10692560 3300010375 Bacteria 1165
95 Ga0105246_10060933 3300011119 Bacteria 2623
96 Ga0105246_10917936 3300011119 Bacteria 787
97 Ga0157369_10049022 3300013105 Bacteria 4580
98 Ga0157375_10922236 3300013308 Unclassified 1016
99 Ga0157379_11336464 3300014968 Unclassified 693
100 Ga0213876_10134267 3300021384 Bacteria 1316
101 Ga0207425_1013873 3300025245 Bacteria 1846
102 Ga0209564_1000494 3300025295 Bacteria 65041
103 Ga0209758_1000546 3300025297 Bacteria 59757
104 Ga0209758_1039387 3300025297 Bacteria 1798
105 Ga0209758_1108810 3300025297 Bacteria 771
106 Ga0209256_1005803 3300025299 Bacteria 6883
107 Ga0209256_1015710 3300025299 Bacteria 2630
108 Ga0207426_1021968 3300025302 Bacteria 2197
109 Ga0209257_1004770 3300025304 Bacteria 10117
110 Ga0207656_10054143 3300025321 Bacteria 1743
111 Ga0207680_10144946 3300025903 Bacteria 1578
112 Ga0207643_10522076 3300025908 Bacteria 760
113 Ga0207707_10024554 3300025912 Bacteria 5275
114 Ga0207707_10240424 3300025912 Bacteria 1574
115 Ga0207695_10145041 3300025913 Bacteria 2319
116 Ga0207671_10050695 3300025914 Bacteria 3074
117 Ga0207671_10110191 3300025914 Bacteria 2094
118 Ga0207663_10378056 3300025916 Bacteria 1078
119 Ga0207660_10050930 3300025917 Bacteria 2942
120 Ga0207662_10193365 3300025918 Bacteria 1314
121 Ga0207657_10070606 3300025919 Bacteria 2960
122 Ga0207649_10044129 3300025920 Bacteria 2729
123 Ga0207649_10189131 3300025920 Bacteria 1446
124 Ga0207652_10005096 3300025921 Bacteria 10662
125 Ga0207652_10165087 3300025921 Bacteria 1985
126 Ga0207694_10172690 3300025924 Bacteria 1751
127 Ga0207694_10238628 3300025924 Bacteria 1485
128 Ga0207694_10350094 3300025924 Bacteria 1223
129 Ga0207650_10385313 3300025925 Bacteria 1158
130 Ga0207659_10350121 3300025926 Bacteria 1225
131 Ga0207687_10645824 3300025927 Bacteria 895
132 Ga0207687_11131085 3300025927 Unclassified 673
133 Ga0207700_10023241 3300025928 Bacteria 4270
134 Ga0207706_10013203 3300025933 Bacteria 7515
135 Ga0207709_10561518 3300025935 Bacteria 899
136 Ga0207670_10636813 3300025936 Bacteria 878
137 Ga0207669_10625299 3300025937 Bacteria 878
138 Ga0207691_10435316 3300025940 Bacteria 1117
139 Ga0207689_10186486 3300025942 Bacteria 1711
140 Ga0207661_10049694 3300025944 Bacteria 3339
141 Ga0207667_10081144 3300025949 Bacteria 3360
142 Ga0207667_10099112 3300025949 Bacteria 3006
143 Ga0207651_10506723 3300025960 Bacteria 1044
144 Ga0207640_10390329 3300025981 Bacteria 1131
145 Ga0207639_10415589 3300026041 Bacteria 1215
146 Ga0207678_10128041 3300026067 Bacteria 2166
147 Ga0207702_10001095 3300026078 Bacteria 27708
148 Ga0207702_11216490 3300026078 Unclassified 747
149 Ga0207641_10342134 3300026088 Bacteria 1424
150 Ga0207641_10953072 3300026088 Bacteria 854
151 Ga0207674_10037869 3300026116 Bacteria 5011
152 Ga0207674_10069777 3300026116 Bacteria 3534
153 Ga0207698_10124007 3300026142 Bacteria 2193
154 Ga0209813_10068721 3300027866 Bacteria 1147
155 Ga0268266_10036780 3300028379 Bacteria 4170
156 Ga0268266_10208338 3300028379 Bacteria 1792
157 Ga0268265_10296181 3300028380 Bacteria 1454
158 Ga0268264_10000157 3300028381 Bacteria 155163
159 Ga0265318_10016381 3300028577 Bacteria 3062
160 Ga0307517_10136957 3300028786 Bacteria 1737
161 Ga0307515_10304970 3300028794 Bacteria 1273
162 Ga0307511_10098713 3300030521 Bacteria 1931
163 Ga0265330_10014184 3300031235 Bacteria 3699
164 Ga0265332_10017669 3300031238 Bacteria 3147
165 Ga0265328_10032149 3300031239 Bacteria 1949
166 Ga0265320_10077413 3300031240 Bacteria 1556
167 Ga0265325_10021548 3300031241 Bacteria 3539
168 Ga0265329_10012634 3300031242 Bacteria 3028
169 Ga0265340_10017315 3300031247 Bacteria 3726
170 Ga0265340_10031418 3300031247 Bacteria 2655
171 Ga0265339_10021879 3300031249 Bacteria 3711
172 Ga0265331_10089624 3300031250 Bacteria 1422
173 Ga0307513_10236638 3300031456 Bacteria 1635
174 Ga0307509_10211414 3300031507 Bacteria 1763
175 Ga0307408_100412183 3300031548 Bacteria 1163
176 Ga0265313_10014046 3300031595 Bacteria 4765
177 Ga0307508_10026332 3300031616 Bacteria 5270
178 Ga0307508_10103542 3300031616 Bacteria 2443
179 Ga0265314_10016572 3300031711 Bacteria 5814
180 Ga0265342_10064401 3300031712 Bacteria 2151
181 Ga0265342_10092975 3300031712 Bacteria 1727
182 Ga0307516_10018402 3300031730 Bacteria 7259
183 Ga0307516_10299559 3300031730 Bacteria 1284
184 Ga0307405_10324853 3300031731 Bacteria 1177
185 Ga0307413_10134247 3300031824 Bacteria 1699
186 Ga0307413_10299646 3300031824 Bacteria 1218
187 Ga0307406_10217658 3300031901 Bacteria 1417
188 Ga0307406_10313642 3300031901 Bacteria 1210
189 Ga0307407_10063986 3300031903 Bacteria 2160
190 Ga0307409_100368396 3300031995 Bacteria 1361
191 Ga0307416_100180431 3300032002 Bacteria 1978
192 Ga0307416_100470658 3300032002 Bacteria 1314
193 Ga0307414_11124874 3300032004 Bacteria 726
194 Ga0307415_100501331 3300032126 Bacteria 1061
195 Ga0307507_10155574 3300033179 Bacteria 1705
196 Ga0307510_10239485 3300033180 Bacteria 1310
197 Ga0373926_0047453 3300035083 Bacteria 1543
198 Ga0373943_0153104 3300035170 Bacteria 1250
199 Ga0373927_0045565 3300035695 Bacteria 2836
200 Ga0373947_0096280 3300035725 Bacteria 1853
201 Ga0373925_0034197 3300037068 Bacteria 3746
202 Ga0395900_0047328 3300037418 Bacteria 4428
203 Ga0395898_0142553 3300037466 Bacteria 2294
204 Ga0395901_0269846 3300038443 Bacteria 1770
205 Ga0436365_0019602 3300039437 Bacteria 1703
206 Ga0436365_1414927 3300039437 Bacteria 1502
207 Ga0436365_1742281 3300039437 Bacteria 1194
208 Ga0436365_1744096 3300039437 Bacteria 5144
209 Ga0436363_0581711 3300039450 Bacteria 1648
210 Ga0436363_1417541 3300039450 Bacteria 2613
211 Ga0439453_0001885 3300041408 Bacteria 2796
212 Ga0451787_349177 3300041441 Bacteria 732
213 Ga0451791_0069053 3300041451 Bacteria 929
214 Ga0451793_0409404 3300041452 Bacteria 850
215 Ga0451802_0254572 3300041460 Bacteria 1224
216 Ga0451807_0974148 3300041486 Bacteria 765
217 Ga0439435_0001176 3300042436 Bacteria 4709
218 Ga0466961_0062489 3300044693 Bacteria 2367
219 Ga0466971_0215755 3300044719 Bacteria 908
220 Ga0466970_0330250 3300044765 Bacteria 863
221 Ga0466957_0057779 3300044842 Bacteria 2375
222 Ga0495629_0045781 3300046459 Bacteria 3069
223 Ga0495629_0594669 3300046459 Unclassified 740
224 Ga0495638_0000010 3300046460 Bacteria 495397
225 Ga0495651_0055681 3300046462 Bacteria 3038
226 Ga0495605_0081687 3300046474 Bacteria 1511
227 Ga0495652_0596238 3300046529 Bacteria 754
228 Ga0495621_0092871 3300046539 Bacteria 1139
229 Ga0495623_0268597 3300046679 Bacteria 953
230 Ga0495658_0590503 3300046683 Unclassified 712
231 Ga0495581_0108955 3300047315 Bacteria 1610
232 Ga0495672_0455854 3300047320 Bacteria 576
233 Ga0495680_0552702 3300047322 Bacteria 775
234 Ga0495686_0109638 3300047472 Bacteria 1657
235 Ga0495686_0178247 3300047472 Bacteria 1232
236 Ga0495686_0295785 3300047472 Bacteria 895
237 Ga0496100_0078148 3300048903 Bacteria 2227
238 Ga0496101_0475053 3300048904 Bacteria 987
239 Ga0496102_0332584 3300048905 Bacteria 1431
240 Ga0496107_0000828 3300048910 Bacteria 18044
241 Ga0496108_0000489 3300048911 Bacteria 31675
242 Ga0496109_0001486 3300048912 Bacteria 19474
243 Ga0496110_0067184 3300048913 Bacteria 3172
244 Ga0496111_0034878 3300048914 Bacteria 3594
245 Ga0496112_0001918 3300048915 Bacteria 16401
246 Ga0496117_0022430 3300048920 Bacteria 5063
247 Ga0496118_0030783 3300048921 Bacteria 4467
248 Ga0496121_0007421 3300048924 Bacteria 13247
249 Ga0496121_0089798 3300048924 Bacteria 2404
250 Ga0496121_0132106 3300048924 Bacteria 1866
251 Ga0496121_0199286 3300048924 Bacteria 1428
252 Ga0496121_0285697 3300048924 Bacteria 1126
253 Ga0496124_0182105 3300048927 Bacteria 1616
254 Ga0496124_0192641 3300048927 Bacteria 1558
255 Ga0496124_0695416 3300048927 Unclassified 645
256 Ga0496125_0387831 3300048928 Bacteria 821
257 Ga0496126_0166691 3300048929 Bacteria 1879
258 Ga0496126_0191836 3300048929 Bacteria 1730
259 Ga0496126_0260129 3300048929 Bacteria 1443
260 Ga0496126_0345675 3300048929 Bacteria 1218
261 Ga0496126_0700221 3300048929 Bacteria 787
262 Ga0495682_0072538 3300049460 Bacteria 1239
263 Ga0501033_0077680 3300049570 Bacteria 2436
264 Ga0501043_0328437 3300049579 Bacteria 1165
265 Ga0501047_0078605 3300049581 Bacteria 3172
266 Ga0501073_0525118 3300049589 Unclassified 818
267 Ga0501035_0107879 3300049822 Bacteria 2441
268 Ga0501044_0163991 3300049823 Bacteria 2197
269 nmdc:mga0yw44_482562_c1 3300050492 Bacteria 841
270 nmdc:mga0yw44_65100_c1 3300050492 Bacteria 2245
271 nmdc:mga0k408_124057_c2 3300050493 Bacteria 1104
272 nmdc:mga04h51_81899_c1 3300050495 Bacteria 1147
273 nmdc:mga05p37_513114_c1 3300050507 Bacteria 1373
274 nmdc:mga0qj67_167642_c1 3300050509 Bacteria 1783
275 nmdc:mga0sz30_110446_c1 3300050516 Bacteria 1205
276 nmdc:mga0sz30_157060_c1 3300050516 Bacteria 1007
277 nmdc:mga0sz30_70540_c2 3300050516 Bacteria 1135
278 Ga0500610_0168552 3300053079 Bacteria 1083
279 Ga0500610_0192282 3300053079 Bacteria 990
280 Ga0500635_0043614 3300053080 Bacteria 1509
281 Ga0500566_0001223 3300053094 Bacteria 15020
282 Ga0500566_0033306 3300053094 Bacteria 3004
283 Ga0500650_0125112 3300053098 Bacteria 1197
284 Ga0500572_000415 3300053111 Bacteria 14990
285 Ga0500572_003805 3300053111 Bacteria 3428
286 Ga0500591_087402 3300053115 Bacteria 1370
287 Ga0500594_0102917 3300053118 Bacteria 881
288 Ga0500595_032185 3300053119 Bacteria 1753
289 Ga0500595_047504 3300053119 Bacteria 1345
290 Ga0500597_053492 3300053120 Bacteria 1724
291 Ga0500607_013334 3300053121 Bacteria 4799
292 Ga0500608_057266 3300053122 Bacteria 1867
293 Ga0500608_062891 3300053122 Bacteria 1771
294 Ga0500608_211519 3300053122 Bacteria 792
295 Ga0500655_016436 3300053133 Bacteria 1363
296 Ga0500658_0027734 3300053134 Bacteria 2193
297 Ga0500559_0000660 3300053136 Bacteria 23212
298 Ga0500559_0015747 3300053136 Bacteria 3193
299 Ga0500564_031446 3300053138 Bacteria 2445
300 Ga0500573_0188148 3300053140 Bacteria 1105
301 Ga0500577_0014743 3300053142 Bacteria 2424
302 Ga0500590_033077 3300053148 Bacteria 2681
303 Ga0500590_038824 3300053148 Bacteria 2456
304 Ga0500603_010391 3300053150 Bacteria 2100
305 Ga0500603_025887 3300053150 Bacteria 1479
306 Ga0500603_142133 3300053150 Unclassified 739
307 Ga0500619_017825 3300053154 Bacteria 1982
308 Ga0500620_008924 3300053155 Bacteria 2560
309 Ga0500638_021102 3300053162 Bacteria 3073
310 Ga0500638_025728 3300053162 Bacteria 2815
311 Ga0500639_022556 3300053163 Bacteria 3325
312 Ga0500639_043097 3300053163 Bacteria 2366
313 Ga0500636_0100242 3300053177 Bacteria 1647
314 Ga0500636_0106997 3300053177 Bacteria 1584
315 Ga0500636_0356458 3300053177 Bacteria 696
316 Ga0500637_0173215 3300053178 Bacteria 1239
317 Ga0500576_157782 3300053725 Bacteria 837
318 Ga0500657_105963 3300053728 Bacteria 1148
319 Ga0500645_054639 3300053730 Bacteria 1161
320 Ga0500645_081278 3300053730 Bacteria 924
321 Ga0500609_000243 3300053731 Bacteria 7870
322 Ga0500596_001263 3300053735 Bacteria 5114
323 Ga0500596_001811 3300053735 Bacteria 4296
324 Ga0500601_000719 3300053737 Bacteria 4366
325 Ga0500601_017516 3300053737 Bacteria 821
326 Ga0466962_0015519 3300061719 Bacteria 3674
327 2844315178 2844315083 Bacteria 8138177
328 2885371153 2885366525 Bacteria 8326213
329 2906603127 2906602504 Bacteria 8295279
330 8019652600 8019648815 Bacteria 10014479
331 8056695299 8056689827 Bacteria 6712655
332 Ga0105249_10391353
333 Ga0055524_1024788
334 Ga0055531_10007516
335 Ga0065165_1013317
336 Ga0065165_1018088
337 Ga0065712_10227598
338 Ga0070676_10401141
339 Ga0070666_10216557
340 Ga0070680_100115858
341 Ga0070682_100283950
342 Ga0068868_100741311
343 Ga0070660_100148268
344 Ga0070691_10045606
345 Ga0070687_100204456
346 Ga0070661_100110788
347 Ga0070668_100185876
348 Ga0070668_100651411
349 Ga0070669_100712317
350 Ga0070674_100143084
351 Ga0070659_100237087
352 Ga0070713_100039703
353 Ga0070711_100439405
354 Ga0070711_100643254
355 Ga0070678_100509809
356 Ga0070662_100042407
357 Ga0070681_10084213
358 Ga0070681_10442035
359 Ga0070679_100082985
360 Ga0070679_100823334
361 Ga0070684_100021696
362 Ga0068853_100023871
363 Ga0070672_100433980
364 Ga0070693_100534657
365 Ga0070665_100027084
366 Ga0070665_100078433
367 Ga0068855_100063760
368 Ga0068855_100295278
369 Ga0068857_100101800
370 Ga0068857_101003174
371 Ga0068854_100540219
372 Ga0068856_100001207
373 Ga0068856_101065804
374 Ga0068852_100168682
375 Ga0068852_100206522
376 Ga0068852_100687321
377 Ga0068859_100377410
378 Ga0068859_101213101
379 Ga0068866_10750045
380 Ga0068861_100457835
381 Ga0068851_10031612
382 Ga0068870_10160467
383 Ga0068858_100203720
384 Ga0068860_100001803
385 Ga0068860_100074683
386 Ga0068862_100148023
387 Ga0081455_10023231
388 Ga0081455_10024051
389 Ga0081540_1009953
390 Ga0081540_1015427
391 Ga0081539_10190096
392 Ga0070717_10002820
393 Ga0075368_10076419
394 Ga0075363_100159184
395 Ga0070712_100206408
396 Ga0075362_10232197
397 Ga0075369_10026120
398 Ga0097621_100201095
399 Ga0097621_100630837
400 Ga0097621_100824159
401 Ga0075428_100505939
402 Ga0075430_100021752
403 Ga0075431_100341250
404 Ga0075429_100204677
405 Ga0097620_100377413
406 Ga0097620_100392415
407 Ga0097620_101212684
408 Ga0099794_10083215
409 Ga0105240_10180669
410 Ga0105240_10393795
411 Ga0105245_10243607
412 Ga0105247_10400462
413 Ga0114129_10610315
414 Ga0105243_10813714
415 Ga0105242_10346958
416 Ga0105248_11728730
417 Ga0105237_10040307
418 Ga0105237_11005252
419 Ga0105238_10141224
420 Ga0105238_10506937
421 Ga0105238_10617147
422 Ga0099796_10065554
423 Ga0105239_10162176
424 Ga0105239_10266314
425 Ga0105239_10692560
426 Ga0105246_10060933
427 Ga0105246_10917936
428 Ga0157369_10049022
429 Ga0157375_10922236
430 Ga0157379_11336464
431 Ga0213876_10134267
432 Ga0207425_1013873
433 Ga0209564_1000494
434 Ga0209758_1000546
435 Ga0209758_1039387
436 Ga0209758_1108810
437 Ga0209256_1005803
438 Ga0209256_1015710
439 Ga0207426_1021968
440 Ga0209257_1004770
441 Ga0207656_10054143
442 Ga0207680_10144946
443 Ga0207643_10522076
444 Ga0207707_10024554
445 Ga0207707_10240424
446 Ga0207695_10145041
447 Ga0207671_10050695
448 Ga0207671_10110191
449 Ga0207663_10378056
450 Ga0207660_10050930
451 Ga0207662_10193365
452 Ga0207657_10070606
453 Ga0207649_10044129
454 Ga0207649_10189131
455 Ga0207652_10005096
456 Ga0207652_10165087
457 Ga0207694_10172690
458 Ga0207694_10238628
459 Ga0207694_10350094
460 Ga0207650_10385313
461 Ga0207659_10350121
462 Ga0207687_10645824
463 Ga0207687_11131085
464 Ga0207700_10023241
465 Ga0207706_10013203
466 Ga0207709_10561518
467 Ga0207670_10636813
468 Ga0207669_10625299
469 Ga0207691_10435316
470 Ga0207689_10186486
471 Ga0207661_10049694
472 Ga0207667_10081144
473 Ga0207667_10099112
474 Ga0207651_10506723
475 Ga0207640_10390329
476 Ga0207639_10415589
477 Ga0207678_10128041
478 Ga0207702_10001095
479 Ga0207702_11216490
480 Ga0207641_10342134
481 Ga0207641_10953072
482 Ga0207674_10037869
483 Ga0207674_10069777
484 Ga0207698_10124007
485 Ga0209813_10068721
486 Ga0268266_10036780
487 Ga0268266_10208338
488 Ga0268265_10296181
489 Ga0268264_10000157
490 Ga0265318_10016381
491 Ga0307517_10136957
492 Ga0307515_10304970
493 Ga0307511_10098713
494 Ga0265330_10014184
495 Ga0265332_10017669
496 Ga0265328_10032149
497 Ga0265320_10077413
498 Ga0265325_10021548
499 Ga0265329_10012634
500 Ga0265340_10017315
501 Ga0265340_10031418
502 Ga0265339_10021879
503 Ga0265331_10089624
504 Ga0307513_10236638
505 Ga0307509_10211414
506 Ga0307408_100412183
507 Ga0265313_10014046
508 Ga0307508_10026332
509 Ga0307508_10103542
510 Ga0265314_10016572
511 Ga0265342_10064401
512 Ga0265342_10092975
513 Ga0307516_10018402
514 Ga0307516_10299559
515 Ga0307405_10324853
516 Ga0307413_10134247
517 Ga0307413_10299646
518 Ga0307406_10217658
519 Ga0307406_10313642
520 Ga0307407_10063986
521 Ga0307409_100368396
522 Ga0307416_100180431
523 Ga0307416_100470658
524 Ga0307414_11124874
525 Ga0307415_100501331
526 Ga0307507_10155574
527 Ga0307510_10239485
528 Ga0373926_0047453
529 Ga0373943_0153104
530 Ga0373927_0045565
531 Ga0373947_0096280
532 Ga0373925_0034197
533 Ga0395900_0047328
534 Ga0395898_0142553
535 Ga0395901_0269846
536 Ga0436365_0019602
537 Ga0436365_1414927
538 Ga0436365_1742281
539 Ga0436365_1744096
540 Ga0436363_0581711
541 Ga0436363_1417541
542 Ga0439453_0001885
543 Ga0451787_349177
544 Ga0451791_0069053
545 Ga0451793_0409404
546 Ga0451802_0254572
547 Ga0451807_0974148
548 Ga0439435_0001176
549 Ga0466961_0062489
550 Ga0466971_0215755
551 Ga0466970_0330250
552 Ga0466957_0057779
553 Ga0495629_0045781
554 Ga0495629_0594669
555 Ga0495638_0000010
556 Ga0495651_0055681
557 Ga0495605_0081687
558 Ga0495652_0596238
559 Ga0495621_0092871
560 Ga0495623_0268597
561 Ga0495658_0590503
562 Ga0495581_0108955
563 Ga0495672_0455854
564 Ga0495680_0552702
565 Ga0495686_0109638
566 Ga0495686_0178247
567 Ga0495686_0295785
568 Ga0496100_0078148
569 Ga0496101_0475053
570 Ga0496102_0332584
571 Ga0496107_0000828
572 Ga0496108_0000489
573 Ga0496109_0001486
574 Ga0496110_0067184
575 Ga0496111_0034878
576 Ga0496112_0001918
577 Ga0496117_0022430
578 Ga0496118_0030783
579 Ga0496121_0007421
580 Ga0496121_0089798
581 Ga0496121_0132106
582 Ga0496121_0199286
583 Ga0496121_0285697
584 Ga0496124_0182105
585 Ga0496124_0192641
586 Ga0496124_0695416
587 Ga0496125_0387831
588 Ga0496126_0166691
589 Ga0496126_0191836
590 Ga0496126_0260129
591 Ga0496126_0345675
592 Ga0496126_0700221
593 Ga0495682_0072538
594 Ga0501033_0077680
595 Ga0501043_0328437
596 Ga0501047_0078605
597 Ga0501073_0525118
598 Ga0501035_0107879
599 Ga0501044_0163991
600 nmdc:mga0yw44_482562_c1
601 nmdc:mga0yw44_65100_c1
602 nmdc:mga0k408_124057_c2
603 nmdc:mga04h51_81899_c1
604 nmdc:mga05p37_513114_c1
605 nmdc:mga0qj67_167642_c1
606 nmdc:mga0sz30_110446_c1
607 nmdc:mga0sz30_157060_c1
608 nmdc:mga0sz30_70540_c2
609 Ga0500610_0168552
610 Ga0500610_0192282
611 Ga0500635_0043614
612 Ga0500566_0001223
613 Ga0500566_0033306
614 Ga0500650_0125112
615 Ga0500572_000415
616 Ga0500572_003805
617 Ga0500591_087402
618 Ga0500594_0102917
619 Ga0500595_032185
620 Ga0500595_047504
621 Ga0500597_053492
622 Ga0500607_013334
623 Ga0500608_057266
624 Ga0500608_062891
625 Ga0500608_211519
626 Ga0500655_016436
627 Ga0500658_0027734
628 Ga0500559_0000660
629 Ga0500559_0015747
630 Ga0500564_031446
631 Ga0500573_0188148
632 Ga0500577_0014743
633 Ga0500590_033077
634 Ga0500590_038824
635 Ga0500603_010391
636 Ga0500603_025887
637 Ga0500603_142133
638 Ga0500619_017825
639 Ga0500620_008924
640 Ga0500638_021102
641 Ga0500638_025728
642 Ga0500639_022556
643 Ga0500639_043097
644 Ga0500636_0100242
645 Ga0500636_0106997
646 Ga0500636_0356458
647 Ga0500637_0173215
648 Ga0500576_157782
649 Ga0500657_105963
650 Ga0500645_054639
651 Ga0500645_081278
652 Ga0500609_000243
653 Ga0500596_001263
654 Ga0500596_001811
655 Ga0500601_000719
656 Ga0500601_017516
657 Ga0466962_0015519
658 2844315178
659 2885371153
660 2906603127
661 8019652600
662 8056695299

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6y8q-assembly3.cif.gz_C abiei antitoxin from streptococcus agalactiae 0.5649 30 189
6y8q-assembly4.cif.gz_D abiei antitoxin from streptococcus agalactiae 0.5422 22 189
5cde-assembly1.cif.gz_B r372a mutant of xaa-pro dipeptidase from xanthomonas campestris 0.4995 2 53
5fcf-assembly1.cif.gz_B crystal structure of xaa-pro dipeptidase from xanthomonas campestris, phosphate and mn bound 0.4977 2 53
5fch-assembly1.cif.gz_B crystal structure of xaa-pro dipeptidase from xanthomonas campestris, phosphate and zn bound 0.4973 2 53
ID Description Score Start End Superfamily
af_O53298_250_338_3.30.460.40 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; 0.8089 12 96 3.30.460.40
af_O53298_250_338_3.30.460.40 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; 0.7469 12 96 3.30.460.40
af_I6WZ83_1_185_3.30.460.40 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; 0.5361 5 192 3.30.460.40
af_I6WZ83_1_185_3.30.460.40 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; 0.534 5 192 3.30.460.40
af_Q9VPK5_655_887_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.4932 121 199 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A1Y6KTJ8-F1-model_v4 Uncharacterized protein 0.9881 1 201
AF-K9GLW3-F1-model_v4 Uncharacterized protein 0.9697 1 200
AF-K9GLW3-F1-model_v4 Uncharacterized protein 0.9602 1 200
AF-U4QSY6-F1-model_v4 Nucleotidyltransferase 0.9114 3 188
AF-A0A0D8FVI9-F1-model_v4 DUF6036 domain-containing protein 0.9025 2 172

Map