F410148

General Info

Members Datasets Scaffolds Average Seq Length
330 246 323 171

Family's Representative Sequence

Representative Sequence 3300030521|Ga0307511_10001570|Ga0307511_1000157013
Length 195
Sequence MAGAGALRHNPAMDLHQLSRNFARPGRLAQILLRPAHRALAREVQSAIALAGRGLQGDRTGDRPPTQAGGGKRQVTLIQAEHLPVIAALTGHAHIDAAGPRRNLVIEGLNLLAARSLFKDQPLVLRIGPEVVLEVTGPCEPCSRMEELLGPGGYNAMRGHGGITARVLTGGALNVGDLVYCELEPAMASAQASLL

Samples

Sample ID Description Type Environment
1 2738543013 Variovorax sp. BT01 Isolate Unclassified
2 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
3 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
4 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
5 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
6 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
7 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
8 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
9 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
10 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
11 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
49 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
69 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
70 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
71 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
72 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
73 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
75 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
107 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
108 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
109 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
112 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
113 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
114 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
115 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
122 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
123 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
124 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
126 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
127 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
131 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
132 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
133 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
134 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
135 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
136 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
137 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
138 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
139 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
140 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
141 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
142 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
143 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
144 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
145 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
146 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
147 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
148 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
149 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
150 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
151 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
152 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
153 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
154 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
155 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
156 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
157 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
158 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
159 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
160 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
165 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
166 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
167 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
168 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
169 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
170 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
171 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
172 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
173 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
174 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
175 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
176 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
179 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
180 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
181 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
196 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
197 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
198 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
208 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
209 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
210 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
211 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
212 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
213 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
214 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
215 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
216 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
220 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
222 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
223 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
224 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
225 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
226 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
227 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
228 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
229 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
230 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
231 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
232 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
233 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
234 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
235 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
236 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
237 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
238 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
239 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
240 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
241 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
242 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
243 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
244 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
245 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
246 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.27
Metatranscriptomes 0.61
Isolates 2.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.09
Nodule 0.61
Rhizoplane 8.18
Rhizosphere 61.52
Stem 0
Stem Tuber 0
Unclassified 10.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000002 3300002704 Bacteria 292156
2 JGI25156J39149_1000003 3300002705 Bacteria 305434
3 JGI25154J39366_1000009 3300002738 Bacteria 305408
4 JGI25157J39369_1000002 3300002741 Bacteria 305434
5 rootH1_10003602 3300003316 Bacteria 5550
6 rootH2_10017766 3300003320 Bacteria 41125
7 rootL2_10001705 3300003322 Bacteria 24471
8 rootL2_10001745 3300003322 Bacteria 8104
9 rootL2_10005015 3300003322 Bacteria 1848
10 rootL2_10031533 3300003322 Bacteria 4806
11 rootH1_10009037 3300003323 Bacteria 29976
12 rootH1_10129979 3300003323 Bacteria 4013
13 rootH1_10225941 3300003323 Unclassified 1267
14 Ga0055537_1017157 3300003773 Bacteria 1200
15 Ga0055524_1000139 3300003775 Bacteria 86430
16 Ga0055536_1014941 3300003781 Bacteria 2688
17 Ga0055534_1000726 3300003784 Bacteria 15931
18 Ga0055530_10001272 3300003791 Bacteria 19049
19 Ga0055530_10023303 3300003791 Bacteria 1782
20 Ga0055540_1000090 3300003792 Bacteria 99454
21 Ga0055540_1000091 3300003792 Bacteria 99089
22 Ga0055540_1003052 3300003792 Bacteria 8339
23 Ga0055531_10008196 3300003794 Bacteria 5562
24 Ga0065165_1000873 3300005262 Bacteria 39246
25 Ga0070690_100409112 3300005330 Bacteria 998
26 Ga0070666_10245442 3300005335 Unclassified 1267
27 Ga0068868_100097915 3300005338 Bacteria 2371
28 Ga0070671_100020763 3300005355 Bacteria 5357
29 Ga0070671_100044313 3300005355 Unclassified 3697
30 Ga0070673_100356012 3300005364 Bacteria 1300
31 Ga0070688_100464845 3300005365 Bacteria 948
32 Ga0070667_100025363 3300005367 Bacteria 4929
33 Ga0070700_100184572 3300005441 Bacteria 1454
34 Ga0070663_100280694 3300005455 Bacteria 1327
35 Ga0070678_100455525 3300005456 Bacteria 1121
36 Ga0070665_100289735 3300005548 Bacteria 1639
37 Ga0070664_100345172 3300005564 Bacteria 1353
38 Ga0070664_101319290 3300005564 Bacteria 682
39 Ga0068859_100002402 3300005617 Bacteria 19068
40 Ga0068864_100096008 3300005618 Bacteria 2623
41 Ga0068863_100019876 3300005841 Bacteria 6424
42 Ga0068858_100000113 3300005842 Bacteria 84912
43 Ga0068858_100478419 3300005842 Bacteria 1202
44 Ga0068860_100127499 3300005843 Unclassified 2439
45 Ga0081455_10176539 3300005937 Bacteria 1621
46 Ga0075364_10113037 3300006051 Bacteria 1813
47 Ga0075362_10052421 3300006177 Bacteria 1828
48 Ga0075367_10004087 3300006178 Bacteria 7066
49 Ga0075369_10002759 3300006186 Bacteria 6304
50 Ga0075366_10003646 3300006195 Bacteria 8163
51 Ga0097620_100002402 3300006931 Bacteria 19068
52 Ga0079104_1000916 3300006946 Bacteria 23741
53 Ga0105250_10033729 3300009092 Unclassified 2056
54 Ga0105240_10002128 3300009093 Bacteria 32334
55 Ga0105245_10224193 3300009098 Bacteria 1815
56 Ga0105247_10000445 3300009101 Bacteria 34975
57 Ga0105243_10006992 3300009148 Bacteria 8689
58 Ga0105248_10156004 3300009177 Unclassified 2576
59 Ga0105248_10638638 3300009177 Bacteria 1201
60 Ga0105237_10007938 3300009545 Bacteria 11564
61 Ga0105237_10081814 3300009545 Bacteria 3220
62 Ga0105238_10000830 3300009551 Bacteria 31988
63 Ga0105249_10213099 3300009553 Bacteria 1897
64 Ga0105239_10110491 3300010375 Bacteria 3047
65 Ga0105239_10163026 3300010375 Bacteria 2491
66 Ga0157370_10011683 3300013104 Bacteria 9166
67 Ga0157374_10348110 3300013296 Bacteria 1472
68 Ga0163162_10291432 3300013306 Bacteria 1764
69 Ga0157375_10147765 3300013308 Bacteria 2482
70 Ga0157375_10222212 3300013308 Bacteria 2047
71 Ga0163163_10004816 3300014325 Bacteria 11592
72 Ga0163163_10139344 3300014325 Bacteria 2468
73 Ga0163163_10209743 3300014325 Bacteria 1997
74 Ga0157380_10065030 3300014326 Bacteria 2930
75 Ga0157379_10032641 3300014968 Bacteria 4642
76 Ga0157379_10426550 3300014968 Bacteria 1222
77 Ga0157379_10646833 3300014968 Bacteria 990
78 Ga0163161_10000180 3300017792 Bacteria 57748
79 Ga0224712_10284580 3300022467 Unclassified 770
80 Ga0209435_100001 3300025206 Bacteria 1424171
81 Ga0209646_1000001 3300025246 Bacteria 3092932
82 Ga0209026_1000003 3300025250 Bacteria 1060571
83 Ga0209759_1000001 3300025256 Bacteria 2799452
84 Ga0209129_1007630 3300025258 Bacteria 3173
85 Ga0209565_1000407 3300025263 Bacteria 35850
86 Ga0209130_1003048 3300025284 Bacteria 7552
87 Ga0209675_1001101 3300025291 Bacteria 16548
88 Ga0209675_1001324 3300025291 Bacteria 14690
89 Ga0209675_1025528 3300025291 Bacteria 1488
90 Ga0209676_1000293 3300025292 Bacteria 101210
91 Ga0209676_1008235 3300025292 Bacteria 4691
92 Ga0209025_1000133 3300025294 Bacteria 195885
93 Ga0209025_1003720 3300025294 Bacteria 14007
94 Ga0209025_1031822 3300025294 Bacteria 2484
95 Ga0209564_1002323 3300025295 Bacteria 15406
96 Ga0209050_1000326 3300025298 Bacteria 95495
97 Ga0209050_1000967 3300025298 Bacteria 36985
98 Ga0209050_1003038 3300025298 Bacteria 12940
99 Ga0209050_1013473 3300025298 Bacteria 3624
100 Ga0209050_1036185 3300025298 Bacteria 1446
101 Ga0209256_1000019 3300025299 Bacteria 558627
102 Ga0209051_1000130 3300025303 Bacteria 141656
103 Ga0209051_1000133 3300025303 Bacteria 139014
104 Ga0209257_1000038 3300025304 Bacteria 609032
105 Ga0209257_1013959 3300025304 Bacteria 3506
106 Ga0207696_1018304 3300025711 Unclassified 2302
107 Ga0207642_10204940 3300025899 Bacteria 1092
108 Ga0207710_10000334 3300025900 Bacteria 35251
109 Ga0207695_10041823 3300025913 Bacteria 4902
110 Ga0207671_10014755 3300025914 Bacteria 6159
111 Ga0207671_10357057 3300025914 Bacteria 1159
112 Ga0207694_10105375 3300025924 Bacteria 2238
113 Ga0207644_10009476 3300025931 Bacteria 6396
114 Ga0207709_10000191 3300025935 Bacteria 82020
115 Ga0207691_10555611 3300025940 Bacteria 973
116 Ga0207711_10384144 3300025941 Bacteria 1303
117 Ga0207679_10064184 3300025945 Bacteria 2744
118 Ga0207668_10455400 3300025972 Bacteria 1093
119 Ga0207658_10009188 3300025986 Bacteria 6704
120 Ga0207703_10007828 3300026035 Bacteria 8451
121 Ga0207639_10449871 3300026041 Bacteria 1169
122 Ga0207639_10751887 3300026041 Bacteria 906
123 Ga0207678_10235785 3300026067 Unclassified 1567
124 Ga0207641_10104176 3300026088 Unclassified 2504
125 Ga0207674_10412781 3300026116 Bacteria 1305
126 Ga0207698_10536440 3300026142 Bacteria 1144
127 Ga0209281_1000935 3300027111 Bacteria 24025
128 Ga0268266_10091594 3300028379 Unclassified 2666
129 Ga0268266_10170400 3300028379 Bacteria 1976
130 Ga0268266_10876661 3300028379 Bacteria 868
131 Ga0268265_10299604 3300028380 Bacteria 1447
132 Ga0268264_10007153 3300028381 Bacteria 9351
133 Ga0307511_10001570 3300030521 Bacteria 24239
134 Ga0316182_1173201 3300030745 Bacteria 3653
135 Ga0265332_10262778 3300031238 Unclassified 714
136 Ga0307513_10016333 3300031456 Bacteria 8961
137 Ga0307513_10107570 3300031456 Unclassified 2791
138 Ga0307513_10190975 3300031456 Bacteria 1900
139 Ga0307408_100279251 3300031548 Bacteria 1390
140 Ga0307514_10000330 3300031649 Bacteria 113231
141 Ga0316575_10030378 3300031665 Bacteria 2112
142 Ga0316575_10188480 3300031665 Bacteria 857
143 Ga0316579_10020191 3300031691 Bacteria 2951
144 Ga0316579_10165879 3300031691 Bacteria 1067
145 Ga0316576_10029389 3300031727 Bacteria 3885
146 Ga0316576_10593467 3300031727 Unclassified 809
147 Ga0316578_10054758 3300031728 Bacteria 2340
148 Ga0316578_10325966 3300031728 Bacteria 916
149 Ga0307405_10169429 3300031731 Bacteria 1556
150 Ga0307405_10252683 3300031731 Bacteria 1312
151 Ga0316577_10150507 3300031733 Bacteria 1311
152 Ga0316577_10276910 3300031733 Bacteria 950
153 Ga0316577_10295947 3300031733 Bacteria 917
154 Ga0307412_10041945 3300031911 Bacteria 2969
155 Ga0307416_100128363 3300032002 Bacteria 2276
156 Ga0307411_10120687 3300032005 Bacteria 1896
157 Ga0316583_10148243 3300032133 Bacteria 817
158 Ga0316583_10174833 3300032133 Unclassified 747
159 Ga0316585_10096945 3300032137 Unclassified 966
160 Ga0316580_10035104 3300032139 Bacteria 1552
161 Ga0316580_10040208 3300032139 Bacteria 1445
162 Ga0316588_1000471 3300033528 Bacteria 5443
163 Ga0316574_0005573 3300035398 Bacteria 6727
164 Ga0316574_0199476 3300035398 Bacteria 1285
165 Ga0316574_0258011 3300035398 Bacteria 1113
166 Ga0316574_0375069 3300035398 Bacteria 898
167 Ga0316574_0575345 3300035398 Bacteria 697
168 Ga0316582_0065565 3300036647 Bacteria 2338
169 Ga0316582_0068827 3300036647 Unclassified 2287
170 Ga0316582_0440069 3300036647 Bacteria 898
171 Ga0316584_0011964 3300036712 Bacteria 6113
172 Ga0316584_0126827 3300036712 Unclassified 1906
173 Ga0316584_0170828 3300036712 Bacteria 1613
174 Ga0316584_0368451 3300036712 Bacteria 1028
175 Ga0316584_0501755 3300036712 Unclassified 852
176 Ga0373925_0382798 3300037068 Bacteria 1146
177 Ga0395905_0111062 3300037471 Bacteria 2574
178 Ga0316581_0152319 3300037588 Unclassified 713
179 Ga0451791_1692606 3300041451 Bacteria 810
180 Ga0451798_1067716 3300041458 Bacteria 962
181 Ga0451835_0594784 3300041492 Bacteria 538
182 Ga0451839_1225651 3300041496 Bacteria 663
183 Ga0451841_1060093 3300041498 Bacteria 1037
184 Ga0451851_0153605 3300041507 Bacteria 958
185 Ga0451853_0887354 3300041512 Bacteria 891
186 Ga0439431_0170527 3300041997 Bacteria 625
187 Ga0439437_000086 3300042000 Bacteria 6646
188 Ga0439455_0019013 3300042012 Bacteria 1616
189 Ga0439456_005434 3300042013 Bacteria 2586
190 Ga0450911_000006 3300042115 Bacteria 222143
191 Ga0450892_010781 3300042130 Bacteria 804
192 Ga0450903_003391 3300042138 Bacteria 2761
193 Ga0450904_000006 3300042139 Bacteria 59554
194 Ga0439446_0053200 3300042156 Bacteria 1213
195 Ga0439434_0032156 3300042435 Bacteria 1596
196 Ga0439434_0369763 3300042435 Bacteria 502
197 Ga0439435_0053148 3300042436 Bacteria 1164
198 Ga0439459_0095892 3300042438 Bacteria 719
199 Ga0439460_0197399 3300042461 Bacteria 685
200 Ga0450893_0024530 3300042532 Bacteria 1053
201 Ga0450893_0047354 3300042532 Unclassified 799
202 Ga0466969_0103677 3300044656 Bacteria 1336
203 Ga0466972_0076192 3300044658 Bacteria 1598
204 Ga0466966_0019262 3300044684 Bacteria 4492
205 Ga0466961_0027432 3300044693 Bacteria 3662
206 Ga0466964_0015707 3300044706 Bacteria 2882
207 Ga0453684_1219055 3300044712 Unclassified 789
208 Ga0466971_0027849 3300044719 Bacteria 2530
209 Ga0466970_0126360 3300044765 Bacteria 1402
210 Ga0466957_1084046 3300044842 Unclassified 577
211 Ga0451576_0884613 3300045051 Bacteria 937
212 Ga0451576_1102378 3300045051 Unclassified 831
213 Ga0466958_0559383 3300045836 Unclassified 743
214 Ga0466967_0114364 3300045976 Bacteria 2484
215 Ga0495629_0656231 3300046459 Bacteria 699
216 Ga0495638_0000004 3300046460 Bacteria 700795
217 Ga0495653_0512785 3300046463 Unclassified 746
218 Ga0495650_0017971 3300046471 Bacteria 3529
219 Ga0495630_0008561 3300046517 Bacteria 7340
220 Ga0495632_0112201 3300046519 Bacteria 1279
221 Ga0495632_0115528 3300046519 Bacteria 1257
222 Ga0495643_0147404 3300046522 Bacteria 1168
223 Ga0495643_0267536 3300046522 Bacteria 791
224 Ga0495642_0042451 3300046528 Bacteria 1853
225 Ga0495654_0002265 3300046530 Bacteria 12449
226 Ga0495621_0064589 3300046539 Bacteria 1336
227 Ga0495611_0013987 3300046648 Bacteria 3424
228 Ga0495669_0168781 3300046684 Bacteria 1040
229 Ga0495624_0027574 3300046690 Bacteria 3718
230 Ga0495674_0008260 3300047319 Bacteria 9932
231 Ga0495674_0277552 3300047319 Bacteria 1374
232 Ga0495676_0382388 3300047321 Bacteria 936
233 Ga0495687_070740 3300047443 Bacteria 1400
234 Ga0495602_0032791 3300048088 Bacteria 4886
235 Ga0495614_0070615 3300048089 Bacteria 1505
236 Ga0496101_0052121 3300048904 Bacteria 2950
237 Ga0496102_0005583 3300048905 Bacteria 10683
238 Ga0496102_0010570 3300048905 Bacteria 7950
239 Ga0496102_0091837 3300048905 Bacteria 2811
240 Ga0496102_0242672 3300048905 Bacteria 1699
241 Ga0496103_0101333 3300048906 Bacteria 1823
242 Ga0496106_0057564 3300048909 Bacteria 2940
243 Ga0496106_0063401 3300048909 Bacteria 2809
244 Ga0496106_0629158 3300048909 Bacteria 858
245 Ga0496107_0187977 3300048910 Bacteria 1534
246 Ga0496107_0742854 3300048910 Bacteria 720
247 Ga0496108_0225368 3300048911 Bacteria 1629
248 Ga0496109_0041522 3300048912 Bacteria 4166
249 Ga0496109_0504690 3300048912 Unclassified 1142
250 Ga0496110_0210080 3300048913 Bacteria 1769
251 Ga0496110_0442585 3300048913 Bacteria 1184
252 Ga0496111_0191888 3300048914 Bacteria 1519
253 Ga0496112_0481634 3300048915 Unclassified 1177
254 Ga0496112_0541374 3300048915 Bacteria 1098
255 Ga0496113_0249087 3300048916 Bacteria 1418
256 Ga0496113_0390484 3300048916 Bacteria 1117
257 Ga0496113_0835322 3300048916 Bacteria 731
258 Ga0496114_0010920 3300048917 Bacteria 7239
259 Ga0496114_0036571 3300048917 Bacteria 4059
260 Ga0496115_1003569 3300048918 Bacteria 638
261 Ga0496118_0034101 3300048921 Bacteria 4161
262 Ga0496121_0050656 3300048924 Unclassified 3505
263 Ga0496121_0569058 3300048924 Unclassified 705
264 Ga0496125_0047353 3300048928 Unclassified 3597
265 Ga0496126_0717456 3300048929 Bacteria 775
266 Ga0501036_0042055 3300049572 Bacteria 3868
267 Ga0501037_0140704 3300049573 Bacteria 1727
268 Ga0501037_0556886 3300049573 Bacteria 773
269 Ga0501038_0154103 3300049574 Bacteria 1872
270 Ga0501039_0002626 3300049575 Bacteria 13415
271 Ga0501041_0018849 3300049577 Bacteria 4110
272 Ga0501042_0054777 3300049578 Bacteria 2845
273 Ga0501043_0759143 3300049579 Bacteria 704
274 Ga0501046_0074474 3300049580 Bacteria 2634
275 Ga0501046_0657534 3300049580 Bacteria 740
276 Ga0501068_0031000 3300049584 Bacteria 3175
277 Ga0501069_0399399 3300049585 Bacteria 813
278 Ga0501072_0008329 3300049588 Bacteria 7876
279 Ga0501075_0001378 3300049591 Bacteria 15819
280 Ga0501075_0051602 3300049591 Bacteria 3093
281 Ga0501076_0000031 3300049592 Bacteria 73431
282 Ga0501076_0004285 3300049592 Bacteria 10110
283 Ga0501077_0045359 3300049593 Bacteria 2792
284 Ga0501217_000954 3300049661 Bacteria 5192
285 Ga0501235_163736 3300049669 Unclassified 584
286 Ga0501247_082268 3300049677 Unclassified 521
287 Ga0501252_005105 3300049682 Bacteria 1417
288 Ga0501079_0012355 3300049741 Bacteria 6516
289 Ga0501080_0003854 3300049742 Bacteria 13255
290 Ga0501081_0000191 3300049743 Bacteria 29657
291 Ga0501045_0000383 3300049824 Bacteria 26686
292 Ga0501045_0431201 3300049824 Bacteria 980
293 Ga0501226_000004 3300049853 Bacteria 284656
294 nmdc:mga03n38_13386_c1 3300050490 Bacteria 3115
295 nmdc:mga0yw44_53533_c1 3300050492 Bacteria 2452
296 nmdc:mga0k408_10191_c1 3300050493 Bacteria 5081
297 nmdc:mga0k408_104380_c1 3300050493 Bacteria 1672
298 nmdc:mga0k408_89870_c1 3300050493 Bacteria 1804
299 nmdc:mga06z11_4763_c1 3300050494 Bacteria 5367
300 nmdc:mga07m45_284686_c1 3300050496 Bacteria 961
301 nmdc:mga07m45_549728_c1 3300050496 Bacteria 668
302 nmdc:mga0qj67_1297372_c1 3300050509 Unclassified 564
303 Ga0500644_0006260 3300053088 Bacteria 3039
304 Ga0500583_0068668 3300053092 Bacteria 1690
305 Ga0500583_0070027 3300053092 Unclassified 1675
306 Ga0500583_0183986 3300053092 Bacteria 1040
307 Ga0500641_0096086 3300053096 Unclassified 1268
308 Ga0500557_007680 3300053105 Bacteria 2533
309 Ga0500569_155419 3300053109 Unclassified 773
310 Ga0500593_001913 3300053117 Bacteria 7503
311 Ga0500594_0077461 3300053118 Unclassified 989
312 Ga0500608_291058 3300053122 Unclassified 612
313 Ga0500628_002571 3300053129 Bacteria 2993
314 Ga0500642_0058370 3300053130 Bacteria 1725
315 Ga0500655_002429 3300053133 Bacteria 3395
316 Ga0500604_0000393 3300053151 Bacteria 12013
317 Ga0500616_0000049 3300053153 Bacteria 303396
318 Ga0500645_008419 3300053730 Bacteria 3524
319 Ga0500656_026807 3300053732 Unclassified 746
320 Ga0501084_0004406 3300054114 Bacteria 11484
321 Ga0501082_0003366 3300060353 Bacteria 13956
322 Ga0466962_0008023 3300061719 Bacteria 5063
323 Ga0530510_0005597 3300061734 Bacteria 8706

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053118 Ga0500594_0077461 Ga0500594_0077461_555_965 125
2 3300042139 Ga0450904_000006 Ga0450904_000006_18193_18588 129
3 3300042435 Ga0439434_0369763 Ga0439434_0369763_93_488 129
4 3300050509 nmdc:mga0qj67_1297372_c1 nmdc:mga0qj67_1297372_c1_57_473 129
5 3300041458 Ga0451798_1067716 Ga0451798_1067716_375_842 132
6 3300031665 Ga0316575_10188480 Ga0316575_101884802 137
7 3300014968 Ga0157379_10646833 Ga0157379_106468332 139
8 3300042532 Ga0450893_0047354 Ga0450893_0047354_144_614 139
9 3300049584 Ga0501068_0031000 Ga0501068_0031000_814_1275 147
10 3300005455 Ga0070663_100280694 Ga0070663_1002806941 152
11 3300025899 Ga0207642_10204940 Ga0207642_102049401 152
12 3300046522 Ga0495643_0147404 Ga0495643_0147404_521_1063 152
13 3300049572 Ga0501036_0042055 Ga0501036_0042055_2925_3404 153
14 3300049573 Ga0501037_0140704 Ga0501037_0140704_1159_1638 153
15 3300049573 Ga0501037_0556886 Ga0501037_0556886_284_763 153
16 3300049574 Ga0501038_0154103 Ga0501038_0154103_727_1206 153
17 3300049575 Ga0501039_0002626 Ga0501039_0002626_9234_9713 153
18 3300049577 Ga0501041_0018849 Ga0501041_0018849_3441_3920 153
19 3300049578 Ga0501042_0054777 Ga0501042_0054777_1193_1672 153
20 3300049580 Ga0501046_0074474 Ga0501046_0074474_73_552 153
21 3300049580 Ga0501046_0657534 Ga0501046_0657534_228_707 153
22 3300049585 Ga0501069_0399399 Ga0501069_0399399_278_757 153
23 3300049588 Ga0501072_0008329 Ga0501072_0008329_4702_5181 153
24 3300049591 Ga0501075_0001378 Ga0501075_0001378_10909_11388 153
25 3300049591 Ga0501075_0051602 Ga0501075_0051602_1362_1841 153
26 3300049592 Ga0501076_0000031 Ga0501076_0000031_33234_33713 153
27 3300049592 Ga0501076_0004285 Ga0501076_0004285_4350_4829 153
28 3300049593 Ga0501077_0045359 Ga0501077_0045359_836_1315 153
29 3300049741 Ga0501079_0012355 Ga0501079_0012355_4812_5291 153
30 3300049742 Ga0501080_0003854 Ga0501080_0003854_5729_6208 153
31 3300049743 Ga0501081_0000191 Ga0501081_0000191_29136_29615 153
32 3300049824 Ga0501045_0000383 Ga0501045_0000383_20361_20840 153
33 3300049824 Ga0501045_0431201 Ga0501045_0431201_472_951 153
34 3300054114 Ga0501084_0004406 Ga0501084_0004406_1667_2146 153
35 3300060353 Ga0501082_0003366 Ga0501082_0003366_8590_9069 153
36 3300061734 Ga0530510_0005597 Ga0530510_0005597_2356_2835 153
37 iso_pu_bacteria 2808606373 2808906680 154
38 3300003322 rootL2_10001745 rootL2_100017452 155
39 3300005937 Ga0081455_10176539 Ga0081455_101765391 155
40 3300031238 Ga0265332_10262778 Ga0265332_102627781 155
41 3300041496 Ga0451839_1225651 Ga0451839_1225651_12_572 155
42 3300041498 Ga0451841_1060093 Ga0451841_1060093_125_685 155
43 3300050493 nmdc:mga0k408_89870_c1 nmdc:mga0k408_89870_c1_638_1198 155
44 3300053153 Ga0500616_0000049 Ga0500616_0000049_170724_171212 155
45 3300005262 Ga0065165_1000873 Ga0065165_100087322 156
46 3300022467 Ga0224712_10284580 Ga0224712_102845801 156
47 3300025972 Ga0207668_10455400 Ga0207668_104554002 156
48 3300028380 Ga0268265_10299604 Ga0268265_102996042 156
49 3300032139 Ga0316580_10040208 Ga0316580_100402082 156
50 3300044658 Ga0466972_0076192 Ga0466972_0076192_158_670 156
51 3300047443 Ga0495687_070740 Ga0495687_070740_851_1351 156
52 3300053092 Ga0500583_0070027 Ga0500583_0070027_656_1162 156
53 3300053096 Ga0500641_0096086 Ga0500641_0096086_299_805 156
54 3300053109 Ga0500569_155419 Ga0500569_155419_209_715 156
55 3300053732 Ga0500656_026807 Ga0500656_026807_39_545 156
56 3300003316 rootH1_10003602 rootH1_100036022 157
57 3300003322 rootL2_10001705 rootL2_100017058 157
58 3300003322 rootL2_10031533 rootL2_100315334 157
59 3300003323 rootH1_10009037 rootH1_100090373 157
60 3300003791 Ga0055530_10023303 Ga0055530_100233032 157
61 3300014326 Ga0157380_10065030 Ga0157380_100650302 157
62 3300025298 Ga0209050_1003038 Ga0209050_100303810 157
63 3300031456 Ga0307513_10190975 Ga0307513_101909752 157
64 3300031548 Ga0307408_100279251 Ga0307408_1002792512 157
65 3300041492 Ga0451835_0594784 Ga0451835_0594784_16_507 157
66 3300041997 Ga0439431_0170527 Ga0439431_0170527_36_518 157
67 3300042000 Ga0439437_000086 Ga0439437_000086_1060_1542 157
68 3300042012 Ga0439455_0019013 Ga0439455_0019013_897_1379 157
69 3300042013 Ga0439456_005434 Ga0439456_005434_1469_1951 157
70 3300042115 Ga0450911_000006 Ga0450911_000006_112992_113474 157
71 3300042130 Ga0450892_010781 Ga0450892_010781_181_663 157
72 3300042138 Ga0450903_003391 Ga0450903_003391_1460_1942 157
73 3300042156 Ga0439446_0053200 Ga0439446_0053200_380_862 157
74 3300042436 Ga0439435_0053148 Ga0439435_0053148_654_1136 157
75 3300042438 Ga0439459_0095892 Ga0439459_0095892_158_640 157
76 3300042461 Ga0439460_0197399 Ga0439460_0197399_95_577 157
77 3300042532 Ga0450893_0024530 Ga0450893_0024530_491_973 157
78 3300044712 Ga0453684_1219055 Ga0453684_1219055_300_773 157
79 3300045051 Ga0451576_1102378 Ga0451576_1102378_311_784 157
80 3300046460 Ga0495638_0000004 Ga0495638_0000004_365733_366212 157
81 3300046463 Ga0495653_0512785 Ga0495653_0512785_47_541 157
82 3300046517 Ga0495630_0008561 Ga0495630_0008561_4149_4643 157
83 3300046539 Ga0495621_0064589 Ga0495621_0064589_86_649 157
84 3300046690 Ga0495624_0027574 Ga0495624_0027574_475_969 157
85 3300047319 Ga0495674_0008260 Ga0495674_0008260_6811_7305 157
86 3300047321 Ga0495676_0382388 Ga0495676_0382388_272_766 157
87 3300048088 Ga0495602_0032791 Ga0495602_0032791_2616_3110 157
88 3300048089 Ga0495614_0070615 Ga0495614_0070615_301_795 157
89 3300048905 Ga0496102_0242672 Ga0496102_0242672_373_867 157
90 3300048906 Ga0496103_0101333 Ga0496103_0101333_497_991 157
91 3300048921 Ga0496118_0034101 Ga0496118_0034101_2740_3234 157
92 3300048924 Ga0496121_0569058 Ga0496121_0569058_172_666 157
93 3300049661 Ga0501217_000954 Ga0501217_000954_4697_5176 157
94 3300049669 Ga0501235_163736 Ga0501235_163736_17_496 157
95 3300049677 Ga0501247_082268 Ga0501247_082268_20_499 157
96 3300049853 Ga0501226_000004 Ga0501226_000004_47586_48068 157
97 3300053105 Ga0500557_007680 Ga0500557_007680_1935_2414 157
98 3300003323 rootH1_10129979 rootH1_101299793 158
99 3300005335 Ga0070666_10245442 Ga0070666_102454422 158
100 3300005338 Ga0068868_100097915 Ga0068868_1000979153 158
101 3300005355 Ga0070671_100020763 Ga0070671_1000207632 158
102 3300005355 Ga0070671_100044313 Ga0070671_1000443133 158
103 3300005364 Ga0070673_100356012 Ga0070673_1003560122 158
104 3300005365 Ga0070688_100464845 Ga0070688_1004648452 158
105 3300005367 Ga0070667_100025363 Ga0070667_1000253632 158
106 3300005441 Ga0070700_100184572 Ga0070700_1001845722 158
107 3300005456 Ga0070678_100455525 Ga0070678_1004555251 158
108 3300005548 Ga0070665_100289735 Ga0070665_1002897352 158
109 3300005564 Ga0070664_100345172 Ga0070664_1003451723 158
110 3300005564 Ga0070664_101319290 Ga0070664_1013192901 158
111 3300005617 Ga0068859_100002402 Ga0068859_1000024023 158
112 3300005618 Ga0068864_100096008 Ga0068864_1000960082 158
113 3300005841 Ga0068863_100019876 Ga0068863_1000198763 158
114 3300005842 Ga0068858_100000113 Ga0068858_10000011318 158
115 3300005843 Ga0068860_100127499 Ga0068860_1001274993 158
116 3300006931 Ga0097620_100002402 Ga0097620_1000024023 158
117 3300009092 Ga0105250_10033729 Ga0105250_100337292 158
118 3300009098 Ga0105245_10224193 Ga0105245_102241933 158
119 3300009101 Ga0105247_10000445 Ga0105247_1000044534 158
120 3300009177 Ga0105248_10156004 Ga0105248_101560043 158
121 3300009177 Ga0105248_10638638 Ga0105248_106386381 158
122 3300009545 Ga0105237_10081814 Ga0105237_100818144 158
123 3300009553 Ga0105249_10213099 Ga0105249_102130992 158
124 3300010375 Ga0105239_10163026 Ga0105239_101630262 158
125 3300013296 Ga0157374_10348110 Ga0157374_103481102 158
126 3300013306 Ga0163162_10291432 Ga0163162_102914322 158
127 3300013308 Ga0157375_10147765 Ga0157375_101477652 158
128 3300013308 Ga0157375_10222212 Ga0157375_102222122 158
129 3300014325 Ga0163163_10004816 Ga0163163_1000481610 158
130 3300014325 Ga0163163_10139344 Ga0163163_101393442 158
131 3300014968 Ga0157379_10032641 Ga0157379_100326413 158
132 3300014968 Ga0157379_10426550 Ga0157379_104265502 158
133 3300025711 Ga0207696_1018304 Ga0207696_10183043 158
134 3300025900 Ga0207710_10000334 Ga0207710_100003343 158
135 3300025914 Ga0207671_10357057 Ga0207671_103570572 158
136 3300025931 Ga0207644_10009476 Ga0207644_100094764 158
137 3300025941 Ga0207711_10384144 Ga0207711_103841442 158
138 3300025945 Ga0207679_10064184 Ga0207679_100641843 158
139 3300025986 Ga0207658_10009188 Ga0207658_100091883 158
140 3300026035 Ga0207703_10007828 Ga0207703_100078285 158
141 3300026067 Ga0207678_10235785 Ga0207678_102357854 158
142 3300026088 Ga0207641_10104176 Ga0207641_101041762 158
143 3300028379 Ga0268266_10091594 Ga0268266_100915942 158
144 3300028381 Ga0268264_10007153 Ga0268264_100071532 158
145 3300031456 Ga0307513_10107570 Ga0307513_101075702 158
146 3300031691 Ga0316579_10020191 Ga0316579_100201914 158
147 3300031727 Ga0316576_10029389 Ga0316576_100293894 158
148 3300031727 Ga0316576_10593467 Ga0316576_105934671 158
149 3300031728 Ga0316578_10054758 Ga0316578_100547582 158
150 3300031728 Ga0316578_10325966 Ga0316578_103259662 158
151 3300031733 Ga0316577_10276910 Ga0316577_102769101 158
152 3300031733 Ga0316577_10295947 Ga0316577_102959471 158
153 3300032133 Ga0316583_10174833 Ga0316583_101748331 158
154 3300032137 Ga0316585_10096945 Ga0316585_100969452 158
155 3300032139 Ga0316580_10035104 Ga0316580_100351041 158
156 3300035398 Ga0316574_0005573 Ga0316574_0005573_203_727 158
157 3300035398 Ga0316574_0199476 Ga0316574_0199476_356_862 158
158 3300035398 Ga0316574_0575345 Ga0316574_0575345_174_680 158
159 3300036647 Ga0316582_0068827 Ga0316582_0068827_1001_1498 158
160 3300036647 Ga0316582_0440069 Ga0316582_0440069_125_631 158
161 3300036712 Ga0316584_0126827 Ga0316584_0126827_715_1212 158
162 3300036712 Ga0316584_0170828 Ga0316584_0170828_972_1478 158
163 3300036712 Ga0316584_0368451 Ga0316584_0368451_225_731 158
164 3300036712 Ga0316584_0501755 Ga0316584_0501755_321_827 158
165 3300037068 Ga0373925_0382798 Ga0373925_0382798_592_1110 158
166 3300037588 Ga0316581_0152319 Ga0316581_0152319_181_687 158
167 3300044656 Ga0466969_0103677 Ga0466969_0103677_45_557 158
168 3300044684 Ga0466966_0019262 Ga0466966_0019262_3202_3714 158
169 3300044693 Ga0466961_0027432 Ga0466961_0027432_2788_3300 158
170 3300044706 Ga0466964_0015707 Ga0466964_0015707_752_1264 158
171 3300044719 Ga0466971_0027849 Ga0466971_0027849_122_634 158
172 3300044765 Ga0466970_0126360 Ga0466970_0126360_153_665 158
173 3300044842 Ga0466957_1084046 Ga0466957_1084046_44_556 158
174 3300045836 Ga0466958_0559383 Ga0466958_0559383_28_540 158
175 3300046459 Ga0495629_0656231 Ga0495629_0656231_150_650 158
176 3300046519 Ga0495632_0115528 Ga0495632_0115528_343_864 158
177 3300046528 Ga0495642_0042451 Ga0495642_0042451_1172_1690 158
178 3300046648 Ga0495611_0013987 Ga0495611_0013987_2850_3380 158
179 3300046684 Ga0495669_0168781 Ga0495669_0168781_58_588 158
180 3300047319 Ga0495674_0277552 Ga0495674_0277552_99_599 158
181 3300048904 Ga0496101_0052121 Ga0496101_0052121_2272_2790 158
182 3300048905 Ga0496102_0010570 Ga0496102_0010570_1155_1673 158
183 3300048905 Ga0496102_0091837 Ga0496102_0091837_1721_2233 158
184 3300048909 Ga0496106_0057564 Ga0496106_0057564_650_1168 158
185 3300048909 Ga0496106_0063401 Ga0496106_0063401_495_1013 158
186 3300048909 Ga0496106_0629158 Ga0496106_0629158_196_708 158
187 3300048910 Ga0496107_0187977 Ga0496107_0187977_457_975 158
188 3300048910 Ga0496107_0742854 Ga0496107_0742854_79_591 158
189 3300048911 Ga0496108_0225368 Ga0496108_0225368_535_1053 158
190 3300048912 Ga0496109_0041522 Ga0496109_0041522_616_1134 158
191 3300048912 Ga0496109_0504690 Ga0496109_0504690_391_909 158
192 3300048913 Ga0496110_0210080 Ga0496110_0210080_740_1258 158
193 3300048914 Ga0496111_0191888 Ga0496111_0191888_592_1161 158
194 3300048915 Ga0496112_0481634 Ga0496112_0481634_360_872 158
195 3300048915 Ga0496112_0541374 Ga0496112_0541374_340_909 158
196 3300048916 Ga0496113_0249087 Ga0496113_0249087_216_728 158
197 3300048916 Ga0496113_0390484 Ga0496113_0390484_327_845 158
198 3300048916 Ga0496113_0835322 Ga0496113_0835322_138_656 158
199 3300048917 Ga0496114_0010920 Ga0496114_0010920_349_867 158
200 3300048918 Ga0496115_1003569 Ga0496115_1003569_47_565 158
201 3300048924 Ga0496121_0050656 Ga0496121_0050656_2046_2558 158
202 3300048928 Ga0496125_0047353 Ga0496125_0047353_2210_2722 158
203 3300049579 Ga0501043_0759143 Ga0501043_0759143_144_656 158
204 3300053092 Ga0500583_0068668 Ga0500583_0068668_507_1028 158
205 3300061719 Ga0466962_0008023 Ga0466962_0008023_2882_3394 158
206 3300005842 Ga0068858_100478419 Ga0068858_1004784192 160
207 3300009551 Ga0105238_10000830 Ga0105238_1000083019 160
208 3300035398 Ga0316574_0375069 Ga0316574_0375069_150_707 160
209 3300036712 Ga0316584_0011964 Ga0316584_0011964_1133_1690 160
210 3300041512 Ga0451853_0887354 Ga0451853_0887354_217_777 160
211 3300028379 Ga0268266_10876661 Ga0268266_108766612 161
212 3300046519 Ga0495632_0112201 Ga0495632_0112201_307_867 161
213 3300046522 Ga0495643_0267536 Ga0495643_0267536_113_673 161
214 3300003320 rootH2_10017766 rootH2_100177665 162
215 3300048929 Ga0496126_0717456 Ga0496126_0717456_21_536 162
216 3300003323 rootH1_10225941 rootH1_102259412 163
217 3300031665 Ga0316575_10030378 Ga0316575_100303782 163
218 3300031691 Ga0316579_10165879 Ga0316579_101658791 163
219 3300031733 Ga0316577_10150507 Ga0316577_101505072 163
220 3300032133 Ga0316583_10148243 Ga0316583_101482431 163
221 3300033528 Ga0316588_1000471 Ga0316588_10004717 163
222 3300035398 Ga0316574_0258011 Ga0316574_0258011_137_691 163
223 3300036647 Ga0316582_0065565 Ga0316582_0065565_1593_2147 163
224 iso_pu_bacteria 2904541872 2904547043 163
225 iso_pu_bacteria 2929160207 2929164592 163
226 iso_pu_bacteria 2945909444 2945910801 163
227 iso_pu_bacteria 2945984333 2945987015 163
228 iso_pu_bacteria 2954767861 2954771446 164
229 3300053117 Ga0500593_001913 Ga0500593_001913_4713_5210 165
230 3300013104 Ga0157370_10011683 Ga0157370_100116834 166
231 3300017792 Ga0163161_10000180 Ga0163161_1000018016 166
232 3300025294 Ga0209025_1000133 Ga0209025_100013345 166
233 3300026041 Ga0207639_10449871 Ga0207639_104498712 166
234 3300045051 Ga0451576_0884613 Ga0451576_0884613_213_743 166
235 3300049682 Ga0501252_005105 Ga0501252_005105_593_1105 166
236 3300005330 Ga0070690_100409112 Ga0070690_1004091122 167
237 3300006051 Ga0075364_10113037 Ga0075364_101130372 167
238 3300006177 Ga0075362_10052421 Ga0075362_100524212 167
239 3300006178 Ga0075367_10004087 Ga0075367_100040872 167
240 3300006186 Ga0075369_10002759 Ga0075369_100027592 167
241 3300006195 Ga0075366_10003646 Ga0075366_100036463 167
242 3300025940 Ga0207691_10555611 Ga0207691_105556112 167
243 3300026116 Ga0207674_10412781 Ga0207674_104127811 167
244 3300026142 Ga0207698_10536440 Ga0207698_105364402 167
245 3300030745 Ga0316182_1173201 Ga0316182_11732013 167
246 3300045976 Ga0466967_0114364 Ga0466967_0114364_596_1117 167
247 3300046471 Ga0495650_0017971 Ga0495650_0017971_1392_1916 167
248 3300046530 Ga0495654_0002265 Ga0495654_0002265_7512_8063 167
249 3300050490 nmdc:mga03n38_13386_c1 nmdc:mga03n38_13386_c1_780_1331 167
250 3300050492 nmdc:mga0yw44_53533_c1 nmdc:mga0yw44_53533_c1_738_1289 167
251 3300050493 nmdc:mga0k408_10191_c1 nmdc:mga0k408_10191_c1_1102_1653 167
252 3300050493 nmdc:mga0k408_104380_c1 nmdc:mga0k408_104380_c1_322_873 167
253 3300050494 nmdc:mga06z11_4763_c1 nmdc:mga06z11_4763_c1_3715_4266 167
254 3300050496 nmdc:mga07m45_284686_c1 nmdc:mga07m45_284686_c1_379_930 167
255 3300050496 nmdc:mga07m45_549728_c1 nmdc:mga07m45_549728_c1_95_646 167
256 3300053092 Ga0500583_0183986 Ga0500583_0183986_202_753 167
257 3300053130 Ga0500642_0058370 Ga0500642_0058370_627_1178 167
258 3300053133 Ga0500655_002429 Ga0500655_002429_474_1025 167
259 3300053151 Ga0500604_0000393 Ga0500604_0000393_3365_3916 167
260 iso_pu_bacteria 2738543013 2739251598 167
261 3300031649 Ga0307514_10000330 Ga0307514_1000033072 169
262 3300042435 Ga0439434_0032156 Ga0439434_0032156_625_1140 169
263 3300031456 Ga0307513_10016333 Ga0307513_100163334 170
264 3300048913 Ga0496110_0442585 Ga0496110_0442585_413_976 170
265 3300003322 rootL2_10005015 rootL2_100050152 171
266 3300003781 Ga0055536_1014941 Ga0055536_10149412 171
267 3300003784 Ga0055534_1000726 Ga0055534_10007263 171
268 3300003792 Ga0055540_1003052 Ga0055540_10030528 171
269 3300009148 Ga0105243_10006992 Ga0105243_100069928 171
270 3300025284 Ga0209130_1003048 Ga0209130_10030482 171
271 3300025291 Ga0209675_1001101 Ga0209675_100110113 171
272 3300025292 Ga0209676_1000293 Ga0209676_100029383 171
273 3300025292 Ga0209676_1008235 Ga0209676_10082354 171
274 3300025294 Ga0209025_1031822 Ga0209025_10318222 171
275 3300025298 Ga0209050_1036185 Ga0209050_10361852 171
276 3300025303 Ga0209051_1000130 Ga0209051_100013035 171
277 3300025304 Ga0209257_1013959 Ga0209257_10139594 171
278 3300025935 Ga0207709_10000191 Ga0207709_1000019115 171
279 3300031731 Ga0307405_10169429 Ga0307405_101694292 171
280 3300031731 Ga0307405_10252683 Ga0307405_102526832 171
281 3300031911 Ga0307412_10041945 Ga0307412_100419452 171
282 3300032002 Ga0307416_100128363 Ga0307416_1001283632 171
283 3300032005 Ga0307411_10120687 Ga0307411_101206872 171
284 3300053122 Ga0500608_291058 Ga0500608_291058_47_583 171
285 3300002704 JGI25155J39150_1000002 JGI25155J39150_100000215 172
286 3300002705 JGI25156J39149_1000003 JGI25156J39149_1000003290 172
287 3300002738 JGI25154J39366_1000009 JGI25154J39366_100000915 172
288 3300002741 JGI25157J39369_1000002 JGI25157J39369_100000215 172
289 3300003773 Ga0055537_1017157 Ga0055537_10171571 172
290 3300003775 Ga0055524_1000139 Ga0055524_100013954 172
291 3300003791 Ga0055530_10001272 Ga0055530_100012726 172
292 3300003792 Ga0055540_1000090 Ga0055540_100009063 172
293 3300003792 Ga0055540_1000091 Ga0055540_100009161 172
294 3300003794 Ga0055531_10008196 Ga0055531_100081965 172
295 3300006946 Ga0079104_1000916 Ga0079104_100091623 172
296 3300009093 Ga0105240_10002128 Ga0105240_1000212820 172
297 3300009545 Ga0105237_10007938 Ga0105237_1000793810 172
298 3300010375 Ga0105239_10110491 Ga0105239_101104913 172
299 3300014325 Ga0163163_10209743 Ga0163163_102097432 172
300 3300025206 Ga0209435_100001 Ga0209435_100001701 172
301 3300025246 Ga0209646_1000001 Ga0209646_10000011070 172
302 3300025250 Ga0209026_1000003 Ga0209026_1000003701 172
303 3300025256 Ga0209759_1000001 Ga0209759_1000001701 172
304 3300025258 Ga0209129_1007630 Ga0209129_10076301 172
305 3300025263 Ga0209565_1000407 Ga0209565_10004072 172
306 3300025291 Ga0209675_1001324 Ga0209675_10013247 172
307 3300025291 Ga0209675_1025528 Ga0209675_10255281 172
308 3300025294 Ga0209025_1003720 Ga0209025_10037201 172
309 3300025295 Ga0209564_1002323 Ga0209564_10023238 172
310 3300025298 Ga0209050_1000326 Ga0209050_100032627 172
311 3300025298 Ga0209050_1000967 Ga0209050_10009674 172
312 3300025298 Ga0209050_1013473 Ga0209050_10134732 172
313 3300025299 Ga0209256_1000019 Ga0209256_1000019468 172
314 3300025303 Ga0209051_1000133 Ga0209051_100013364 172
315 3300025304 Ga0209257_1000038 Ga0209257_100003864 172
316 3300025913 Ga0207695_10041823 Ga0207695_100418231 172
317 3300025914 Ga0207671_10014755 Ga0207671_100147552 172
318 3300025924 Ga0207694_10105375 Ga0207694_101053752 172
319 3300026041 Ga0207639_10751887 Ga0207639_107518872 172
320 3300027111 Ga0209281_1000935 Ga0209281_10009353 172
321 3300028379 Ga0268266_10170400 Ga0268266_101704002 172
322 3300030521 Ga0307511_10001570 Ga0307511_1000157013 172
323 3300037471 Ga0395905_0111062 Ga0395905_0111062_896_1435 172
324 3300041451 Ga0451791_1692606 Ga0451791_1692606_144_662 172
325 3300041507 Ga0451851_0153605 Ga0451851_0153605_277_858 172
326 3300048905 Ga0496102_0005583 Ga0496102_0005583_2975_3520 172
327 3300048917 Ga0496114_0036571 Ga0496114_0036571_379_903 172
328 3300053088 Ga0500644_0006260 Ga0500644_0006260_2440_2958 172
329 3300053129 Ga0500628_002571 Ga0500628_002571_2270_2836 172
330 3300053730 Ga0500645_008419 Ga0500645_008419_1385_1903 172

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03473

MOSC

MOSC domain

64

180

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1oru-assembly1.cif.gz_B crystal structure of apc1665, yuad protein from bacillus subtilis 0.8029 17 172
1o67-assembly1.cif.gz_A crystal structure of an hypothetical protein 0.7906 17 167
1o65-assembly2.cif.gz_B crystal structure of an hypothetical protein 0.7643 17 167
1o65-assembly1.cif.gz_A crystal structure of an hypothetical protein 0.7528 17 167
5yhi-assembly1.cif.gz_B crystal structure of yiim from escherichia coli 0.7488 20 172
ID Description Score Start End Superfamily
1oruB00 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.7811 18 172 2.40.33.20
5yhiA00 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.7552 20 172 2.40.33.20
af_Q2FVS9_1_216_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.7537 20 168 2.40.33.20
af_P95151_15_247_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.7437 14 168 2.40.33.20
1oruB00 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.7047 18 172 2.40.33.20
ID Description Score Start End GO Terms
AF-A0A554RYV3-F1-model_v4 MOSC domain-containing protein 0.9955 5 172 GO:0003824
GO:0030151
GO:0030170
AF-F5Y4T3-F1-model_v4 MOSC domain-containing protein 0.9938 5 171 GO:0003824
GO:0030151
GO:0030170
AF-A0A2G6WUD8-F1-model_v4 MOSC domain-containing protein 0.993 1 172 GO:0003824
GO:0030151
GO:0030170
AF-A0A2G6WUD8-F1-model_v4 MOSC domain-containing protein 0.9872 1 172 GO:0003824
GO:0030151
GO:0030170
AF-A0A5B8CUL7-F1-model_v4 MOSC domain-containing protein 0.9834 4 169 GO:0003824
GO:0030151
GO:0030170

Feature Viewer

pLDDT pTM Quality
92.73 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map