F409863

General Info

Members Datasets Scaffolds Average Seq Length
329 188 658 441

Family's Representative Sequence

Representative Sequence 3300049593|Ga0501077_0038350|Ga0501077_0038350_1515_3011
Length 498
Sequence MRRGASNTTARAARSPTSSFGGMPPILLRVPRDAGNVGGGPPRRLVSVPLPTSAGIFQALAFECASGSVYLALVKGDLDGGEDVVTRVHSECLTGDALGSLRCDCGVQLQLGLRAIGSAGRGVLVYATGHEGRGIGLVNKLRSYAEQDRGADTLDANLALGLAVDARDYTDAAAVLRALGVRSVRLLTNNPRKVDGLRRSGIDVVAVEPLATAPHSRNLGYLRTKERRLGHVRPTGEAVGEEPVDVAPALDISDLIGPVAAPPERPFVVLKFAQTLDGRIATATGDARWISGEAERRASHALRAACDAVLVGVGTVLQDDPQLTVRMVPGASPLRVVLDSTLRVPDRAKILGPGAATTILTTDRSDPGRRRRLAARHLGVQVLPAGTYGVDVRPALGALRASGVETLLVEGGARVITSLLRAGVVDRLIVAVAPTIIGQGTEAVGPLGVTAVADGIRLVNRSMHVVGDDVLLAGDLAASPAVSQQDGPDQLAFIRTQQ

Samples

Sample ID Description Type Environment
1 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
56 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
83 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
88 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
89 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
90 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
91 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
92 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
93 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
94 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
95 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
96 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
97 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
98 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
99 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
100 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
110 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
111 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
112 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
113 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
114 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
115 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
116 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
117 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
118 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
119 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
120 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
121 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
122 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
123 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
124 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
127 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
128 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
129 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
130 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
131 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
132 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
135 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
136 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
137 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
138 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
139 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
140 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
141 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
142 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
163 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
164 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
165 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
166 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
167 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
168 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
169 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
170 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
173 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
175 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
176 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
177 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
178 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
181 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
182 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
184 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
185 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
186 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
187 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
188 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.34
Rhizosphere 94.53
Stem 0
Stem Tuber 0
Unclassified 0.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501077_0038350 3300049593 Bacteria 3050
2 JGI24751J29686_10000502 3300002459 Bacteria 11407
3 JGI25407J50210_10000493 3300003373 Bacteria 7880
4 JGI25407J50210_10001571 3300003373 Bacteria 5200
5 JGI25407J50210_10001582 3300003373 Bacteria 5188
6 JGI25407J50210_10004505 3300003373 Bacteria 3390
7 Ga0070670_100040094 3300005331 Bacteria 4027
8 Ga0070670_100147977 3300005331 Bacteria 2032
9 Ga0070661_100064120 3300005344 Bacteria 2700
10 Ga0070692_10018086 3300005345 Bacteria 3383
11 Ga0070668_100081896 3300005347 Bacteria 2531
12 Ga0070668_100200714 3300005347 Bacteria 1637
13 Ga0070675_100072788 3300005354 Bacteria 2853
14 Ga0070659_100077680 3300005366 Bacteria 2648
15 Ga0070703_10000026 3300005406 Bacteria 71473
16 Ga0070703_10003233 3300005406 Bacteria 4647
17 Ga0070711_100152562 3300005439 Bacteria 1743
18 Ga0070700_100004945 3300005441 Bacteria 7011
19 Ga0070694_100004286 3300005444 Bacteria 8583
20 Ga0070663_100002936 3300005455 Bacteria 9706
21 Ga0070662_100007334 3300005457 Bacteria 7143
22 Ga0070706_100027248 3300005467 Bacteria 5259
23 Ga0070698_100000724 3300005471 Bacteria 35413
24 Ga0070698_100004174 3300005471 Bacteria 15870
25 Ga0070684_100000947 3300005535 Bacteria 20686
26 Ga0070686_100100878 3300005544 Bacteria 1950
27 Ga0070696_100049346 3300005546 Bacteria 2923
28 Ga0070665_100187263 3300005548 Bacteria 2071
29 Ga0070704_100004895 3300005549 Bacteria 7770
30 Ga0070704_100069033 3300005549 Bacteria 2559
31 Ga0070664_100004783 3300005564 Bacteria 10850
32 Ga0068857_100166361 3300005577 Bacteria 2003
33 Ga0068859_100289724 3300005617 Bacteria 1730
34 Ga0068866_10023438 3300005718 Bacteria 2872
35 Ga0068861_100032437 3300005719 Bacteria 3845
36 Ga0068870_10000254 3300005840 Bacteria 19736
37 Ga0068863_100004827 3300005841 Bacteria 13283
38 Ga0081455_10001270 3300005937 Bacteria 31500
39 Ga0081455_10002217 3300005937 Bacteria 23137
40 Ga0081455_10010281 3300005937 Bacteria 9515
41 Ga0081455_10046930 3300005937 Bacteria 3744
42 Ga0081455_10058800 3300005937 Bacteria 3250
43 Ga0081455_10062246 3300005937 Bacteria 3137
44 Ga0081538_10000164 3300005981 Bacteria 70649
45 Ga0081538_10000191 3300005981 Bacteria 67563
46 Ga0081538_10000567 3300005981 Bacteria 40928
47 Ga0081538_10001113 3300005981 Bacteria 28482
48 Ga0081538_10001244 3300005981 Bacteria 26667
49 Ga0081538_10011509 3300005981 Bacteria 7161
50 Ga0081538_10015749 3300005981 Bacteria 5836
51 Ga0081538_10023075 3300005981 Bacteria 4483
52 Ga0081538_10024765 3300005981 Bacteria 4262
53 Ga0081538_10029918 3300005981 Bacteria 3709
54 Ga0081538_10032171 3300005981 Bacteria 3522
55 Ga0081538_10042254 3300005981 Bacteria 2880
56 Ga0081540_1045525 3300005983 Bacteria 2226
57 Ga0070717_10074356 3300006028 Bacteria 2840
58 Ga0075432_10021655 3300006058 Bacteria 2197
59 Ga0075428_100000337 3300006844 Bacteria 46678
60 Ga0075428_100007325 3300006844 Bacteria 12225
61 Ga0075428_100077950 3300006844 Bacteria 3617
62 Ga0075428_100158841 3300006844 Bacteria 2454
63 Ga0075430_100009162 3300006846 Bacteria 8365
64 Ga0075430_100010313 3300006846 Bacteria 7911
65 Ga0075430_100061047 3300006846 Bacteria 3168
66 Ga0075430_100135914 3300006846 Bacteria 2048
67 Ga0075431_100002053 3300006847 Bacteria 19241
68 Ga0075431_100002234 3300006847 Bacteria 18544
69 Ga0075431_100011005 3300006847 Bacteria 9108
70 Ga0075431_100066686 3300006847 Bacteria 3716
71 Ga0075431_100154656 3300006847 Bacteria 2360
72 Ga0075431_100163733 3300006847 Bacteria 2287
73 Ga0075431_100193634 3300006847 Bacteria 2082
74 Ga0075433_10004820 3300006852 Bacteria 10539
75 Ga0075434_100001608 3300006871 Bacteria 19188
76 Ga0075429_100000091 3300006880 Bacteria 48427
77 Ga0075429_100007505 3300006880 Bacteria 9469
78 Ga0075429_100151916 3300006880 Bacteria 2028
79 Ga0075436_100092794 3300006914 Bacteria 2099
80 Ga0097620_100289729 3300006931 Bacteria 1730
81 Ga0075435_100000610 3300007076 Bacteria 21959
82 Ga0075435_100030266 3300007076 Bacteria 4255
83 Ga0111539_10021790 3300009094 Bacteria 7878
84 Ga0111539_10045203 3300009094 Bacteria 5272
85 Ga0111539_10174927 3300009094 Bacteria 2508
86 Ga0105245_10145736 3300009098 Bacteria 2234
87 Ga0114129_10000882 3300009147 Bacteria 39074
88 Ga0114129_10020779 3300009147 Bacteria 9330
89 Ga0114129_10035363 3300009147 Bacteria 7057
90 Ga0114129_10181676 3300009147 Bacteria 2862
91 Ga0114129_10257466 3300009147 Bacteria 2340
92 Ga0114129_10340018 3300009147 Bacteria 1991
93 Ga0114129_10427301 3300009147 Bacteria 1741
94 Ga0105243_10006235 3300009148 Bacteria 9216
95 Ga0105242_10001711 3300009176 Bacteria 17332
96 Ga0105249_10012379 3300009553 Bacteria 7518
97 Ga0105246_10001638 3300011119 Bacteria 13341
98 Ga0105246_10114050 3300011119 Bacteria 1990
99 Ga0157371_10105167 3300013102 Bacteria 2003
100 Ga0163162_10008700 3300013306 Bacteria 9881
101 Ga0163163_10158838 3300014325 Bacteria 2306
102 Ga0157377_10019652 3300014745 Bacteria 3531
103 Ga0157377_10046313 3300014745 Bacteria 2432
104 Ga0213875_10000326 3300021388 Bacteria 45254
105 Ga0207653_10000009 3300025885 Bacteria 197279
106 Ga0207653_10001376 3300025885 Bacteria 7895
107 Ga0207688_10071518 3300025901 Bacteria 1969
108 Ga0207643_10000055 3300025908 Bacteria 73929
109 Ga0207705_10111513 3300025909 Bacteria 2022
110 Ga0207684_10000058 3300025910 Bacteria 211166
111 Ga0207684_10010683 3300025910 Bacteria 8065
112 Ga0207646_10032667 3300025922 Bacteria 4709
113 Ga0207694_10181874 3300025924 Bacteria 1705
114 Ga0207650_10002626 3300025925 Bacteria 12433
115 Ga0207659_10013920 3300025926 Bacteria 5173
116 Ga0207687_10088904 3300025927 Bacteria 2248
117 Ga0207706_10001706 3300025933 Bacteria 21654
118 Ga0207711_10105078 3300025941 Unclassified 2504
119 Ga0207689_10117012 3300025942 Bacteria 2191
120 Ga0207712_10011905 3300025961 Bacteria 5546
121 Ga0207668_10078067 3300025972 Bacteria 2390
122 Ga0207678_10113358 3300026067 Bacteria 2313
123 Ga0207678_10115960 3300026067 Bacteria 2285
124 Ga0207708_10002921 3300026075 Bacteria 12589
125 Ga0207708_10085556 3300026075 Bacteria 2426
126 Ga0207641_10073521 3300026088 Bacteria 2946
127 Ga0207676_10000977 3300026095 Bacteria 22053
128 Ga0207674_10002564 3300026116 Bacteria 22879
129 Ga0207674_10016577 3300026116 Bacteria 8058
130 Ga0207675_100005193 3300026118 Bacteria 12536
131 Ga0207675_100027047 3300026118 Bacteria 5340
132 Ga0207675_100167377 3300026118 Bacteria 2099
133 Ga0268266_10035890 3300028379 Bacteria 4217
134 Ga0268266_10135946 3300028379 Bacteria 2202
135 Ga0307408_100091580 3300031548 Bacteria 2296
136 Ga0307405_10030502 3300031731 Bacteria 3162
137 Ga0307413_10013286 3300031824 Bacteria 4134
138 Ga0307413_10024801 3300031824 Bacteria 3276
139 Ga0307410_10063651 3300031852 Bacteria 2531
140 Ga0307410_10076583 3300031852 Bacteria 2335
141 Ga0307406_10162349 3300031901 Bacteria 1607
142 Ga0307407_10017244 3300031903 Bacteria 3617
143 Ga0307407_10023741 3300031903 Bacteria 3204
144 Ga0307407_10028726 3300031903 Bacteria 2977
145 Ga0307409_100020451 3300031995 Bacteria 4512
146 Ga0307409_100044329 3300031995 Bacteria 3349
147 Ga0307409_100053213 3300031995 Bacteria 3109
148 Ga0307409_100260050 3300031995 Bacteria 1592
149 Ga0307416_100021497 3300032002 Bacteria 4634
150 Ga0307416_100054972 3300032002 Bacteria 3203
151 Ga0307416_100055936 3300032002 Bacteria 3180
152 Ga0307416_100092822 3300032002 Bacteria 2598
153 Ga0307416_100194301 3300032002 Bacteria 1918
154 Ga0307414_10254355 3300032004 Bacteria 1462
155 Ga0307411_10074379 3300032005 Bacteria 2315
156 Ga0307415_100030080 3300032126 Bacteria 3479
157 Ga0307415_100039932 3300032126 Bacteria 3105
158 Ga0307415_100115196 3300032126 Bacteria 2003
159 Ga0307415_100164161 3300032126 Bacteria 1725
160 Ga0373926_0000986 3300035083 Bacteria 8282
161 Ga0373944_0001198 3300035089 Bacteria 6490
162 Ga0373936_0001642 3300035113 Bacteria 8198
163 Ga0373945_0000524 3300035116 Bacteria 10952
164 Ga0373943_0006336 3300035170 Bacteria 5311
165 Ga0373946_0000577 3300035171 Bacteria 12097
166 Ga0373924_0014534 3300035410 Bacteria 2977
167 Ga0373931_0065816 3300035691 Bacteria 1965
168 Ga0373935_0005674 3300035692 Bacteria 7364
169 Ga0373927_0016724 3300035695 Bacteria 4838
170 Ga0373933_0069151 3300035724 Bacteria 2146
171 Ga0373947_0004614 3300035725 Bacteria 8077
172 Ga0373925_0015681 3300037068 Bacteria 5483
173 Ga0395899_0002642 3300037312 Bacteria 14450
174 Ga0395899_0081877 3300037312 Bacteria 2348
175 Ga0395900_0024700 3300037418 Bacteria 6151
176 Ga0395900_0048052 3300037418 Bacteria 4395
177 Ga0395900_0104230 3300037418 Bacteria 2914
178 Ga0395898_0010991 3300037466 Bacteria 9433
179 Ga0395898_0191532 3300037466 Bacteria 1954
180 Ga0395905_0016000 3300037471 Bacteria 7130
181 Ga0395905_0073131 3300037471 Bacteria 3213
182 Ga0395905_0117270 3300037471 Bacteria 2502
183 Ga0395905_0159091 3300037471 Bacteria 2123
184 Ga0436364_0346202 3300037853 Bacteria 62581
185 Ga0436364_0757570 3300037853 Bacteria 2830
186 Ga0436364_1484394 3300037853 Bacteria 4534
187 Ga0395901_0009740 3300038443 Bacteria 9741
188 Ga0395901_0039556 3300038443 Bacteria 4880
189 Ga0395901_0039643 3300038443 Bacteria 4875
190 Ga0395901_0187182 3300038443 Bacteria 2171
191 Ga0436365_0358626 3300039437 Bacteria 1633
192 Ga0436365_0780878 3300039437 Bacteria 4894
193 Ga0451853_4041186 3300041512 Bacteria 1778
194 Ga0439448_0000013 3300042005 Bacteria 29673
195 Ga0439450_000316 3300042008 Bacteria 5987
196 Ga0439450_000422 3300042008 Bacteria 5479
197 Ga0439463_000041 3300042016 Bacteria 27286
198 Ga0439463_000761 3300042016 Bacteria 8922
199 Ga0450913_000559 3300042117 Bacteria 1648
200 Ga0450900_000478 3300042136 Bacteria 3187
201 Ga0439464_0000072 3300042439 Bacteria 14209
202 Ga0439464_0010502 3300042439 Bacteria 2445
203 Ga0439460_0002964 3300042461 Bacteria 4090
204 Ga0439460_0005593 3300042461 Bacteria 3091
205 Ga0450916_002010 3300042530 Bacteria 2100
206 Ga0439440_0000205 3300042993 Bacteria 9253
207 Ga0466966_0000310 3300044684 Bacteria 31446
208 Ga0466971_0011087 3300044719 Bacteria 3946
209 Ga0466970_0002252 3300044765 Bacteria 9314
210 Ga0466957_0007618 3300044842 Bacteria 6122
211 Ga0466959_0015807 3300045049 Bacteria 5506
212 Ga0466959_0030566 3300045049 Unclassified 3988
213 Ga0466958_0000081 3300045836 Bacteria 29136
214 Ga0466958_0002964 3300045836 Bacteria 8693
215 Ga0466967_0021769 3300045976 Bacteria 5216
216 Ga0466967_0098217 3300045976 Bacteria 2674
217 Ga0466967_0199409 3300045976 Bacteria 1895
218 Ga0466967_0280482 3300045976 Bacteria 1599
219 Ga0495603_0005067 3300046455 Bacteria 7872
220 Ga0495653_0004692 3300046463 Bacteria 11063
221 Ga0495662_0006251 3300046476 Bacteria 5953
222 Ga0495664_0002011 3300046477 Bacteria 10859
223 Ga0495584_0052273 3300046491 Bacteria 2056
224 Ga0495608_0043858 3300046511 Bacteria 2987
225 Ga0495618_0005970 3300046514 Bacteria 7397
226 Ga0495630_0005771 3300046517 Bacteria 8748
227 Ga0495630_0281979 3300046517 Bacteria 1269
228 Ga0495663_0010002 3300046525 Bacteria 2632
229 Ga0495665_0005622 3300046531 Bacteria 6758
230 Ga0495667_0009335 3300046559 Bacteria 6647
231 Ga0495656_0035225 3300046615 Bacteria 2056
232 Ga0495635_0014194 3300046663 Bacteria 5575
233 Ga0495657_0056865 3300046675 Bacteria 2603
234 Ga0495599_0030302 3300046678 Bacteria 3394
235 Ga0495624_0005615 3300046690 Bacteria 9005
236 Ga0495581_0107016 3300047315 Bacteria 1625
237 Ga0495674_0002323 3300047319 Bacteria 18677
238 Ga0495684_0005738 3300047471 Bacteria 9657
239 Ga0496102_0033119 3300048905 Bacteria 4643
240 Ga0496102_0294696 3300048905 Bacteria 1529
241 Ga0496106_0000757 3300048909 Bacteria 23309
242 Ga0496107_0003673 3300048910 Bacteria 10313
243 Ga0496108_0014076 3300048911 Bacteria 6526
244 Ga0496109_0029242 3300048912 Bacteria 4935
245 Ga0496109_0053120 3300048912 Bacteria 3694
246 Ga0496110_0023734 3300048913 Bacteria 5219
247 Ga0496110_0054286 3300048913 Bacteria 3524
248 Ga0496114_0004307 3300048917 Bacteria 11016
249 Ga0496115_0052949 3300048918 Bacteria 3257
250 Ga0501031_0029778 3300049568 Bacteria 3562
251 Ga0501033_0059217 3300049570 Bacteria 2828
252 Ga0501036_0042733 3300049572 Bacteria 3837
253 Ga0501038_0032466 3300049574 Bacteria 4606
254 Ga0501039_0091731 3300049575 Bacteria 2368
255 Ga0501039_0164875 3300049575 Bacteria 1742
256 Ga0501040_0017774 3300049576 Bacteria 4719
257 Ga0501040_0052500 3300049576 Bacteria 2790
258 Ga0501040_0068460 3300049576 Bacteria 2448
259 Ga0501042_0016198 3300049578 Bacteria 5114
260 Ga0501042_0017906 3300049578 Bacteria 4896
261 Ga0501042_0054835 3300049578 Bacteria 2843
262 Ga0501046_0018585 3300049580 Bacteria 5780
263 Ga0501046_0022172 3300049580 Bacteria 5234
264 Ga0501048_0062298 3300049582 Bacteria 2640
265 Ga0501048_0101551 3300049582 Bacteria 2029
266 Ga0501067_0013105 3300049583 Bacteria 4589
267 Ga0501068_0013697 3300049584 Bacteria 4618
268 Ga0501068_0059793 3300049584 Bacteria 2314
269 Ga0501069_0027051 3300049585 Bacteria 3143
270 Ga0501069_0042436 3300049585 Bacteria 2516
271 Ga0501071_0000335 3300049587 Bacteria 22714
272 Ga0501071_0006151 3300049587 Bacteria 7778
273 Ga0501071_0187928 3300049587 Bacteria 1549
274 Ga0501072_0002243 3300049588 Bacteria 14425
275 Ga0501072_0043367 3300049588 Bacteria 3535
276 Ga0501072_0083118 3300049588 Bacteria 2538
277 Ga0501074_0006009 3300049590 Bacteria 8760
278 Ga0501075_0014087 3300049591 Bacteria 5726
279 Ga0501075_0053861 3300049591 Bacteria 3025
280 Ga0501075_0085946 3300049591 Bacteria 2383
281 Ga0501076_0001260 3300049592 Bacteria 16868
282 Ga0501076_0067716 3300049592 Unclassified 2851
283 Ga0501077_0013384 3300049593 Bacteria 5145
284 Ga0501079_0011547 3300049741 Bacteria 6743
285 Ga0501079_0025183 3300049741 Bacteria 4563
286 Ga0501079_0070562 3300049741 Bacteria 2698
287 Ga0501079_0086308 3300049741 Bacteria 2429
288 Ga0501080_0026232 3300049742 Bacteria 5415
289 Ga0501081_0002506 3300049743 Bacteria 11576
290 Ga0501081_0038151 3300049743 Bacteria 3281
291 Ga0501081_0068573 3300049743 Bacteria 2469
292 Ga0501081_0152400 3300049743 Bacteria 1661
293 Ga0501035_0109319 3300049822 Bacteria 2424
294 Ga0501035_0184343 3300049822 Bacteria 1797
295 Ga0501045_0004685 3300049824 Bacteria 9446
296 Ga0501045_0013279 3300049824 Bacteria 5814
297 nmdc:mga05p37_310_c1 3300050507 Bacteria 51515
298 nmdc:mga05p37_393731_c1 3300050507 Bacteria 1620
299 nmdc:mga05p37_522008_c1 3300050507 Bacteria 1358
300 nmdc:mga09592_104094_c1 3300050508 Bacteria 2432
301 nmdc:mga09592_6454_c1 3300050508 Bacteria 9554
302 nmdc:mga09592_98213_c1 3300050508 Bacteria 2507
303 nmdc:mga0qj67_2994_c1 3300050509 Bacteria 12123
304 nmdc:mga0qj67_63708_c1 3300050509 Bacteria 2932
305 nmdc:mga0qj67_66330_c1 3300050509 Bacteria 2875
306 nmdc:mga06r32_16617_c1 3300050510 Bacteria 6708
307 nmdc:mga06r32_250507_c1 3300050510 Bacteria 1759
308 nmdc:mga06r32_54128_c1 3300050510 Bacteria 3848
309 nmdc:mga06r32_96753_c1 3300050510 Bacteria 2892
310 nmdc:mga08y16_213598_c1 3300050511 Bacteria 1998
311 nmdc:mga0n895_5113_c1 3300050512 Bacteria 10900
312 nmdc:mga0n895_5338_c1 3300050512 Bacteria 10710
313 nmdc:mga0rr50_23392_c1 3300050513 Bacteria 4260
314 nmdc:mga08x19_46406_c1 3300050514 Bacteria 2778
315 nmdc:mga0a205_257_c1 3300050515 Bacteria 38119
316 nmdc:mga0a205_43365_c1 3300050515 Bacteria 4338
317 Ga0501084_0005318 3300054114 Bacteria 10542
318 Ga0501084_0012512 3300054114 Bacteria 7028
319 Ga0501084_0045331 3300054114 Bacteria 3682
320 Ga0501084_0065444 3300054114 Bacteria 3041
321 Ga0501084_0279767 3300054114 Bacteria 1409
322 Ga0501082_0017511 3300060353 Bacteria 6174
323 Ga0501082_0021723 3300060353 Bacteria 5533
324 Ga0501082_0055052 3300060353 Bacteria 3428
325 Ga0466962_0009720 3300061719 Bacteria 4615
326 Ga0530510_0020685 3300061734 Bacteria 4679
327 Ga0530510_0024778 3300061734 Bacteria 4286
328 Ga0530510_0025579 3300061734 Bacteria 4222
329 2623501335 2622736605 Bacteria 4992138
330 Ga0501077_0038350
331 JGI24751J29686_10000502
332 JGI25407J50210_10000493
333 JGI25407J50210_10001571
334 JGI25407J50210_10001582
335 JGI25407J50210_10004505
336 Ga0070670_100040094
337 Ga0070670_100147977
338 Ga0070661_100064120
339 Ga0070692_10018086
340 Ga0070668_100081896
341 Ga0070668_100200714
342 Ga0070675_100072788
343 Ga0070659_100077680
344 Ga0070703_10000026
345 Ga0070703_10003233
346 Ga0070711_100152562
347 Ga0070700_100004945
348 Ga0070694_100004286
349 Ga0070663_100002936
350 Ga0070662_100007334
351 Ga0070706_100027248
352 Ga0070698_100000724
353 Ga0070698_100004174
354 Ga0070684_100000947
355 Ga0070686_100100878
356 Ga0070696_100049346
357 Ga0070665_100187263
358 Ga0070704_100004895
359 Ga0070704_100069033
360 Ga0070664_100004783
361 Ga0068857_100166361
362 Ga0068859_100289724
363 Ga0068866_10023438
364 Ga0068861_100032437
365 Ga0068870_10000254
366 Ga0068863_100004827
367 Ga0081455_10001270
368 Ga0081455_10002217
369 Ga0081455_10010281
370 Ga0081455_10046930
371 Ga0081455_10058800
372 Ga0081455_10062246
373 Ga0081538_10000164
374 Ga0081538_10000191
375 Ga0081538_10000567
376 Ga0081538_10001113
377 Ga0081538_10001244
378 Ga0081538_10011509
379 Ga0081538_10015749
380 Ga0081538_10023075
381 Ga0081538_10024765
382 Ga0081538_10029918
383 Ga0081538_10032171
384 Ga0081538_10042254
385 Ga0081540_1045525
386 Ga0070717_10074356
387 Ga0075432_10021655
388 Ga0075428_100000337
389 Ga0075428_100007325
390 Ga0075428_100077950
391 Ga0075428_100158841
392 Ga0075430_100009162
393 Ga0075430_100010313
394 Ga0075430_100061047
395 Ga0075430_100135914
396 Ga0075431_100002053
397 Ga0075431_100002234
398 Ga0075431_100011005
399 Ga0075431_100066686
400 Ga0075431_100154656
401 Ga0075431_100163733
402 Ga0075431_100193634
403 Ga0075433_10004820
404 Ga0075434_100001608
405 Ga0075429_100000091
406 Ga0075429_100007505
407 Ga0075429_100151916
408 Ga0075436_100092794
409 Ga0097620_100289729
410 Ga0075435_100000610
411 Ga0075435_100030266
412 Ga0111539_10021790
413 Ga0111539_10045203
414 Ga0111539_10174927
415 Ga0105245_10145736
416 Ga0114129_10000882
417 Ga0114129_10020779
418 Ga0114129_10035363
419 Ga0114129_10181676
420 Ga0114129_10257466
421 Ga0114129_10340018
422 Ga0114129_10427301
423 Ga0105243_10006235
424 Ga0105242_10001711
425 Ga0105249_10012379
426 Ga0105246_10001638
427 Ga0105246_10114050
428 Ga0157371_10105167
429 Ga0163162_10008700
430 Ga0163163_10158838
431 Ga0157377_10019652
432 Ga0157377_10046313
433 Ga0213875_10000326
434 Ga0207653_10000009
435 Ga0207653_10001376
436 Ga0207688_10071518
437 Ga0207643_10000055
438 Ga0207705_10111513
439 Ga0207684_10000058
440 Ga0207684_10010683
441 Ga0207646_10032667
442 Ga0207694_10181874
443 Ga0207650_10002626
444 Ga0207659_10013920
445 Ga0207687_10088904
446 Ga0207706_10001706
447 Ga0207711_10105078
448 Ga0207689_10117012
449 Ga0207712_10011905
450 Ga0207668_10078067
451 Ga0207678_10113358
452 Ga0207678_10115960
453 Ga0207708_10002921
454 Ga0207708_10085556
455 Ga0207641_10073521
456 Ga0207676_10000977
457 Ga0207674_10002564
458 Ga0207674_10016577
459 Ga0207675_100005193
460 Ga0207675_100027047
461 Ga0207675_100167377
462 Ga0268266_10035890
463 Ga0268266_10135946
464 Ga0307408_100091580
465 Ga0307405_10030502
466 Ga0307413_10013286
467 Ga0307413_10024801
468 Ga0307410_10063651
469 Ga0307410_10076583
470 Ga0307406_10162349
471 Ga0307407_10017244
472 Ga0307407_10023741
473 Ga0307407_10028726
474 Ga0307409_100020451
475 Ga0307409_100044329
476 Ga0307409_100053213
477 Ga0307409_100260050
478 Ga0307416_100021497
479 Ga0307416_100054972
480 Ga0307416_100055936
481 Ga0307416_100092822
482 Ga0307416_100194301
483 Ga0307414_10254355
484 Ga0307411_10074379
485 Ga0307415_100030080
486 Ga0307415_100039932
487 Ga0307415_100115196
488 Ga0307415_100164161
489 Ga0373926_0000986
490 Ga0373944_0001198
491 Ga0373936_0001642
492 Ga0373945_0000524
493 Ga0373943_0006336
494 Ga0373946_0000577
495 Ga0373924_0014534
496 Ga0373931_0065816
497 Ga0373935_0005674
498 Ga0373927_0016724
499 Ga0373933_0069151
500 Ga0373947_0004614
501 Ga0373925_0015681
502 Ga0395899_0002642
503 Ga0395899_0081877
504 Ga0395900_0024700
505 Ga0395900_0048052
506 Ga0395900_0104230
507 Ga0395898_0010991
508 Ga0395898_0191532
509 Ga0395905_0016000
510 Ga0395905_0073131
511 Ga0395905_0117270
512 Ga0395905_0159091
513 Ga0436364_0346202
514 Ga0436364_0757570
515 Ga0436364_1484394
516 Ga0395901_0009740
517 Ga0395901_0039556
518 Ga0395901_0039643
519 Ga0395901_0187182
520 Ga0436365_0358626
521 Ga0436365_0780878
522 Ga0451853_4041186
523 Ga0439448_0000013
524 Ga0439450_000316
525 Ga0439450_000422
526 Ga0439463_000041
527 Ga0439463_000761
528 Ga0450913_000559
529 Ga0450900_000478
530 Ga0439464_0000072
531 Ga0439464_0010502
532 Ga0439460_0002964
533 Ga0439460_0005593
534 Ga0450916_002010
535 Ga0439440_0000205
536 Ga0466966_0000310
537 Ga0466971_0011087
538 Ga0466970_0002252
539 Ga0466957_0007618
540 Ga0466959_0015807
541 Ga0466959_0030566
542 Ga0466958_0000081
543 Ga0466958_0002964
544 Ga0466967_0021769
545 Ga0466967_0098217
546 Ga0466967_0199409
547 Ga0466967_0280482
548 Ga0495603_0005067
549 Ga0495653_0004692
550 Ga0495662_0006251
551 Ga0495664_0002011
552 Ga0495584_0052273
553 Ga0495608_0043858
554 Ga0495618_0005970
555 Ga0495630_0005771
556 Ga0495630_0281979
557 Ga0495663_0010002
558 Ga0495665_0005622
559 Ga0495667_0009335
560 Ga0495656_0035225
561 Ga0495635_0014194
562 Ga0495657_0056865
563 Ga0495599_0030302
564 Ga0495624_0005615
565 Ga0495581_0107016
566 Ga0495674_0002323
567 Ga0495684_0005738
568 Ga0496102_0033119
569 Ga0496102_0294696
570 Ga0496106_0000757
571 Ga0496107_0003673
572 Ga0496108_0014076
573 Ga0496109_0029242
574 Ga0496109_0053120
575 Ga0496110_0023734
576 Ga0496110_0054286
577 Ga0496114_0004307
578 Ga0496115_0052949
579 Ga0501031_0029778
580 Ga0501033_0059217
581 Ga0501036_0042733
582 Ga0501038_0032466
583 Ga0501039_0091731
584 Ga0501039_0164875
585 Ga0501040_0017774
586 Ga0501040_0052500
587 Ga0501040_0068460
588 Ga0501042_0016198
589 Ga0501042_0017906
590 Ga0501042_0054835
591 Ga0501046_0018585
592 Ga0501046_0022172
593 Ga0501048_0062298
594 Ga0501048_0101551
595 Ga0501067_0013105
596 Ga0501068_0013697
597 Ga0501068_0059793
598 Ga0501069_0027051
599 Ga0501069_0042436
600 Ga0501071_0000335
601 Ga0501071_0006151
602 Ga0501071_0187928
603 Ga0501072_0002243
604 Ga0501072_0043367
605 Ga0501072_0083118
606 Ga0501074_0006009
607 Ga0501075_0014087
608 Ga0501075_0053861
609 Ga0501075_0085946
610 Ga0501076_0001260
611 Ga0501076_0067716
612 Ga0501077_0013384
613 Ga0501079_0011547
614 Ga0501079_0025183
615 Ga0501079_0070562
616 Ga0501079_0086308
617 Ga0501080_0026232
618 Ga0501081_0002506
619 Ga0501081_0038151
620 Ga0501081_0068573
621 Ga0501081_0152400
622 Ga0501035_0109319
623 Ga0501035_0184343
624 Ga0501045_0004685
625 Ga0501045_0013279
626 nmdc:mga05p37_310_c1
627 nmdc:mga05p37_393731_c1
628 nmdc:mga05p37_522008_c1
629 nmdc:mga09592_104094_c1
630 nmdc:mga09592_6454_c1
631 nmdc:mga09592_98213_c1
632 nmdc:mga0qj67_2994_c1
633 nmdc:mga0qj67_63708_c1
634 nmdc:mga0qj67_66330_c1
635 nmdc:mga06r32_16617_c1
636 nmdc:mga06r32_250507_c1
637 nmdc:mga06r32_54128_c1
638 nmdc:mga06r32_96753_c1
639 nmdc:mga08y16_213598_c1
640 nmdc:mga0n895_5113_c1
641 nmdc:mga0n895_5338_c1
642 nmdc:mga0rr50_23392_c1
643 nmdc:mga08x19_46406_c1
644 nmdc:mga0a205_257_c1
645 nmdc:mga0a205_43365_c1
646 Ga0501084_0005318
647 Ga0501084_0012512
648 Ga0501084_0045331
649 Ga0501084_0065444
650 Ga0501084_0279767
651 Ga0501082_0017511
652 Ga0501082_0021723
653 Ga0501082_0055052
654 Ga0466962_0009720
655 Ga0530510_0020685
656 Ga0530510_0024778
657 Ga0530510_0025579
658 2623501335

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00925

GTP_cyclohydro2

GTP cyclohydrolase II

43

209

0.96

PF01872

RibD_C

RibD C-terminal domain

266

472

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bz1-assembly1.cif.gz_A-2 crystal structure of apo e. coli gtp cyclohydrolase ii 0.9353 7 175
2bz0-assembly1.cif.gz_A crystal structure of e. coli gtp cyclohydrolase ii in complex with gtp analogue, gmpcpp, and zinc 0.9314 7 175
2bz0-assembly1.cif.gz_A crystal structure of e. coli gtp cyclohydrolase ii in complex with gtp analogue, gmpcpp, and zinc 0.9102 7 175
2bz1-assembly1.cif.gz_A-2 crystal structure of apo e. coli gtp cyclohydrolase ii 0.9095 7 175
4rl4-assembly1.cif.gz_A crystal structure of gtp cyclohydrolase ii from helicobacter pylori 26695 0.899 6 175
ID Description Score Start End Superfamily
af_A0A0R0GI97_331_502_3.40.50.10990 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;GTP cyclohydrolase II 0.9732 9 177 3.40.50.10990
af_Q2FXG1_205_373_3.40.50.10990 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;GTP cyclohydrolase II 0.9562 9 175 3.40.50.10990
af_A0A0R0GI97_331_502_3.40.50.10990 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;GTP cyclohydrolase II 0.951 9 177 3.40.50.10990
af_Q5A1Y2_80_302_3.40.50.10990 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;GTP cyclohydrolase II 0.9356 12 173 3.40.50.10990
2bz0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;GTP cyclohydrolase II 0.9314 7 175 3.40.50.10990
ID Description Score Start End GO Terms
AF-A0A4J0IC30-F1-model_v4 deleted 0.9985 95 197
AF-A0A7K3D485-F1-model_v4 GTP cyclohydrolase II (EC 3.5.4.25) 0.9942 35 196 GO:0003935
GO:0005525
GO:0005829
GO:0009231
AF-K1U4G7-F1-model_v4 GTP cyclohydrolase II/3,4-dihydroxy-2-butanone 4-phosphate synthase 0.994 99 197 GO:0005829
GO:0008686
GO:0009231
GO:0016787
AF-X7YPH3-F1-model_v4 GTP cyclohydrolase II (EC 3.5.4.25) 0.9919 53 196 GO:0003935
GO:0005525
GO:0005829
GO:0009231
GO:0009349
AF-A0A661KBP3-F1-model_v4 GTP cyclohydrolase II (EC 3.5.4.25) 0.9911 97 197 GO:0003935
GO:0005525
GO:0005829
GO:0009231

Map