F410140

General Info

Members Datasets Scaffolds Average Seq Length
330 218 656 714

Family's Representative Sequence

Representative Sequence 3300028017|Ga0265356_1000039|Ga0265356_100003916
Length 821
Sequence MDDEPVKLDEGIFVYERLDALSRGAFTPSVLSRERLGSGRNRGFRAFYFELIVFFRATLHAATFARVLPFVMLGAQAVRYVIREYGPMLRFSCCILALAVTGAVPAGFPTPPXVPPQRAVAESKYGTSVTDPYRYFENMQDPVVVQFFKEQNDYTRAVLARLGEPRERLFDRIKALDNAGVLVTGVTRDGPDYFYEKLNPGDNSPKLYVRNVDGSGERVLVDPQSLATAGKHYTINYFLPSLDGKRVAYGISEGGSEAEVIHVVDTATTHVLPDAIDRAYYIGVTSWLPDGNSFYYVRFPKLRPDEPATDKEKRPVAYLHVLGRDPDHDVAVFGYGVDPKIPFGVTDFPIVTRSPVSPYTVGMIVHGVANERTIYATRGAVLDSNIAWTPVATAADDVVNLDFKGSTIYLLSHKNAPAFKLLTTSLDAPNVATAQTVIPAGKDVLEDLDVAADGLYVLSREGGFGKITRVGIAGDGKPGEQTNVALPYEGSVTAIATDPREPGVVFGMTGWTHSQLYYAADANGAVTDTHLKPLANVDTSPYTSSEVSARSADGTMVPLSVVYRKGLSLDGSHPVYLQGYGAYGIELTPTFSATRIAWLERGGVFAVCHPRGGGWYGEAWHRAGMIATKPHTWQDFVACGRWLVNHKYTSPAHLAGEGTSAGGITIGRAITTQPQLFAAALDVVGASNALRAEFTPNGPPNIPEFGTVTNETGFRALYAMDAYEHVVPGTAYPAVMLVTGFNDPRVAPWQLAKFTARLARATTSGRPILLRVDYDAGHGFMAASREQTEQLLTDEYSFLLWQCGDPAFAGIPTRIYPRRAP

Samples

Sample ID Description Type Environment
1 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
77 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
80 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
81 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
82 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
129 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
130 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
131 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
132 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
133 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
134 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
137 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
138 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
139 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
140 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
141 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
142 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
143 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
144 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
159 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
160 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
161 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
162 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
163 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
164 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
165 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
166 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
167 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
168 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
169 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
170 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
171 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
172 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
173 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
174 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
175 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
176 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
177 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
178 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
179 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
180 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
181 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
182 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
183 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
184 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
185 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
186 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
187 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
188 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
189 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
190 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
191 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
192 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
193 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
194 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
195 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
196 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
197 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
198 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
199 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
200 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
201 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
202 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
203 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
204 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
205 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
206 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
207 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
208 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
209 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
210 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
215 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
216 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
217 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
218 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.09
Metatranscriptomes 0.61
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.61
Nodule 0
Rhizoplane 1.21
Rhizosphere 90.91
Stem 0
Stem Tuber 0
Unclassified 3.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265356_1000039 3300028017 Bacteria 21031
2 JGI25153J46596_10004549 3300003215 Bacteria 7449
3 rootH2_10019536 3300003320 Bacteria 3903
4 rootH1_10115361 3300003323 Bacteria 5228
5 Ga0070676_10001285 3300005328 Bacteria 12614
6 Ga0070683_100014197 3300005329 Bacteria 6959
7 Ga0070683_100069992 3300005329 Bacteria 3272
8 Ga0070683_100090121 3300005329 Bacteria 2879
9 Ga0070683_100102320 3300005329 Bacteria 2698
10 Ga0068869_100023640 3300005334 Bacteria 4249
11 Ga0070666_10000189 3300005335 Bacteria 42318
12 Ga0070680_100011448 3300005336 Bacteria 6864
13 Ga0070680_100018410 3300005336 Bacteria 5518
14 Ga0070680_100086420 3300005336 Bacteria 2592
15 Ga0068868_100009194 3300005338 Bacteria 7098
16 Ga0070689_100044629 3300005340 Bacteria 3410
17 Ga0070668_100000780 3300005347 Bacteria 21974
18 Ga0070669_100007865 3300005353 Bacteria 7621
19 Ga0070675_100004000 3300005354 Bacteria 11185
20 Ga0070675_100009582 3300005354 Bacteria 7538
21 Ga0070671_100021620 3300005355 Bacteria 5255
22 Ga0070671_100050877 3300005355 Bacteria 3446
23 Ga0070674_100005233 3300005356 Bacteria 7465
24 Ga0070659_100024897 3300005366 Bacteria 4592
25 Ga0070667_100001716 3300005367 Bacteria 19582
26 Ga0070667_100014209 3300005367 Bacteria 6577
27 Ga0070709_10004585 3300005434 Bacteria 7461
28 Ga0070709_10005181 3300005434 Bacteria 7052
29 Ga0070714_100005296 3300005435 Bacteria 9833
30 Ga0070714_100032803 3300005435 Bacteria 4337
31 Ga0070713_100028462 3300005436 Bacteria 4412
32 Ga0070710_10011034 3300005437 Bacteria 4454
33 Ga0070711_100007753 3300005439 Bacteria 6540
34 Ga0070708_100001317 3300005445 Bacteria 19038
35 Ga0070663_100023316 3300005455 Bacteria 4147
36 Ga0070678_100000206 3300005456 Bacteria 26238
37 Ga0070681_10000029 3300005458 Bacteria 104346
38 Ga0070681_10005906 3300005458 Bacteria 11849
39 Ga0068867_100001041 3300005459 Bacteria 18910
40 Ga0070685_10024935 3300005466 Bacteria 3289
41 Ga0070679_100006577 3300005530 Bacteria 10828
42 Ga0070684_100037939 3300005535 Bacteria 4136
43 Ga0070672_100002098 3300005543 Bacteria 12568
44 Ga0070696_100010411 3300005546 Bacteria 6231
45 Ga0070693_100044890 3300005547 Bacteria 2502
46 Ga0070665_100003042 3300005548 Bacteria 18075
47 Ga0070665_100003151 3300005548 Bacteria 17741
48 Ga0068855_100001205 3300005563 Bacteria 32157
49 Ga0068855_100004597 3300005563 Bacteria 16850
50 Ga0068855_100055516 3300005563 Bacteria 4652
51 Ga0070664_100092678 3300005564 Bacteria 2616
52 Ga0068857_100034341 3300005577 Bacteria 4486
53 Ga0068854_100021596 3300005578 Bacteria 4370
54 Ga0068856_100027325 3300005614 Bacteria 5567
55 Ga0068856_100043436 3300005614 Bacteria 4423
56 Ga0068856_100052719 3300005614 Bacteria 4012
57 Ga0068859_100000248 3300005617 Bacteria 53199
58 Ga0068859_100002862 3300005617 Bacteria 17512
59 Ga0068864_100012974 3300005618 Bacteria 6896
60 Ga0068866_10032211 3300005718 Bacteria 2532
61 Ga0068861_100061331 3300005719 Unclassified 2885
62 Ga0068863_100002768 3300005841 Bacteria 17374
63 Ga0068863_100010444 3300005841 Bacteria 9025
64 Ga0068858_100009090 3300005842 Bacteria 9504
65 Ga0068860_100002614 3300005843 Bacteria 18801
66 Ga0068860_100011359 3300005843 Bacteria 8776
67 Ga0068862_100049205 3300005844 Bacteria 3600
68 Ga0070717_10002752 3300006028 Bacteria 12429
69 Ga0097621_100002115 3300006237 Bacteria 13591
70 Ga0068871_100002345 3300006358 Bacteria 12901
71 Ga0075428_100047385 3300006844 Bacteria 4722
72 Ga0068865_100001013 3300006881 Bacteria 16162
73 Ga0097620_100000248 3300006931 Bacteria 53199
74 Ga0097620_100002862 3300006931 Bacteria 17512
75 Ga0099794_10002070 3300007265 Bacteria 7279
76 Ga0099794_10002135 3300007265 Bacteria 7188
77 Ga0105240_10003830 3300009093 Bacteria 23260
78 Ga0105240_10037176 3300009093 Bacteria 6258
79 Ga0105240_10062690 3300009093 Unclassified 4628
80 Ga0105240_10070001 3300009093 Bacteria 4341
81 Ga0105240_10147723 3300009093 Bacteria 2803
82 Ga0111539_10000224 3300009094 Bacteria 67805
83 Ga0105245_10043036 3300009098 Bacteria 4029
84 Ga0105247_10000222 3300009101 Bacteria 54538
85 Ga0105241_10009465 3300009174 Bacteria 7157
86 Ga0105248_10009756 3300009177 Bacteria 10579
87 Ga0105238_10116376 3300009551 Bacteria 2653
88 Ga0105249_10021159 3300009553 Bacteria 5823
89 Ga0105239_10099834 3300010375 Unclassified 3210
90 Ga0157373_10028747 3300013100 Bacteria 4009
91 Ga0157371_10010474 3300013102 Bacteria 7218
92 Ga0157371_10020394 3300013102 Bacteria 4877
93 Ga0157371_10030161 3300013102 Bacteria 3913
94 Ga0157369_10005143 3300013105 Bacteria 15313
95 Ga0157369_10038295 3300013105 Bacteria 5244
96 Ga0157369_10112716 3300013105 Bacteria 2889
97 Ga0157374_10019568 3300013296 Bacteria 5993
98 Ga0157378_10026744 3300013297 Bacteria 5086
99 Ga0163162_10004549 3300013306 Bacteria 13365
100 Ga0163162_10023360 3300013306 Bacteria 6102
101 Ga0157372_10000001 3300013307 Bacteria 791349
102 Ga0157372_10064385 3300013307 Bacteria 4114
103 Ga0157375_10001781 3300013308 Bacteria 18462
104 Ga0157375_10004651 3300013308 Bacteria 11932
105 Ga0157380_10000232 3300014326 Bacteria 33436
106 Ga0157377_10013614 3300014745 Bacteria 4121
107 Ga0157379_10012747 3300014968 Bacteria 7351
108 Ga0182006_1000005 3300015261 Bacteria 621201
109 Ga0182007_10002552 3300015262 Bacteria 8960
110 Ga0163161_10058842 3300017792 Bacteria 2793
111 Ga0213872_10000026 3300021361 Bacteria 149852
112 Ga0213872_10000327 3300021361 Bacteria 40322
113 Ga0213875_10000001 3300021388 Bacteria 2793540
114 Ga0209758_1000096 3300025297 Bacteria 231496
115 Ga0207697_10001949 3300025315 Bacteria 10962
116 Ga0207697_10005346 3300025315 Bacteria 5984
117 Ga0207682_10003086 3300025893 Bacteria 7299
118 Ga0207710_10000228 3300025900 Bacteria 48758
119 Ga0207680_10001972 3300025903 Bacteria 9608
120 Ga0207699_10028542 3300025906 Bacteria 3103
121 Ga0207645_10000905 3300025907 Bacteria 24586
122 Ga0207645_10012124 3300025907 Bacteria 5856
123 Ga0207707_10001433 3300025912 Bacteria 22060
124 Ga0207707_10038512 3300025912 Bacteria 4177
125 Ga0207707_10041345 3300025912 Bacteria 4026
126 Ga0207695_10054145 3300025913 Bacteria 4192
127 Ga0207695_10098045 3300025913 Bacteria 2931
128 Ga0207660_10042219 3300025917 Bacteria 3200
129 Ga0207660_10044094 3300025917 Bacteria 3137
130 Ga0207662_10016987 3300025918 Bacteria 4111
131 Ga0207657_10003266 3300025919 Bacteria 17353
132 Ga0207652_10007614 3300025921 Bacteria 8717
133 Ga0207681_10000944 3300025923 Bacteria 18951
134 Ga0207694_10016912 3300025924 Bacteria 5510
135 Ga0207694_10017591 3300025924 Bacteria 5403
136 Ga0207650_10002468 3300025925 Bacteria 12863
137 Ga0207650_10010569 3300025925 Bacteria 6339
138 Ga0207659_10001868 3300025926 Bacteria 12470
139 Ga0207659_10004777 3300025926 Bacteria 8216
140 Ga0207687_10068717 3300025927 Bacteria 2524
141 Ga0207700_10024860 3300025928 Bacteria 4151
142 Ga0207664_10018831 3300025929 Bacteria 5092
143 Ga0207664_10038404 3300025929 Bacteria 3713
144 Ga0207664_10094743 3300025929 Bacteria 2454
145 Ga0207644_10000950 3300025931 Bacteria 18500
146 Ga0207690_10031222 3300025932 Bacteria 3407
147 Ga0207669_10027214 3300025937 Bacteria 3126
148 Ga0207704_10001981 3300025938 Bacteria 9180
149 Ga0207691_10002655 3300025940 Bacteria 17478
150 Ga0207711_10008808 3300025941 Bacteria 8438
151 Ga0207711_10073839 3300025941 Bacteria 2965
152 Ga0207689_10005716 3300025942 Bacteria 11058
153 Ga0207689_10025564 3300025942 Bacteria 4948
154 Ga0207661_10007400 3300025944 Bacteria 7812
155 Ga0207661_10082785 3300025944 Bacteria 2654
156 Ga0207661_10098778 3300025944 Bacteria 2447
157 Ga0207667_10001237 3300025949 Bacteria 32048
158 Ga0207667_10029718 3300025949 Bacteria 5921
159 Ga0207667_10047990 3300025949 Bacteria 4517
160 Ga0207651_10060071 3300025960 Bacteria 2637
161 Ga0207668_10000919 3300025972 Bacteria 17751
162 Ga0207658_10001261 3300025986 Bacteria 20017
163 Ga0207658_10016773 3300025986 Bacteria 5040
164 Ga0207703_10007654 3300026035 Bacteria 8559
165 Ga0207678_10012225 3300026067 Bacteria 7537
166 Ga0207678_10016534 3300026067 Bacteria 6479
167 Ga0207708_10001426 3300026075 Bacteria 17937
168 Ga0207702_10031293 3300026078 Bacteria 4434
169 Ga0207702_10054090 3300026078 Bacteria 3401
170 Ga0207641_10002271 3300026088 Bacteria 17917
171 Ga0207648_10000126 3300026089 Bacteria 75403
172 Ga0207676_10010072 3300026095 Bacteria 6727
173 Ga0207674_10001525 3300026116 Bacteria 29849
174 Ga0207674_10004355 3300026116 Bacteria 17074
175 Ga0207675_100000347 3300026118 Bacteria 44211
176 Ga0207683_10002062 3300026121 Bacteria 17777
177 Ga0207698_10033219 3300026142 Bacteria 3747
178 Ga0209588_1000024 3300027671 Bacteria 86158
179 Ga0209588_1001205 3300027671 Bacteria 6687
180 Ga0207428_10015930 3300027907 Bacteria 6484
181 Ga0265356_1000241 3300028017 Bacteria 10303
182 Ga0268266_10001732 3300028379 Bacteria 24974
183 Ga0268266_10003091 3300028379 Bacteria 16994
184 Ga0268264_10005089 3300028381 Bacteria 11138
185 Ga0268264_10105017 3300028381 Bacteria 2463
186 Ga0265337_1002494 3300028556 Bacteria 8388
187 Ga0265319_1004091 3300028563 Bacteria 7340
188 Ga0265319_1007992 3300028563 Bacteria 4688
189 Ga0265318_10001345 3300028577 Bacteria 14668
190 Ga0265318_10003553 3300028577 Bacteria 7811
191 Ga0307515_10017749 3300028794 Bacteria 12940
192 Ga0307515_10125632 3300028794 Bacteria 2868
193 Ga0265338_10000089 3300028800 Bacteria 172762
194 Ga0265338_10002472 3300028800 Bacteria 27606
195 Ga0265338_10012117 3300028800 Bacteria 9851
196 Ga0265338_10043215 3300028800 Bacteria 4183
197 Ga0265324_10011721 3300029957 Bacteria 3333
198 Ga0265762_1002748 3300030760 Unclassified 3148
199 Ga0265760_10000458 3300031090 Bacteria 11526
200 Ga0265320_10001079 3300031240 Bacteria 20138
201 Ga0265320_10003565 3300031240 Bacteria 10406
202 Ga0265325_10000108 3300031241 Bacteria 57913
203 Ga0265325_10011713 3300031241 Bacteria 5033
204 Ga0265339_10009137 3300031249 Bacteria 6256
205 Ga0265327_10004067 3300031251 Bacteria 13247
206 Ga0265327_10006157 3300031251 Bacteria 9704
207 Ga0265327_10010024 3300031251 Bacteria 6734
208 Ga0307509_10004080 3300031507 Bacteria 21394
209 Ga0307509_10004172 3300031507 Bacteria 21115
210 Ga0307509_10047895 3300031507 Bacteria 4595
211 Ga0265313_10000172 3300031595 Bacteria 68540
212 Ga0265313_10000886 3300031595 Bacteria 30240
213 Ga0265313_10002843 3300031595 Bacteria 14554
214 Ga0307508_10000273 3300031616 Bacteria 63550
215 Ga0307508_10029958 3300031616 Bacteria 4918
216 Ga0265342_10002800 3300031712 Bacteria 14762
217 Ga0265342_10024344 3300031712 Unclassified 3823
218 Ga0307516_10000890 3300031730 Bacteria 41141
219 Ga0307411_10042599 3300032005 Bacteria 2898
220 Ga0373935_0029347 3300035692 Bacteria 3404
221 Ga0373933_0027305 3300035724 Unclassified 3286
222 Ga0373937_0011123 3300036401 Bacteria 7887
223 Ga0373925_0048622 3300037068 Bacteria 3161
224 Ga0395899_0004800 3300037312 Bacteria 10528
225 Ga0395899_0006463 3300037312 Bacteria 9080
226 Ga0395899_0039528 3300037312 Bacteria 3531
227 Ga0395900_0010011 3300037418 Bacteria 9701
228 Ga0395900_0015727 3300037418 Bacteria 7715
229 Ga0395900_0129004 3300037418 Bacteria 2592
230 Ga0395898_0002262 3300037466 Bacteria 23343
231 Ga0395898_0014749 3300037466 Bacteria 8023
232 Ga0395905_0035826 3300037471 Bacteria 4660
233 Ga0395905_0063541 3300037471 Bacteria 3454
234 Ga0395905_0106840 3300037471 Bacteria 2628
235 Ga0436364_0192764 3300037853 Bacteria 18601
236 Ga0436364_0273345 3300037853 Bacteria 2794207
237 Ga0436364_0589085 3300037853 Bacteria 4056
238 Ga0436364_0956063 3300037853 Unclassified 6036
239 Ga0395901_0000045 3300038443 Bacteria 188874
240 Ga0395901_0030000 3300038443 Bacteria 5602
241 Ga0242420_000914 3300038996 Bacteria 3685
242 Ga0436365_0029180 3300039437 Bacteria 3745
243 Ga0436365_0254746 3300039437 Bacteria 3530
244 Ga0436365_0425150 3300039437 Unclassified 3342
245 Ga0436365_1862388 3300039437 Bacteria 7275
246 Ga0436360_0815859 3300039438 Bacteria 3442
247 Ga0436360_1186566 3300039438 Bacteria 16035
248 Ga0436360_1237438 3300039438 Bacteria 2930
249 Ga0436361_0149327 3300039447 Bacteria 9327
250 Ga0436361_0198070 3300039447 Bacteria 76284
251 Ga0436361_0382410 3300039447 Bacteria 14510
252 Ga0436363_0068988 3300039450 Bacteria 16403
253 Ga0436363_0771344 3300039450 Bacteria 13832
254 Ga0436363_0888913 3300039450 Bacteria 5126
255 Ga0436362_0361509 3300039453 Bacteria 5469
256 Ga0436362_0907400 3300039453 Bacteria 3208
257 Ga0436362_0942446 3300039453 Bacteria 3200
258 Ga0466969_0005395 3300044656 Bacteria 6804
259 Ga0466972_0000191 3300044658 Bacteria 47087
260 Ga0466965_0002973 3300044683 Bacteria 7345
261 Ga0466965_0003500 3300044683 Bacteria 6891
262 Ga0466965_0004965 3300044683 Bacteria 5955
263 Ga0466966_0000061 3300044684 Bacteria 79168
264 Ga0466966_0001207 3300044684 Bacteria 16577
265 Ga0466966_0017001 3300044684 Bacteria 4808
266 Ga0466966_0027310 3300044684 Bacteria 3722
267 Ga0466961_0001601 3300044693 Bacteria 14025
268 Ga0466964_0001075 3300044706 Bacteria 9139
269 Ga0466964_0005169 3300044706 Bacteria 4837
270 Ga0453684_0144201 3300044712 Bacteria 2839
271 Ga0466968_0003273 3300044735 Bacteria 5967
272 Ga0466970_0040308 3300044765 Bacteria 2480
273 Ga0466957_0005374 3300044842 Bacteria 7190
274 Ga0466957_0056846 3300044842 Bacteria 2393
275 Ga0466960_0009199 3300044901 Bacteria 4066
276 Ga0466959_0002935 3300045049 Bacteria 11001
277 Ga0466958_0047390 3300045836 Bacteria 2594
278 Ga0495617_002086 3300046452 Bacteria 8273
279 Ga0495592_0003489 3300046454 Bacteria 11283
280 Ga0495638_0020846 3300046460 Unclassified 4328
281 Ga0495651_0003315 3300046462 Bacteria 12362
282 Ga0495653_0000038 3300046463 Bacteria 120385
283 Ga0495650_0000161 3300046471 Bacteria 149996
284 Ga0495605_0003570 3300046474 Bacteria 9216
285 Ga0495664_0013212 3300046477 Bacteria 4683
286 Ga0495583_0000067 3300046506 Bacteria 189381
287 Ga0495606_0000537 3300046507 Bacteria 61013
288 Ga0495628_0034360 3300046516 Unclassified 4078
289 Ga0495644_0000211 3300046523 Bacteria 27476
290 Ga0495644_0000755 3300046523 Bacteria 13374
291 Ga0495648_0000831 3300046524 Bacteria 32651
292 Ga0495642_0013746 3300046528 Bacteria 3135
293 Ga0495609_0001188 3300046538 Bacteria 17954
294 Ga0495609_0018872 3300046538 Bacteria 3193
295 Ga0495597_0004019 3300046542 Bacteria 8249
296 Ga0495645_0009189 3300046543 Bacteria 6907
297 Ga0495667_0030976 3300046559 Unclassified 3592
298 Ga0495668_0004886 3300046616 Bacteria 9309
299 Ga0495668_0025084 3300046616 Bacteria 3389
300 Ga0495611_0001139 3300046648 Bacteria 13900
301 Ga0495611_0001593 3300046648 Bacteria 11088
302 Ga0495625_0016132 3300046660 Bacteria 5885
303 Ga0495659_0000193 3300046664 Bacteria 26723
304 Ga0495661_0049951 3300046665 Unclassified 2534
305 Ga0495599_0004083 3300046678 Bacteria 8608
306 Ga0495623_0005952 3300046679 Bacteria 7948
307 Ga0495670_0002462 3300046691 Bacteria 9135
308 Ga0495589_0011473 3300046794 Bacteria 4601
309 Ga0495660_0000025 3300046810 Bacteria 260275
310 Ga0495636_0000302 3300047318 Bacteria 19376
311 Ga0495687_001851 3300047443 Bacteria 18491
312 Ga0495685_000011 3300047447 Bacteria 83484
313 Ga0495673_0000001 3300047469 Bacteria 1630730
314 Ga0495673_0015798 3300047469 Unclassified 3878
315 Ga0495684_0014164 3300047471 Bacteria 6135
316 Ga0495686_0001339 3300047472 Bacteria 27571
317 Ga0495602_0028659 3300048088 Bacteria 5323
318 Ga0496107_0039929 3300048910 Bacteria 3368
319 Ga0496110_0009614 3300048913 Bacteria 7829
320 Ga0496112_0027036 3300048915 Bacteria 5530
321 Ga0496114_0089098 3300048917 Bacteria 2618
322 Ga0495678_007646 3300049459 Bacteria 5575
323 Ga0495682_0000199 3300049460 Bacteria 48422
324 Ga0495682_0001987 3300049460 Bacteria 10110
325 Ga0501081_0012069 3300049743 Bacteria 5662
326 Ga0466962_0002841 3300061719 Bacteria 8245
327 Ga0466962_0019393 3300061719 Bacteria 3268
328 2524004445 2523533629 Bacteria 2982326
329 Ga0265356_1000039
330 JGI25153J46596_10004549
331 rootH2_10019536
332 rootH1_10115361
333 Ga0070676_10001285
334 Ga0070683_100014197
335 Ga0070683_100069992
336 Ga0070683_100090121
337 Ga0070683_100102320
338 Ga0068869_100023640
339 Ga0070666_10000189
340 Ga0070680_100011448
341 Ga0070680_100018410
342 Ga0070680_100086420
343 Ga0068868_100009194
344 Ga0070689_100044629
345 Ga0070668_100000780
346 Ga0070669_100007865
347 Ga0070675_100004000
348 Ga0070675_100009582
349 Ga0070671_100021620
350 Ga0070671_100050877
351 Ga0070674_100005233
352 Ga0070659_100024897
353 Ga0070667_100001716
354 Ga0070667_100014209
355 Ga0070709_10004585
356 Ga0070709_10005181
357 Ga0070714_100005296
358 Ga0070714_100032803
359 Ga0070713_100028462
360 Ga0070710_10011034
361 Ga0070711_100007753
362 Ga0070708_100001317
363 Ga0070663_100023316
364 Ga0070678_100000206
365 Ga0070681_10000029
366 Ga0070681_10005906
367 Ga0068867_100001041
368 Ga0070685_10024935
369 Ga0070679_100006577
370 Ga0070684_100037939
371 Ga0070672_100002098
372 Ga0070696_100010411
373 Ga0070693_100044890
374 Ga0070665_100003042
375 Ga0070665_100003151
376 Ga0068855_100001205
377 Ga0068855_100004597
378 Ga0068855_100055516
379 Ga0070664_100092678
380 Ga0068857_100034341
381 Ga0068854_100021596
382 Ga0068856_100027325
383 Ga0068856_100043436
384 Ga0068856_100052719
385 Ga0068859_100000248
386 Ga0068859_100002862
387 Ga0068864_100012974
388 Ga0068866_10032211
389 Ga0068861_100061331
390 Ga0068863_100002768
391 Ga0068863_100010444
392 Ga0068858_100009090
393 Ga0068860_100002614
394 Ga0068860_100011359
395 Ga0068862_100049205
396 Ga0070717_10002752
397 Ga0097621_100002115
398 Ga0068871_100002345
399 Ga0075428_100047385
400 Ga0068865_100001013
401 Ga0097620_100000248
402 Ga0097620_100002862
403 Ga0099794_10002070
404 Ga0099794_10002135
405 Ga0105240_10003830
406 Ga0105240_10037176
407 Ga0105240_10062690
408 Ga0105240_10070001
409 Ga0105240_10147723
410 Ga0111539_10000224
411 Ga0105245_10043036
412 Ga0105247_10000222
413 Ga0105241_10009465
414 Ga0105248_10009756
415 Ga0105238_10116376
416 Ga0105249_10021159
417 Ga0105239_10099834
418 Ga0157373_10028747
419 Ga0157371_10010474
420 Ga0157371_10020394
421 Ga0157371_10030161
422 Ga0157369_10005143
423 Ga0157369_10038295
424 Ga0157369_10112716
425 Ga0157374_10019568
426 Ga0157378_10026744
427 Ga0163162_10004549
428 Ga0163162_10023360
429 Ga0157372_10000001
430 Ga0157372_10064385
431 Ga0157375_10001781
432 Ga0157375_10004651
433 Ga0157380_10000232
434 Ga0157377_10013614
435 Ga0157379_10012747
436 Ga0182006_1000005
437 Ga0182007_10002552
438 Ga0163161_10058842
439 Ga0213872_10000026
440 Ga0213872_10000327
441 Ga0213875_10000001
442 Ga0209758_1000096
443 Ga0207697_10001949
444 Ga0207697_10005346
445 Ga0207682_10003086
446 Ga0207710_10000228
447 Ga0207680_10001972
448 Ga0207699_10028542
449 Ga0207645_10000905
450 Ga0207645_10012124
451 Ga0207707_10001433
452 Ga0207707_10038512
453 Ga0207707_10041345
454 Ga0207695_10054145
455 Ga0207695_10098045
456 Ga0207660_10042219
457 Ga0207660_10044094
458 Ga0207662_10016987
459 Ga0207657_10003266
460 Ga0207652_10007614
461 Ga0207681_10000944
462 Ga0207694_10016912
463 Ga0207694_10017591
464 Ga0207650_10002468
465 Ga0207650_10010569
466 Ga0207659_10001868
467 Ga0207659_10004777
468 Ga0207687_10068717
469 Ga0207700_10024860
470 Ga0207664_10018831
471 Ga0207664_10038404
472 Ga0207664_10094743
473 Ga0207644_10000950
474 Ga0207690_10031222
475 Ga0207669_10027214
476 Ga0207704_10001981
477 Ga0207691_10002655
478 Ga0207711_10008808
479 Ga0207711_10073839
480 Ga0207689_10005716
481 Ga0207689_10025564
482 Ga0207661_10007400
483 Ga0207661_10082785
484 Ga0207661_10098778
485 Ga0207667_10001237
486 Ga0207667_10029718
487 Ga0207667_10047990
488 Ga0207651_10060071
489 Ga0207668_10000919
490 Ga0207658_10001261
491 Ga0207658_10016773
492 Ga0207703_10007654
493 Ga0207678_10012225
494 Ga0207678_10016534
495 Ga0207708_10001426
496 Ga0207702_10031293
497 Ga0207702_10054090
498 Ga0207641_10002271
499 Ga0207648_10000126
500 Ga0207676_10010072
501 Ga0207674_10001525
502 Ga0207674_10004355
503 Ga0207675_100000347
504 Ga0207683_10002062
505 Ga0207698_10033219
506 Ga0209588_1000024
507 Ga0209588_1001205
508 Ga0207428_10015930
509 Ga0265356_1000241
510 Ga0268266_10001732
511 Ga0268266_10003091
512 Ga0268264_10005089
513 Ga0268264_10105017
514 Ga0265337_1002494
515 Ga0265319_1004091
516 Ga0265319_1007992
517 Ga0265318_10001345
518 Ga0265318_10003553
519 Ga0307515_10017749
520 Ga0307515_10125632
521 Ga0265338_10000089
522 Ga0265338_10002472
523 Ga0265338_10012117
524 Ga0265338_10043215
525 Ga0265324_10011721
526 Ga0265762_1002748
527 Ga0265760_10000458
528 Ga0265320_10001079
529 Ga0265320_10003565
530 Ga0265325_10000108
531 Ga0265325_10011713
532 Ga0265339_10009137
533 Ga0265327_10004067
534 Ga0265327_10006157
535 Ga0265327_10010024
536 Ga0307509_10004080
537 Ga0307509_10004172
538 Ga0307509_10047895
539 Ga0265313_10000172
540 Ga0265313_10000886
541 Ga0265313_10002843
542 Ga0307508_10000273
543 Ga0307508_10029958
544 Ga0265342_10002800
545 Ga0265342_10024344
546 Ga0307516_10000890
547 Ga0307411_10042599
548 Ga0373935_0029347
549 Ga0373933_0027305
550 Ga0373937_0011123
551 Ga0373925_0048622
552 Ga0395899_0004800
553 Ga0395899_0006463
554 Ga0395899_0039528
555 Ga0395900_0010011
556 Ga0395900_0015727
557 Ga0395900_0129004
558 Ga0395898_0002262
559 Ga0395898_0014749
560 Ga0395905_0035826
561 Ga0395905_0063541
562 Ga0395905_0106840
563 Ga0436364_0192764
564 Ga0436364_0273345
565 Ga0436364_0589085
566 Ga0436364_0956063
567 Ga0395901_0000045
568 Ga0395901_0030000
569 Ga0242420_000914
570 Ga0436365_0029180
571 Ga0436365_0254746
572 Ga0436365_0425150
573 Ga0436365_1862388
574 Ga0436360_0815859
575 Ga0436360_1186566
576 Ga0436360_1237438
577 Ga0436361_0149327
578 Ga0436361_0198070
579 Ga0436361_0382410
580 Ga0436363_0068988
581 Ga0436363_0771344
582 Ga0436363_0888913
583 Ga0436362_0361509
584 Ga0436362_0907400
585 Ga0436362_0942446
586 Ga0466969_0005395
587 Ga0466972_0000191
588 Ga0466965_0002973
589 Ga0466965_0003500
590 Ga0466965_0004965
591 Ga0466966_0000061
592 Ga0466966_0001207
593 Ga0466966_0017001
594 Ga0466966_0027310
595 Ga0466961_0001601
596 Ga0466964_0001075
597 Ga0466964_0005169
598 Ga0453684_0144201
599 Ga0466968_0003273
600 Ga0466970_0040308
601 Ga0466957_0005374
602 Ga0466957_0056846
603 Ga0466960_0009199
604 Ga0466959_0002935
605 Ga0466958_0047390
606 Ga0495617_002086
607 Ga0495592_0003489
608 Ga0495638_0020846
609 Ga0495651_0003315
610 Ga0495653_0000038
611 Ga0495650_0000161
612 Ga0495605_0003570
613 Ga0495664_0013212
614 Ga0495583_0000067
615 Ga0495606_0000537
616 Ga0495628_0034360
617 Ga0495644_0000211
618 Ga0495644_0000755
619 Ga0495648_0000831
620 Ga0495642_0013746
621 Ga0495609_0001188
622 Ga0495609_0018872
623 Ga0495597_0004019
624 Ga0495645_0009189
625 Ga0495667_0030976
626 Ga0495668_0004886
627 Ga0495668_0025084
628 Ga0495611_0001139
629 Ga0495611_0001593
630 Ga0495625_0016132
631 Ga0495659_0000193
632 Ga0495661_0049951
633 Ga0495599_0004083
634 Ga0495623_0005952
635 Ga0495670_0002462
636 Ga0495589_0011473
637 Ga0495660_0000025
638 Ga0495636_0000302
639 Ga0495687_001851
640 Ga0495685_000011
641 Ga0495673_0000001
642 Ga0495673_0015798
643 Ga0495684_0014164
644 Ga0495686_0001339
645 Ga0495602_0028659
646 Ga0496107_0039929
647 Ga0496110_0009614
648 Ga0496112_0027036
649 Ga0496114_0089098
650 Ga0495678_007646
651 Ga0495682_0000199
652 Ga0495682_0001987
653 Ga0501081_0012069
654 Ga0466962_0002841
655 Ga0466962_0019393
656 2524004445

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00326

Peptidase_S9

Prolyl oligopeptidase family

589

806

0.93

PF02897

Peptidase_S9_N

Prolyl oligopeptidase, N-terminal beta-propeller domain

112

528

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jym-assembly1.cif.gz_A crystal structure of prolyl endopeptidase from haliotis discus hannai 0.9272 31 694
4amz-assembly1.cif.gz_A prolyl oligopeptidase from porcine brain with a covalently bound inhibitor ic-2 0.9249 29 696
2bkl-assembly1.cif.gz_A structural and mechanistic analysis of two prolyl endopeptidases: role of inter-domain dynamics in catalysis and specificity 0.9207 33 694
5o3x-assembly1.cif.gz_A structural characterization of the fast and promiscuous macrocyclase from plant - apo pcy1 0.9205 33 695
7y1x-assembly1.cif.gz_A crystal structure of prolyl oligopeptidase from microbulbifer arenaceous complex with peg400 and mes 0.9201 33 694
ID Description Score Start End Superfamily
3munA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9835 432 694 3.40.50.1820
af_A0A1D6E3C1_444_645_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9786 432 612 3.40.50.1820
5uw6B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9637 426 694 3.40.50.1820
af_A0A0R0KWG6_523_785_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9632 433 688 3.40.50.1820
5n4cC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9629 432 696 3.40.50.1820
ID Description Score Start End GO Terms
AF-T1D8B7-F1-model_v4 prolyl oligopeptidase (EC 3.4.21.26) 0.9877 469 694 GO:0004252
GO:0005829
GO:0006508
GO:0070012
AF-A0A800L6G7-F1-model_v4 prolyl oligopeptidase (EC 3.4.21.26) 0.9863 539 696 GO:0004252
GO:0005829
GO:0006508
GO:0070012
AF-A0A3B8QIA1-F1-model_v4 deleted 0.9841 432 664
AF-A0A1I8AI13-F1-model_v4 Prolyl endopeptidase (EC 3.4.21.-) 0.9827 501 618 GO:0004252
GO:0005829
GO:0006508
GO:0070012
AF-A0A5C7QFC8-F1-model_v4 deleted 0.9763 439 696

Map