F409951

General Info

Members Datasets Scaffolds Average Seq Length
330 192 658 316

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100027022|Ga0070690_1000270222
Length 354
Sequence LNGLQTRKSAAILIVATLGFKEIIKEYVLIKKPADIKSSEITDRKVYLNRRTFMRGAVLTGSALATGFVYRKLNPPGAVIESRPKIAQVMSPPTDEAIRRGFRANEPLTSLADITNYNNFYEFDTEKRAVAAAARNFVTRPWAVSVEGLVNKKRIFDLDELLKLPQEERIYRLRCVEGWSMVIPWVGFPLSALLKQVEPLSTAKYVAFETLLDPDRMPNQKTSVLQWPYVEGLRLDEAMHPLTILATGMYGETLPSQDGAPVRLVVPWKYGFKSIKSIVKISLVAEEPVTTWNREWPEAYGFYSNVNPNVAHPRYSQRYEHRIGEIGSRETLLFNGYAEQVGQLYQGMDLRANY

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
152 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
153 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
154 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
156 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
157 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
158 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
164 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
165 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
166 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
169 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
178 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
179 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
180 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
181 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
182 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
185 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.79
Metatranscriptomes 1.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.61
Rhizosphere 98.79
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100027022 3300005330 Bacteria 3545
2 JGI25406J46586_10057593 3300003203 Bacteria 1270
3 Ga0058863_11897439 3300004799 Bacteria 1332
4 Ga0058862_12250373 3300004803 Bacteria 1253
5 Ga0058862_12681274 3300004803 Bacteria 2551
6 Ga0065704_10150301 3300005289 Bacteria 1435
7 Ga0065715_10103921 3300005293 Bacteria 2998
8 Ga0065715_10111083 3300005293 Bacteria 2590
9 Ga0065707_10003470 3300005295 Bacteria 6163
10 Ga0070658_10045657 3300005327 Bacteria 3543
11 Ga0070690_100291327 3300005330 Bacteria 1167
12 Ga0070677_10018975 3300005333 Bacteria 2485
13 Ga0068869_100190055 3300005334 Bacteria 1614
14 Ga0070682_100059747 3300005337 Bacteria 2409
15 Ga0068868_100009324 3300005338 Bacteria 7055
16 Ga0070660_100013888 3300005339 Bacteria 5793
17 Ga0070689_100158257 3300005340 Bacteria 1829
18 Ga0070689_100225923 3300005340 Bacteria 1537
19 Ga0070687_100005709 3300005343 Bacteria 5049
20 Ga0070661_100034871 3300005344 Bacteria 3651
21 Ga0070692_10105079 3300005345 Bacteria 1554
22 Ga0070669_100003701 3300005353 Bacteria 11034
23 Ga0070669_100029182 3300005353 Bacteria 3975
24 Ga0070675_100000324 3300005354 Bacteria 32228
25 Ga0070675_100011708 3300005354 Bacteria 6875
26 Ga0070675_100057368 3300005354 Bacteria 3210
27 Ga0070675_100212892 3300005354 Bacteria 1681
28 Ga0070675_100246931 3300005354 Bacteria 1561
29 Ga0070675_100353489 3300005354 Bacteria 1303
30 Ga0070674_100028709 3300005356 Bacteria 3655
31 Ga0070674_100048803 3300005356 Bacteria 2907
32 Ga0070674_100106018 3300005356 Bacteria 2056
33 Ga0070673_100011727 3300005364 Bacteria 5993
34 Ga0070673_100039939 3300005364 Bacteria 3596
35 Ga0070673_100044735 3300005364 Bacteria 3429
36 Ga0070673_100111855 3300005364 Bacteria 2266
37 Ga0070688_100041001 3300005365 Bacteria 2840
38 Ga0070659_100060212 3300005366 Bacteria 2999
39 Ga0070667_100015070 3300005367 Bacteria 6387
40 Ga0070709_10001140 3300005434 Bacteria 14641
41 Ga0070714_100055555 3300005435 Bacteria 3384
42 Ga0070713_100455462 3300005436 Bacteria 1202
43 Ga0070701_10023426 3300005438 Bacteria 2973
44 Ga0070701_10104919 3300005438 Bacteria 1571
45 Ga0070705_100054329 3300005440 Bacteria 2349
46 Ga0070700_100004383 3300005441 Bacteria 7370
47 Ga0070700_100177324 3300005441 Bacteria 1480
48 Ga0070694_100044884 3300005444 Bacteria 2959
49 Ga0070708_100137598 3300005445 Bacteria 2263
50 Ga0070708_100332321 3300005445 Bacteria 1432
51 Ga0070663_100059844 3300005455 Bacteria 2738
52 Ga0070678_100115029 3300005456 Bacteria 2111
53 Ga0070662_100091116 3300005457 Bacteria 2289
54 Ga0070681_10179045 3300005458 Bacteria 2042
55 Ga0070681_10228908 3300005458 Bacteria 1773
56 Ga0068867_100031485 3300005459 Bacteria 3830
57 Ga0068867_100143706 3300005459 Bacteria 1867
58 Ga0070706_100075422 3300005467 Bacteria 3121
59 Ga0070707_100000053 3300005468 Bacteria 100755
60 Ga0070698_100000127 3300005471 Bacteria 66092
61 Ga0070698_100075664 3300005471 Bacteria 3370
62 Ga0070698_100075989 3300005471 Bacteria 3362
63 Ga0070699_100103735 3300005518 Bacteria 2494
64 Ga0070679_100050009 3300005530 Bacteria 4164
65 Ga0070679_100080454 3300005530 Bacteria 3248
66 Ga0070679_100119945 3300005530 Bacteria 2615
67 Ga0070672_100146777 3300005543 Bacteria 1949
68 Ga0070686_100300405 3300005544 Bacteria 1190
69 Ga0070695_100161625 3300005545 Bacteria 1572
70 Ga0070695_100309921 3300005545 Bacteria 1170
71 Ga0070696_100041187 3300005546 Bacteria 3191
72 Ga0070693_100006518 3300005547 Bacteria 5660
73 Ga0070665_100563695 3300005548 Bacteria 1151
74 Ga0070704_100010509 3300005549 Bacteria 5634
75 Ga0070704_100079292 3300005549 Bacteria 2412
76 Ga0068855_100014774 3300005563 Bacteria 9404
77 Ga0070664_100004359 3300005564 Bacteria 11371
78 Ga0070664_100220539 3300005564 Bacteria 1697
79 Ga0068857_100036979 3300005577 Bacteria 4324
80 Ga0068854_100045861 3300005578 Bacteria 3110
81 Ga0068856_100187694 3300005614 Bacteria 2081
82 Ga0070702_100003191 3300005615 Bacteria 7278
83 Ga0068859_100000507 3300005617 Bacteria 38390
84 Ga0068859_100152401 3300005617 Bacteria 2387
85 Ga0068861_100001737 3300005719 Bacteria 13978
86 Ga0068861_100308997 3300005719 Bacteria 1372
87 Ga0068870_10000317 3300005840 Bacteria 17849
88 Ga0068863_100024773 3300005841 Bacteria 5723
89 Ga0068858_100005354 3300005842 Bacteria 12589
90 Ga0068858_100012764 3300005842 Bacteria 7918
91 Ga0068858_100111584 3300005842 Bacteria 2554
92 Ga0068858_100302750 3300005842 Bacteria 1525
93 Ga0068860_100034933 3300005843 Bacteria 4823
94 Ga0068862_100082013 3300005844 Bacteria 2798
95 Ga0068862_100249418 3300005844 Bacteria 1617
96 Ga0068862_100291227 3300005844 Bacteria 1499
97 Ga0081539_10002622 3300005985 Bacteria 24590
98 Ga0081539_10100169 3300005985 Bacteria 1478
99 Ga0070712_100038248 3300006175 Bacteria 3278
100 Ga0097621_100107751 3300006237 Bacteria 2352
101 Ga0097621_100141968 3300006237 Bacteria 2053
102 Ga0097621_100179718 3300006237 Bacteria 1828
103 Ga0097621_100383943 3300006237 Bacteria 1255
104 Ga0068871_100054448 3300006358 Bacteria 3246
105 Ga0068871_100064460 3300006358 Bacteria 3000
106 Ga0075428_100006967 3300006844 Bacteria 12541
107 Ga0075428_100036361 3300006844 Bacteria 5424
108 Ga0075428_100102297 3300006844 Bacteria 3124
109 Ga0075428_100118098 3300006844 Bacteria 2889
110 Ga0075428_100181570 3300006844 Bacteria 2277
111 Ga0075430_100009694 3300006846 Bacteria 8136
112 Ga0075430_100163735 3300006846 Bacteria 1851
113 Ga0075431_100004042 3300006847 Bacteria 14290
114 Ga0075431_100011844 3300006847 Bacteria 8800
115 Ga0075431_100069392 3300006847 Bacteria 3636
116 Ga0075431_100231059 3300006847 Bacteria 1885
117 Ga0075433_10003849 3300006852 Bacteria 11620
118 Ga0075433_10003945 3300006852 Bacteria 11489
119 Ga0075433_10077820 3300006852 Bacteria 2922
120 Ga0075434_100014082 3300006871 Bacteria 7638
121 Ga0075434_100090676 3300006871 Bacteria 3058
122 Ga0075429_100028626 3300006880 Bacteria 4837
123 Ga0075429_100031440 3300006880 Bacteria 4613
124 Ga0075436_100000002 3300006914 Bacteria 475522
125 Ga0075436_100069642 3300006914 Bacteria 2431
126 Ga0097620_100000507 3300006931 Bacteria 38390
127 Ga0075435_100143168 3300007076 Bacteria 2007
128 Ga0075435_100421268 3300007076 Bacteria 1150
129 Ga0105240_10003515 3300009093 Bacteria 24309
130 Ga0105240_10011240 3300009093 Bacteria 12482
131 Ga0105240_10083080 3300009093 Bacteria 3932
132 Ga0111539_10011795 3300009094 Bacteria 10955
133 Ga0111539_10039254 3300009094 Bacteria 5708
134 Ga0111539_10096908 3300009094 Bacteria 3465
135 Ga0114129_10001970 3300009147 Bacteria 28080
136 Ga0114129_10011855 3300009147 Bacteria 12398
137 Ga0114129_10036802 3300009147 Bacteria 6911
138 Ga0114129_10387178 3300009147 Bacteria 1845
139 Ga0114129_10454651 3300009147 Bacteria 1679
140 Ga0105248_10047144 3300009177 Bacteria 4832
141 Ga0105248_10064266 3300009177 Bacteria 4120
142 Ga0105248_10157438 3300009177 Bacteria 2563
143 Ga0105248_10281193 3300009177 Bacteria 1873
144 Ga0105248_10397365 3300009177 Bacteria 1552
145 Ga0105248_10486770 3300009177 Bacteria 1390
146 Ga0105238_10325280 3300009551 Bacteria 1524
147 Ga0105249_10002561 3300009553 Bacteria 15735
148 Ga0157371_10078922 3300013102 Bacteria 2332
149 Ga0157374_10077092 3300013296 Bacteria 3153
150 Ga0157378_10094577 3300013297 Bacteria 2721
151 Ga0157378_10244790 3300013297 Bacteria 1714
152 Ga0163162_10009672 3300013306 Bacteria 9378
153 Ga0157375_10011631 3300013308 Bacteria 7776
154 Ga0163163_10005319 3300014325 Bacteria 11118
155 Ga0163163_10140676 3300014325 Bacteria 2455
156 Ga0157380_10079644 3300014326 Bacteria 2676
157 Ga0157380_10574448 3300014326 Bacteria 1110
158 Ga0157377_10177669 3300014745 Bacteria 1336
159 Ga0157379_10015574 3300014968 Bacteria 6676
160 Ga0157379_10357047 3300014968 Bacteria 1339
161 Ga0157376_10043292 3300014969 Bacteria 3694
162 Ga0157376_10080951 3300014969 Bacteria 2787
163 Ga0163161_10012877 3300017792 Bacteria 5812
164 Ga0213872_10001441 3300021361 Bacteria 15498
165 Ga0213876_10000684 3300021384 Bacteria 23970
166 Ga0224712_10084068 3300022467 Bacteria 1320
167 Ga0207697_10000530 3300025315 Bacteria 21540
168 Ga0207682_10000349 3300025893 Bacteria 21134
169 Ga0207688_10000951 3300025901 Bacteria 14699
170 Ga0207680_10190715 3300025903 Bacteria 1391
171 Ga0207699_10000031 3300025906 Bacteria 137708
172 Ga0207645_10000346 3300025907 Bacteria 38743
173 Ga0207645_10000777 3300025907 Bacteria 26632
174 Ga0207645_10157037 3300025907 Bacteria 1487
175 Ga0207643_10001670 3300025908 Bacteria 12449
176 Ga0207684_10061770 3300025910 Bacteria 3181
177 Ga0207684_10089938 3300025910 Bacteria 2616
178 Ga0207684_10120078 3300025910 Bacteria 2253
179 Ga0207707_10081737 3300025912 Bacteria 2820
180 Ga0207695_10121411 3300025913 Bacteria 2580
181 Ga0207695_10129413 3300025913 Bacteria 2483
182 Ga0207693_10059501 3300025915 Bacteria 2993
183 Ga0207662_10001557 3300025918 Bacteria 11201
184 Ga0207657_10002506 3300025919 Bacteria 19866
185 Ga0207649_10022914 3300025920 Bacteria 3610
186 Ga0207652_10038738 3300025921 Bacteria 4042
187 Ga0207646_10000575 3300025922 Bacteria 48116
188 Ga0207681_10033899 3300025923 Bacteria 3353
189 Ga0207650_10066662 3300025925 Bacteria 2700
190 Ga0207650_10287127 3300025925 Bacteria 1341
191 Ga0207659_10000511 3300025926 Bacteria 23289
192 Ga0207659_10004165 3300025926 Bacteria 8733
193 Ga0207659_10012554 3300025926 Bacteria 5394
194 Ga0207659_10155992 3300025926 Bacteria 1787
195 Ga0207659_10156412 3300025926 Bacteria 1785
196 Ga0207659_10237676 3300025926 Bacteria 1472
197 Ga0207664_10190173 3300025929 Bacteria 1767
198 Ga0207644_10429922 3300025931 Bacteria 1083
199 Ga0207690_10303713 3300025932 Bacteria 1249
200 Ga0207706_10411582 3300025933 Bacteria 1172
201 Ga0207670_10109392 3300025936 Bacteria 1989
202 Ga0207670_10422980 3300025936 Bacteria 1069
203 Ga0207669_10005240 3300025937 Bacteria 5798
204 Ga0207669_10040306 3300025937 Bacteria 2708
205 Ga0207665_10087409 3300025939 Bacteria 2155
206 Ga0207691_10034688 3300025940 Bacteria 4690
207 Ga0207691_10046812 3300025940 Bacteria 3972
208 Ga0207691_10366012 3300025940 Bacteria 1232
209 Ga0207711_10114401 3300025941 Bacteria 2403
210 Ga0207711_10199122 3300025941 Bacteria 1827
211 Ga0207711_10443473 3300025941 Bacteria 1208
212 Ga0207689_10003093 3300025942 Bacteria 15311
213 Ga0207689_10211835 3300025942 Bacteria 1601
214 Ga0207689_10257928 3300025942 Bacteria 1442
215 Ga0207679_10015142 3300025945 Bacteria 5087
216 Ga0207667_10088722 3300025949 Bacteria 3197
217 Ga0207667_10145485 3300025949 Bacteria 2440
218 Ga0207651_10030454 3300025960 Bacteria 3436
219 Ga0207651_10081164 3300025960 Bacteria 2337
220 Ga0207651_10094569 3300025960 Bacteria 2198
221 Ga0207712_10015239 3300025961 Bacteria 4956
222 Ga0207712_10123667 3300025961 Bacteria 1961
223 Ga0207668_10057848 3300025972 Bacteria 2707
224 Ga0207640_10062630 3300025981 Bacteria 2468
225 Ga0207658_10034124 3300025986 Bacteria 3634
226 Ga0207703_10012951 3300026035 Bacteria 6500
227 Ga0207703_10013249 3300026035 Bacteria 6422
228 Ga0207703_10105243 3300026035 Bacteria 2398
229 Ga0207703_10269938 3300026035 Bacteria 1541
230 Ga0207703_10459800 3300026035 Bacteria 1190
231 Ga0207708_10002322 3300026075 Bacteria 13972
232 Ga0207708_10013518 3300026075 Bacteria 6103
233 Ga0207708_10016144 3300026075 Bacteria 5610
234 Ga0207702_10378860 3300026078 Bacteria 1360
235 Ga0207641_10005002 3300026088 Bacteria 11363
236 Ga0207648_10001795 3300026089 Bacteria 23516
237 Ga0207648_10009903 3300026089 Bacteria 9086
238 Ga0207648_10015634 3300026089 Bacteria 6970
239 Ga0207648_10087778 3300026089 Bacteria 2715
240 Ga0207676_10038579 3300026095 Bacteria 3648
241 Ga0207674_10077124 3300026116 Bacteria 3339
242 Ga0207675_100011719 3300026118 Bacteria 8200
243 Ga0207675_100035948 3300026118 Bacteria 4621
244 Ga0207675_100454713 3300026118 Bacteria 1269
245 Ga0207683_10023508 3300026121 Bacteria 5302
246 Ga0207683_10185880 3300026121 Bacteria 1885
247 Ga0207683_10248193 3300026121 Bacteria 1624
248 Ga0209996_1008281 3300027395 Bacteria 1361
249 Ga0209974_10015465 3300027876 Bacteria 2534
250 Ga0209974_10045462 3300027876 Bacteria 1466
251 Ga0207428_10019722 3300027907 Bacteria 5745
252 Ga0207428_10020982 3300027907 Bacteria 5537
253 Ga0207428_10137278 3300027907 Bacteria 1869
254 Ga0268266_10401830 3300028379 Bacteria 1295
255 Ga0268265_10084954 3300028380 Bacteria 2510
256 Ga0268265_10130031 3300028380 Bacteria 2090
257 Ga0268265_10276772 3300028380 Bacteria 1500
258 Ga0268265_10585009 3300028380 Bacteria 1064
259 Ga0268264_10006593 3300028381 Bacteria 9765
260 Ga0268264_10071690 3300028381 Bacteria 2936
261 Ga0307405_10270863 3300031731 Bacteria 1273
262 Ga0307410_10413832 3300031852 Bacteria 1092
263 Ga0307416_100207610 3300032002 Bacteria 1865
264 Ga0307415_100012424 3300032126 Bacteria 4924
265 Ga0307415_100085273 3300032126 Bacteria 2269
266 Ga0373926_0029394 3300035083 Bacteria 1932
267 Ga0373949_0015523 3300035090 Bacteria 1702
268 Ga0373932_0006377 3300035112 Bacteria 2789
269 Ga0373936_0086298 3300035113 Bacteria 1311
270 Ga0373945_0045108 3300035116 Bacteria 1605
271 Ga0373943_0001436 3300035170 Bacteria 10763
272 Ga0373955_0009386 3300035172 Bacteria 4578
273 Ga0373955_0072361 3300035172 Bacteria 1931
274 Ga0373924_0005205 3300035410 Bacteria 4591
275 Ga0373935_0006417 3300035692 Bacteria 7020
276 Ga0373947_0140612 3300035725 Bacteria 1548
277 Ga0373925_0004647 3300037068 Bacteria 10372
278 Ga0395905_0003600 3300037471 Bacteria 16476
279 Ga0242420_002083 3300038996 Bacteria 2808
280 Ga0436365_0297369 3300039437 Bacteria 35031
281 Ga0436361_0254530 3300039447 Bacteria 1302
282 Ga0436361_0554014 3300039447 Bacteria 63849
283 Ga0439435_0003325 3300042436 Bacteria 3331
284 Ga0451576_0224121 3300045051 Bacteria 1963
285 Ga0451576_0343571 3300045051 Bacteria 1563
286 Ga0451576_0537524 3300045051 Bacteria 1228
287 Ga0495621_0017901 3300046539 Bacteria 2296
288 Ga0495669_0004790 3300046684 Bacteria 5613
289 Ga0496104_0452469 3300048907 Bacteria 1196
290 Ga0496112_0160469 3300048915 Bacteria 2215
291 Ga0501033_0097500 3300049570 Bacteria 2148
292 Ga0501036_0180029 3300049572 Bacteria 1779
293 Ga0501039_0407936 3300049575 Bacteria 1067
294 Ga0501040_0038141 3300049576 Bacteria 3266
295 Ga0501047_0193830 3300049581 Bacteria 1895
296 Ga0501072_0213698 3300049588 Bacteria 1537
297 Ga0501075_0060811 3300049591 Bacteria 2846
298 Ga0501076_0166437 3300049592 Bacteria 1797
299 Ga0501076_0386489 3300049592 Bacteria 1150
300 Ga0501079_0085788 3300049741 Bacteria 2437
301 Ga0501081_0023613 3300049743 Bacteria 4123
302 Ga0501045_0024956 3300049824 Bacteria 4295
303 nmdc:mga05p37_34338_c1 3300050507 Bacteria 6212
304 nmdc:mga05p37_45412_c1 3300050507 Bacteria 5403
305 nmdc:mga05p37_6587_c1 3300050507 Bacteria 13693
306 nmdc:mga09592_201331_c1 3300050508 Bacteria 1724
307 nmdc:mga09592_93673_c1 3300050508 Bacteria 2569
308 nmdc:mga0qj67_168216_c1 3300050509 Bacteria 1780
309 nmdc:mga0qj67_173976_c1 3300050509 Bacteria 1748
310 nmdc:mga0qj67_4339_c1 3300050509 Bacteria 10271
311 nmdc:mga06r32_1084_c1 3300050510 Bacteria 24408
312 nmdc:mga06r32_126748_c1 3300050510 Bacteria 2522
313 nmdc:mga06r32_304982_c1 3300050510 Bacteria 1578
314 nmdc:mga06r32_319421_c1 3300050510 Bacteria 1538
315 nmdc:mga06r32_35176_c1 3300050510 Bacteria 4726
316 nmdc:mga06r32_47182_c1 3300050510 Bacteria 4113
317 nmdc:mga08y16_127869_c1 3300050511 Bacteria 2643
318 nmdc:mga08y16_36024_c1 3300050511 Bacteria 5196
319 nmdc:mga0n895_12127_c1 3300050512 Bacteria 7714
320 nmdc:mga0n895_14030_c1 3300050512 Bacteria 7260
321 nmdc:mga0rr50_161784_c1 3300050513 Bacteria 1817
322 nmdc:mga0rr50_34109_c1 3300050513 Bacteria 3642
323 nmdc:mga0rr50_439191_c1 3300050513 Bacteria 1105
324 nmdc:mga08x19_23509_c1 3300050514 Bacteria 3823
325 nmdc:mga08x19_9_c1 3300050514 Bacteria 418852
326 nmdc:mga0a205_14933_c1 3300050515 Bacteria 7247
327 nmdc:mga0a205_45367_c1 3300050515 Bacteria 4238
328 nmdc:mga0a205_89529_c1 3300050515 Bacteria 2974
329 Ga0501082_0093438 3300060353 Bacteria 2599
330 Ga0070690_100027022
331 JGI25406J46586_10057593
332 Ga0058863_11897439
333 Ga0058862_12250373
334 Ga0058862_12681274
335 Ga0065704_10150301
336 Ga0065715_10103921
337 Ga0065715_10111083
338 Ga0065707_10003470
339 Ga0070658_10045657
340 Ga0070690_100291327
341 Ga0070677_10018975
342 Ga0068869_100190055
343 Ga0070682_100059747
344 Ga0068868_100009324
345 Ga0070660_100013888
346 Ga0070689_100158257
347 Ga0070689_100225923
348 Ga0070687_100005709
349 Ga0070661_100034871
350 Ga0070692_10105079
351 Ga0070669_100003701
352 Ga0070669_100029182
353 Ga0070675_100000324
354 Ga0070675_100011708
355 Ga0070675_100057368
356 Ga0070675_100212892
357 Ga0070675_100246931
358 Ga0070675_100353489
359 Ga0070674_100028709
360 Ga0070674_100048803
361 Ga0070674_100106018
362 Ga0070673_100011727
363 Ga0070673_100039939
364 Ga0070673_100044735
365 Ga0070673_100111855
366 Ga0070688_100041001
367 Ga0070659_100060212
368 Ga0070667_100015070
369 Ga0070709_10001140
370 Ga0070714_100055555
371 Ga0070713_100455462
372 Ga0070701_10023426
373 Ga0070701_10104919
374 Ga0070705_100054329
375 Ga0070700_100004383
376 Ga0070700_100177324
377 Ga0070694_100044884
378 Ga0070708_100137598
379 Ga0070708_100332321
380 Ga0070663_100059844
381 Ga0070678_100115029
382 Ga0070662_100091116
383 Ga0070681_10179045
384 Ga0070681_10228908
385 Ga0068867_100031485
386 Ga0068867_100143706
387 Ga0070706_100075422
388 Ga0070707_100000053
389 Ga0070698_100000127
390 Ga0070698_100075664
391 Ga0070698_100075989
392 Ga0070699_100103735
393 Ga0070679_100050009
394 Ga0070679_100080454
395 Ga0070679_100119945
396 Ga0070672_100146777
397 Ga0070686_100300405
398 Ga0070695_100161625
399 Ga0070695_100309921
400 Ga0070696_100041187
401 Ga0070693_100006518
402 Ga0070665_100563695
403 Ga0070704_100010509
404 Ga0070704_100079292
405 Ga0068855_100014774
406 Ga0070664_100004359
407 Ga0070664_100220539
408 Ga0068857_100036979
409 Ga0068854_100045861
410 Ga0068856_100187694
411 Ga0070702_100003191
412 Ga0068859_100000507
413 Ga0068859_100152401
414 Ga0068861_100001737
415 Ga0068861_100308997
416 Ga0068870_10000317
417 Ga0068863_100024773
418 Ga0068858_100005354
419 Ga0068858_100012764
420 Ga0068858_100111584
421 Ga0068858_100302750
422 Ga0068860_100034933
423 Ga0068862_100082013
424 Ga0068862_100249418
425 Ga0068862_100291227
426 Ga0081539_10002622
427 Ga0081539_10100169
428 Ga0070712_100038248
429 Ga0097621_100107751
430 Ga0097621_100141968
431 Ga0097621_100179718
432 Ga0097621_100383943
433 Ga0068871_100054448
434 Ga0068871_100064460
435 Ga0075428_100006967
436 Ga0075428_100036361
437 Ga0075428_100102297
438 Ga0075428_100118098
439 Ga0075428_100181570
440 Ga0075430_100009694
441 Ga0075430_100163735
442 Ga0075431_100004042
443 Ga0075431_100011844
444 Ga0075431_100069392
445 Ga0075431_100231059
446 Ga0075433_10003849
447 Ga0075433_10003945
448 Ga0075433_10077820
449 Ga0075434_100014082
450 Ga0075434_100090676
451 Ga0075429_100028626
452 Ga0075429_100031440
453 Ga0075436_100000002
454 Ga0075436_100069642
455 Ga0097620_100000507
456 Ga0075435_100143168
457 Ga0075435_100421268
458 Ga0105240_10003515
459 Ga0105240_10011240
460 Ga0105240_10083080
461 Ga0111539_10011795
462 Ga0111539_10039254
463 Ga0111539_10096908
464 Ga0114129_10001970
465 Ga0114129_10011855
466 Ga0114129_10036802
467 Ga0114129_10387178
468 Ga0114129_10454651
469 Ga0105248_10047144
470 Ga0105248_10064266
471 Ga0105248_10157438
472 Ga0105248_10281193
473 Ga0105248_10397365
474 Ga0105248_10486770
475 Ga0105238_10325280
476 Ga0105249_10002561
477 Ga0157371_10078922
478 Ga0157374_10077092
479 Ga0157378_10094577
480 Ga0157378_10244790
481 Ga0163162_10009672
482 Ga0157375_10011631
483 Ga0163163_10005319
484 Ga0163163_10140676
485 Ga0157380_10079644
486 Ga0157380_10574448
487 Ga0157377_10177669
488 Ga0157379_10015574
489 Ga0157379_10357047
490 Ga0157376_10043292
491 Ga0157376_10080951
492 Ga0163161_10012877
493 Ga0213872_10001441
494 Ga0213876_10000684
495 Ga0224712_10084068
496 Ga0207697_10000530
497 Ga0207682_10000349
498 Ga0207688_10000951
499 Ga0207680_10190715
500 Ga0207699_10000031
501 Ga0207645_10000346
502 Ga0207645_10000777
503 Ga0207645_10157037
504 Ga0207643_10001670
505 Ga0207684_10061770
506 Ga0207684_10089938
507 Ga0207684_10120078
508 Ga0207707_10081737
509 Ga0207695_10121411
510 Ga0207695_10129413
511 Ga0207693_10059501
512 Ga0207662_10001557
513 Ga0207657_10002506
514 Ga0207649_10022914
515 Ga0207652_10038738
516 Ga0207646_10000575
517 Ga0207681_10033899
518 Ga0207650_10066662
519 Ga0207650_10287127
520 Ga0207659_10000511
521 Ga0207659_10004165
522 Ga0207659_10012554
523 Ga0207659_10155992
524 Ga0207659_10156412
525 Ga0207659_10237676
526 Ga0207664_10190173
527 Ga0207644_10429922
528 Ga0207690_10303713
529 Ga0207706_10411582
530 Ga0207670_10109392
531 Ga0207670_10422980
532 Ga0207669_10005240
533 Ga0207669_10040306
534 Ga0207665_10087409
535 Ga0207691_10034688
536 Ga0207691_10046812
537 Ga0207691_10366012
538 Ga0207711_10114401
539 Ga0207711_10199122
540 Ga0207711_10443473
541 Ga0207689_10003093
542 Ga0207689_10211835
543 Ga0207689_10257928
544 Ga0207679_10015142
545 Ga0207667_10088722
546 Ga0207667_10145485
547 Ga0207651_10030454
548 Ga0207651_10081164
549 Ga0207651_10094569
550 Ga0207712_10015239
551 Ga0207712_10123667
552 Ga0207668_10057848
553 Ga0207640_10062630
554 Ga0207658_10034124
555 Ga0207703_10012951
556 Ga0207703_10013249
557 Ga0207703_10105243
558 Ga0207703_10269938
559 Ga0207703_10459800
560 Ga0207708_10002322
561 Ga0207708_10013518
562 Ga0207708_10016144
563 Ga0207702_10378860
564 Ga0207641_10005002
565 Ga0207648_10001795
566 Ga0207648_10009903
567 Ga0207648_10015634
568 Ga0207648_10087778
569 Ga0207676_10038579
570 Ga0207674_10077124
571 Ga0207675_100011719
572 Ga0207675_100035948
573 Ga0207675_100454713
574 Ga0207683_10023508
575 Ga0207683_10185880
576 Ga0207683_10248193
577 Ga0209996_1008281
578 Ga0209974_10015465
579 Ga0209974_10045462
580 Ga0207428_10019722
581 Ga0207428_10020982
582 Ga0207428_10137278
583 Ga0268266_10401830
584 Ga0268265_10084954
585 Ga0268265_10130031
586 Ga0268265_10276772
587 Ga0268265_10585009
588 Ga0268264_10006593
589 Ga0268264_10071690
590 Ga0307405_10270863
591 Ga0307410_10413832
592 Ga0307416_100207610
593 Ga0307415_100012424
594 Ga0307415_100085273
595 Ga0373926_0029394
596 Ga0373949_0015523
597 Ga0373932_0006377
598 Ga0373936_0086298
599 Ga0373945_0045108
600 Ga0373943_0001436
601 Ga0373955_0009386
602 Ga0373955_0072361
603 Ga0373924_0005205
604 Ga0373935_0006417
605 Ga0373947_0140612
606 Ga0373925_0004647
607 Ga0395905_0003600
608 Ga0242420_002083
609 Ga0436365_0297369
610 Ga0436361_0254530
611 Ga0436361_0554014
612 Ga0439435_0003325
613 Ga0451576_0224121
614 Ga0451576_0343571
615 Ga0451576_0537524
616 Ga0495621_0017901
617 Ga0495669_0004790
618 Ga0496104_0452469
619 Ga0496112_0160469
620 Ga0501033_0097500
621 Ga0501036_0180029
622 Ga0501039_0407936
623 Ga0501040_0038141
624 Ga0501047_0193830
625 Ga0501072_0213698
626 Ga0501075_0060811
627 Ga0501076_0166437
628 Ga0501076_0386489
629 Ga0501079_0085788
630 Ga0501081_0023613
631 Ga0501045_0024956
632 nmdc:mga05p37_34338_c1
633 nmdc:mga05p37_45412_c1
634 nmdc:mga05p37_6587_c1
635 nmdc:mga09592_201331_c1
636 nmdc:mga09592_93673_c1
637 nmdc:mga0qj67_168216_c1
638 nmdc:mga0qj67_173976_c1
639 nmdc:mga0qj67_4339_c1
640 nmdc:mga06r32_1084_c1
641 nmdc:mga06r32_126748_c1
642 nmdc:mga06r32_304982_c1
643 nmdc:mga06r32_319421_c1
644 nmdc:mga06r32_35176_c1
645 nmdc:mga06r32_47182_c1
646 nmdc:mga08y16_127869_c1
647 nmdc:mga08y16_36024_c1
648 nmdc:mga0n895_12127_c1
649 nmdc:mga0n895_14030_c1
650 nmdc:mga0rr50_161784_c1
651 nmdc:mga0rr50_34109_c1
652 nmdc:mga0rr50_439191_c1
653 nmdc:mga08x19_23509_c1
654 nmdc:mga08x19_9_c1
655 nmdc:mga0a205_14933_c1
656 nmdc:mga0a205_45367_c1
657 nmdc:mga0a205_89529_c1
658 Ga0501082_0093438

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00174

Oxidored_molyb

Oxidoreductase molybdopterin binding domain

131

292

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xdq-assembly3.cif.gz_C structural and biochemical identification of a novel bacterial oxidoreductase 0.9002 87 319
1xdy-assembly7.cif.gz_G structural and biochemical identification of a novel bacterial oxidoreductase, w-containing cofactor 0.8516 78 319
2c9x-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella y236f mutant 0.815 107 265
2ca4-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella mutant 0.8029 107 265
2ca3-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella r55m mutant 0.8021 107 265
ID Description Score Start End Superfamily
1xdyH00 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8742 78 319 3.90.420.10
2ca4A01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8099 107 265 3.90.420.10
1xdyH00 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8023 78 319 3.90.420.10
af_P96400_291_442_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.7877 104 257 3.90.420.10
4pw9A01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.7715 111 263 3.90.420.10
ID Description Score Start End GO Terms
AF-A0A7S1GSH0-F1-model_v4 Oxidoreductase molybdopterin-binding domain-containing protein 0.914 108 277
AF-A0A7S1GSH0-F1-model_v4 Oxidoreductase molybdopterin-binding domain-containing protein 0.9089 108 277
AF-A0A162C394-F1-model_v4 Oxidoreductase molybdopterin-binding domain-containing protein 0.9066 93 238
AF-A0A388NT57-F1-model_v4 Protein-methionine-sulfoxide reductase catalytic subunit MsrP 0.904 117 324
AF-A0A2V7JYE4-F1-model_v4 Molybdopterin-binding protein 0.9027 108 277

Map