F409850

General Info

Members Datasets Scaffolds Average Seq Length
329 216 658 163

Family's Representative Sequence

Representative Sequence 3300049573|Ga0501037_0293185|Ga0501037_0293185_462_995
Length 162
Sequence MHCPYCKNEDTKVLDSRVADDGGSIRRRRTCAACDRRFTTVEKMQLTVLKRSGATEPFNRDKAIAGVRKACKGRPVLRLSGQAEFDANEVGLAILAPLRALDEVAYLRFASVYRAFESADDFEAEIAVLRAERAATTDEPVLVPVQPHPGQDLAVSASDASG

Samples

Sample ID Description Type Environment
1 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
41 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
42 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
43 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
44 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
45 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
79 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
80 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
81 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
82 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
83 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
84 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
85 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
86 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
89 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
90 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
91 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
92 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
96 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
104 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
105 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
107 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
108 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
109 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
110 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
111 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
112 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
113 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
119 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
120 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
121 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
122 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
123 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
124 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
125 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
126 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
127 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
128 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
129 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
130 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
131 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
132 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
133 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
134 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
135 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
136 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
137 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
138 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
139 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
140 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
141 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
142 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
143 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
144 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
145 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
146 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
147 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
163 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
164 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
180 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
181 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
182 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
183 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
184 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
185 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
186 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
187 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
191 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
194 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
197 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
198 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
199 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
200 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
201 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
202 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
203 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
205 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
206 2643221561 Nocardioides sp. Root151 Isolate Unclassified
207 2643221696 Nocardioides sp. Root140 Isolate Unclassified
208 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
209 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
210 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
211 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
212 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
213 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
214 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
215 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
216 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.01
Metatranscriptomes 3.65
Isolates 3.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.13
Nodule 0
Rhizoplane 10.03
Rhizosphere 82.37
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501037_0293185 3300049573 Bacteria 1131
2 LJQas_1010496 3300000549 Bacteria 1109
3 JGI24740J21852_10021843 3300001979 Bacteria 2212
4 JGI24739J22299_10005169 3300001989 Bacteria 4970
5 JGI24739J22299_10072240 3300001989 Bacteria 1072
6 JGI24737J22298_10014454 3300001990 Bacteria 2563
7 JGI24737J22298_10115075 3300001990 Bacteria 795
8 Ga0070683_100131951 3300005329 Bacteria 2364
9 Ga0070670_100524677 3300005331 Bacteria 1055
10 Ga0070682_100122313 3300005337 Bacteria 1749
11 Ga0070682_100304696 3300005337 Bacteria 1170
12 Ga0068868_100216898 3300005338 Bacteria 1601
13 Ga0070660_100533252 3300005339 Bacteria 978
14 Ga0070692_10829083 3300005345 Bacteria 634
15 Ga0070668_100262567 3300005347 Bacteria 1436
16 Ga0070668_101765551 3300005347 Bacteria 569
17 Ga0070674_101602717 3300005356 Bacteria 587
18 Ga0070667_100480153 3300005367 Bacteria 1138
19 Ga0070705_100547916 3300005440 Bacteria 886
20 Ga0070663_100281457 3300005455 Bacteria 1325
21 Ga0070662_100100789 3300005457 Bacteria 2185
22 Ga0070681_10312868 3300005458 Bacteria 1480
23 Ga0070699_100864017 3300005518 Bacteria 828
24 Ga0070679_100600527 3300005530 Bacteria 1044
25 Ga0070684_100199204 3300005535 Bacteria 1823
26 Ga0068855_100451942 3300005563 Bacteria 1402
27 Ga0068857_100673316 3300005577 Bacteria 982
28 Ga0068857_100811562 3300005577 Bacteria 894
29 Ga0068856_100251472 3300005614 Bacteria 1782
30 Ga0068859_100306069 3300005617 Bacteria 1683
31 Ga0081455_10055955 3300005937 Bacteria 3352
32 Ga0081539_10042861 3300005985 Bacteria 2631
33 Ga0075368_10288235 3300006042 Bacteria 706
34 Ga0075363_100323158 3300006048 Bacteria 898
35 Ga0075362_10180325 3300006177 Bacteria 1023
36 Ga0068871_100668124 3300006358 Bacteria 950
37 Ga0075430_100086179 3300006846 Bacteria 2629
38 Ga0075434_100602923 3300006871 Bacteria 1117
39 Ga0097620_100306048 3300006931 Bacteria 1683
40 Ga0105243_10436490 3300009148 Bacteria 1225
41 Ga0105241_10579783 3300009174 Bacteria 1011
42 Ga0105241_10725015 3300009174 Bacteria 909
43 Ga0105238_11641892 3300009551 Bacteria 673
44 Ga0105249_11146128 3300009553 Bacteria 848
45 Ga0105246_10305612 3300011119 Bacteria 1286
46 Ga0157323_1000396 3300012495 Bacteria 1926
47 Ga0157319_1001238 3300012497 Bacteria 1289
48 Ga0157314_1017874 3300012500 Bacteria 694
49 Ga0157324_1000948 3300012506 Bacteria 1488
50 Ga0157315_1014709 3300012508 Bacteria 753
51 Ga0157326_1005566 3300012513 Bacteria 1335
52 Ga0157371_10343507 3300013102 Bacteria 1086
53 Ga0157370_10552172 3300013104 Bacteria 1056
54 Ga0163162_11556071 3300013306 Bacteria 754
55 Ga0157372_10666977 3300013307 Bacteria 1211
56 Ga0157377_10258677 3300014745 Bacteria 1132
57 Ga0157376_11073340 3300014969 Bacteria 830
58 Ga0163161_10134483 3300017792 Bacteria 1868
59 Ga0206356_11302453 3300020070 Bacteria 1299
60 Ga0206351_10168757 3300020077 Bacteria 833
61 Ga0206352_10763204 3300020078 Bacteria 1159
62 Ga0206350_10132833 3300020080 Bacteria 783
63 Ga0206354_11556067 3300020081 Bacteria 1289
64 Ga0224712_10034957 3300022467 Bacteria 1852
65 Ga0224712_10265506 3300022467 Bacteria 796
66 Ga0207688_10147476 3300025901 Bacteria 1388
67 Ga0207647_10168809 3300025904 Bacteria 1274
68 Ga0207671_10205848 3300025914 Bacteria 1538
69 Ga0207662_10106876 3300025918 Bacteria 1741
70 Ga0207649_10790050 3300025920 Bacteria 740
71 Ga0207687_11105365 3300025927 Bacteria 681
72 Ga0207644_10431394 3300025931 Bacteria 1081
73 Ga0207706_10093317 3300025933 Bacteria 2647
74 Ga0207669_10510358 3300025937 Bacteria 964
75 Ga0207661_10327614 3300025944 Bacteria 1378
76 Ga0207661_10444341 3300025944 Bacteria 1180
77 Ga0207661_11420327 3300025944 Bacteria 637
78 Ga0207667_10322384 3300025949 Bacteria 1578
79 Ga0207668_10075196 3300025972 Bacteria 2428
80 Ga0207668_10665301 3300025972 Bacteria 913
81 Ga0207668_11651071 3300025972 Bacteria 579
82 Ga0207658_10461842 3300025986 Bacteria 1126
83 Ga0207658_10496539 3300025986 Bacteria 1086
84 Ga0207658_10677919 3300025986 Bacteria 930
85 Ga0207677_10309669 3300026023 Bacteria 1308
86 Ga0207639_11296758 3300026041 Bacteria 683
87 Ga0207674_10029988 3300026116 Bacteria 5722
88 Ga0207674_10532262 3300026116 Bacteria 1135
89 Ga0207698_10513687 3300026142 Bacteria 1168
90 Ga0207698_10696477 3300026142 Bacteria 1010
91 Ga0209970_1057378 3300027614 Bacteria 711
92 Ga0209998_10121846 3300027717 Bacteria 658
93 Ga0307517_10255823 3300028786 Bacteria 1022
94 Ga0307515_10267907 3300028794 Bacteria 1434
95 Ga0307512_10084166 3300030522 Bacteria 2263
96 Ga0314311_1111643 3300030733 Bacteria 758
97 Ga0316178_1009907 3300030735 Bacteria 1606
98 Ga0316180_1128086 3300030736 Bacteria 1392
99 Ga0316181_1113417 3300030744 Bacteria 2066
100 Ga0316181_1123035 3300030744 Bacteria 1309
101 Ga0316182_1385471 3300030745 Bacteria 1828
102 Ga0307513_10115730 3300031456 Bacteria 2663
103 Ga0307408_100073559 3300031548 Bacteria 2534
104 Ga0307508_10379677 3300031616 Bacteria 1004
105 Ga0307508_10746107 3300031616 Bacteria 592
106 Ga0316576_10003593 3300031727 Bacteria 9141
107 Ga0316578_10012372 3300031728 Bacteria 4498
108 Ga0307405_10393333 3300031731 Bacteria 1083
109 Ga0316577_10022330 3300031733 Bacteria 3513
110 Ga0307413_10102470 3300031824 Bacteria 1895
111 Ga0307413_10403999 3300031824 Bacteria 1071
112 Ga0307413_10465724 3300031824 Bacteria 1007
113 Ga0307410_10284867 3300031852 Bacteria 1298
114 Ga0307410_10709345 3300031852 Bacteria 849
115 Ga0307406_10972249 3300031901 Bacteria 727
116 Ga0307407_10234787 3300031903 Bacteria 1248
117 Ga0307407_10361969 3300031903 Bacteria 1030
118 Ga0307412_10176585 3300031911 Bacteria 1602
119 Ga0307412_10952713 3300031911 Bacteria 755
120 Ga0307409_100356056 3300031995 Bacteria 1383
121 Ga0307409_100969999 3300031995 Bacteria 867
122 Ga0307409_101476422 3300031995 Bacteria 707
123 Ga0307416_100222650 3300032002 Bacteria 1811
124 Ga0307416_100468765 3300032002 Bacteria 1316
125 Ga0307416_101187430 3300032002 Bacteria 868
126 Ga0307416_101841709 3300032002 Bacteria 709
127 Ga0307414_10510356 3300032004 Bacteria 1065
128 Ga0307414_10931991 3300032004 Bacteria 797
129 Ga0307411_10199363 3300032005 Bacteria 1536
130 Ga0307411_10381330 3300032005 Bacteria 1160
131 Ga0307415_100501667 3300032126 Bacteria 1061
132 Ga0307415_100856664 3300032126 Bacteria 834
133 Ga0316585_10004851 3300032137 Bacteria 3773
134 Ga0316580_10015364 3300032139 Bacteria 2342
135 Ga0316596_1104916 3300033541 Bacteria 765
136 Ga0373938_0135676 3300034957 Bacteria 645
137 Ga0373952_0220071 3300035092 Bacteria 564
138 Ga0373941_0063214 3300035115 Bacteria 1210
139 Ga0373954_0278021 3300035118 Bacteria 825
140 Ga0373956_0000984 3300035119 Bacteria 11829
141 Ga0316574_0193758 3300035398 Bacteria 1306
142 Ga0373931_0107534 3300035691 Bacteria 1578
143 Ga0316582_0037539 3300036647 Bacteria 3004
144 Ga0395900_1053877 3300037418 Bacteria 732
145 Ga0395898_0423911 3300037466 Bacteria 1268
146 Ga0395898_0511685 3300037466 Bacteria 1142
147 Ga0395905_0228981 3300037471 Bacteria 1738
148 Ga0395901_0596346 3300038443 Bacteria 1114
149 Ga0436362_0259477 3300039453 Bacteria 729
150 Ga0439438_017991 3300041405 Bacteria 2022
151 Ga0439461_0165012 3300041410 Bacteria 579
152 Ga0439465_0174293 3300041413 Bacteria 776
153 Ga0451795_1242544 3300041456 Bacteria 707
154 Ga0451800_0320896 3300041459 Bacteria 729
155 Ga0451802_0060820 3300041460 Bacteria 820
156 Ga0451802_0760563 3300041460 Bacteria 961
157 Ga0451837_0458295 3300041494 Bacteria 1081
158 Ga0451843_1031454 3300041509 Bacteria 739
159 Ga0439446_0076498 3300042156 Bacteria 1031
160 Ga0451577_0102302 3300042876 Bacteria 2560
161 Ga0466969_0089294 3300044656 Bacteria 1462
162 Ga0466972_0047317 3300044658 Bacteria 2080
163 Ga0466972_0306277 3300044658 Bacteria 742
164 Ga0466965_0026295 3300044683 Bacteria 2821
165 Ga0466965_0136163 3300044683 Bacteria 1276
166 Ga0466965_0328756 3300044683 Bacteria 834
167 Ga0466966_0055464 3300044684 Bacteria 2508
168 Ga0466966_0280558 3300044684 Bacteria 1002
169 Ga0466966_0517679 3300044684 Bacteria 718
170 Ga0466961_0350812 3300044693 Bacteria 898
171 Ga0466961_0693022 3300044693 Bacteria 610
172 Ga0466964_0070091 3300044706 Bacteria 1480
173 Ga0466964_0105145 3300044706 Bacteria 1251
174 Ga0466964_0415806 3300044706 Bacteria 706
175 Ga0466971_0506502 3300044719 Bacteria 596
176 Ga0466970_0025386 3300044765 Bacteria 3102
177 Ga0466970_0066417 3300044765 Bacteria 1936
178 Ga0466970_0088382 3300044765 Bacteria 1680
179 Ga0466970_0099115 3300044765 Bacteria 1586
180 Ga0466970_0103675 3300044765 Bacteria 1550
181 Ga0466970_0129063 3300044765 Bacteria 1388
182 Ga0466970_0288205 3300044765 Bacteria 924
183 Ga0466970_0409647 3300044765 Bacteria 774
184 Ga0466970_0434331 3300044765 Bacteria 751
185 Ga0466957_0018498 3300044842 Bacteria 4093
186 Ga0466957_0216314 3300044842 Bacteria 1264
187 Ga0466957_0562391 3300044842 Bacteria 795
188 Ga0466960_0122354 3300044901 Bacteria 1364
189 Ga0466960_0233976 3300044901 Bacteria 1015
190 Ga0466960_0300222 3300044901 Bacteria 905
191 Ga0466960_0399461 3300044901 Bacteria 791
192 Ga0466960_0461270 3300044901 Bacteria 740
193 Ga0466960_0662715 3300044901 Bacteria 624
194 Ga0466959_0122880 3300045049 Bacteria 1844
195 Ga0466959_0198708 3300045049 Bacteria 1397
196 Ga0466958_0476039 3300045836 Bacteria 809
197 Ga0466967_0044372 3300045976 Bacteria 3856
198 Ga0466967_0127443 3300045976 Bacteria 2359
199 Ga0466967_0219989 3300045976 Bacteria 1804
200 Ga0466967_0284498 3300045976 Bacteria 1587
201 Ga0466967_0313024 3300045976 Bacteria 1513
202 Ga0466967_0414338 3300045976 Bacteria 1312
203 Ga0495650_0050551 3300046471 Bacteria 1718
204 Ga0495639_0387616 3300046475 Bacteria 705
205 Ga0495664_0137461 3300046477 Bacteria 1481
206 Ga0495596_0288698 3300046500 Bacteria 638
207 Ga0495658_0488790 3300046683 Bacteria 787
208 Ga0496100_0082400 3300048903 Bacteria 2175
209 Ga0496100_0430544 3300048903 Bacteria 1009
210 Ga0496101_0890267 3300048904 Bacteria 701
211 Ga0496102_0046347 3300048905 Bacteria 3948
212 Ga0496103_0117621 3300048906 Bacteria 1692
213 Ga0496104_0166964 3300048907 Bacteria 2110
214 Ga0496104_0213807 3300048907 Bacteria 1840
215 Ga0496104_0417424 3300048907 Bacteria 1254
216 Ga0496105_0351886 3300048908 Bacteria 1176
217 Ga0496106_0041190 3300048909 Bacteria 3460
218 Ga0496107_0168561 3300048910 Bacteria 1624
219 Ga0496107_0177089 3300048910 Bacteria 1583
220 Ga0496108_0497249 3300048911 Bacteria 1065
221 Ga0496108_1090005 3300048911 Bacteria 679
222 Ga0496109_0025461 3300048912 Bacteria 5273
223 Ga0496109_0244217 3300048912 Bacteria 1690
224 Ga0496109_0283568 3300048912 Bacteria 1561
225 Ga0496109_0508769 3300048912 Bacteria 1137
226 Ga0496110_0343243 3300048913 Bacteria 1360
227 Ga0496111_0253645 3300048914 Bacteria 1305
228 Ga0496111_0323646 3300048914 Bacteria 1142
229 Ga0496113_0123446 3300048916 Bacteria 2026
230 Ga0496113_0314017 3300048916 Bacteria 1256
231 Ga0496114_0135597 3300048917 Bacteria 2128
232 Ga0496114_0224311 3300048917 Bacteria 1650
233 Ga0496114_0294993 3300048917 Bacteria 1431
234 Ga0496114_0664743 3300048917 Bacteria 915
235 Ga0496115_0259379 3300048918 Bacteria 1430
236 Ga0496115_0302067 3300048918 Bacteria 1311
237 Ga0496117_0092672 3300048920 Bacteria 1940
238 Ga0496124_0022333 3300048927 Bacteria 5802
239 Ga0496124_0072562 3300048927 Bacteria 2850
240 Ga0501317_017776 3300049533 Bacteria 935
241 Ga0501317_073729 3300049533 Bacteria 580
242 Ga0501318_029569 3300049534 Bacteria 739
243 Ga0501031_0231796 3300049568 Bacteria 1201
244 Ga0501031_0385706 3300049568 Bacteria 906
245 Ga0501032_0009653 3300049569 Bacteria 6990
246 Ga0501033_0009731 3300049570 Bacteria 7388
247 Ga0501033_0124769 3300049570 Bacteria 1867
248 Ga0501033_0316796 3300049570 Bacteria 1096
249 Ga0501033_0491023 3300049570 Bacteria 850
250 Ga0501034_0043346 3300049571 Bacteria 4554
251 Ga0501034_0044842 3300049571 Bacteria 4470
252 Ga0501036_0007694 3300049572 Bacteria 8800
253 Ga0501036_0105154 3300049572 Bacteria 2387
254 Ga0501036_0349226 3300049572 Bacteria 1235
255 Ga0501037_0000627 3300049573 Bacteria 27381
256 Ga0501037_0020081 3300049573 Bacteria 4932
257 Ga0501038_0005560 3300049574 Bacteria 11703
258 Ga0501038_0005868 3300049574 Bacteria 11360
259 Ga0501038_0066148 3300049574 Bacteria 3079
260 Ga0501038_1003264 3300049574 Bacteria 613
261 Ga0501039_0016788 3300049575 Bacteria 5610
262 Ga0501041_0695354 3300049577 Bacteria 651
263 Ga0501041_0743993 3300049577 Bacteria 628
264 Ga0501042_0016896 3300049578 Bacteria 5021
265 Ga0501042_0331768 3300049578 Bacteria 1099
266 Ga0501042_0519654 3300049578 Bacteria 865
267 Ga0501043_0094985 3300049579 Bacteria 2343
268 Ga0501043_0248905 3300049579 Bacteria 1369
269 Ga0501043_0489358 3300049579 Bacteria 920
270 Ga0501046_0000919 3300049580 Bacteria 28877
271 Ga0501046_0003412 3300049580 Bacteria 14588
272 Ga0501046_0139783 3300049580 Bacteria 1833
273 Ga0501047_0028832 3300049581 Bacteria 5354
274 Ga0501047_0097111 3300049581 Bacteria 2824
275 Ga0501047_0714189 3300049581 Bacteria 819
276 Ga0501048_0002214 3300049582 Bacteria 14804
277 Ga0501048_0206445 3300049582 Bacteria 1393
278 Ga0501048_0474205 3300049582 Bacteria 897
279 Ga0501067_0175755 3300049583 Bacteria 1192
280 Ga0501067_0403922 3300049583 Bacteria 762
281 Ga0501068_0108058 3300049584 Bacteria 1728
282 Ga0501068_0388809 3300049584 Bacteria 899
283 Ga0501068_0721989 3300049584 Bacteria 652
284 Ga0501070_0064094 3300049586 Bacteria 3044
285 Ga0501071_0370888 3300049587 Bacteria 1091
286 Ga0501071_0521291 3300049587 Bacteria 912
287 Ga0501071_0662286 3300049587 Bacteria 803
288 Ga0501071_1015013 3300049587 Bacteria 641
289 Ga0501073_0163648 3300049589 Bacteria 1541
290 Ga0501074_0110488 3300049590 Bacteria 1967
291 Ga0501075_0928436 3300049591 Bacteria 661
292 Ga0501076_0943667 3300049592 Bacteria 711
293 Ga0501243_022651 3300049675 Bacteria 1042
294 Ga0501079_0241671 3300049741 Bacteria 1411
295 Ga0501079_0830495 3300049741 Bacteria 728
296 Ga0501079_1001831 3300049741 Bacteria 658
297 Ga0501080_0437540 3300049742 Bacteria 1173
298 Ga0501081_0457325 3300049743 Bacteria 949
299 Ga0501035_0017166 3300049822 Bacteria 6670
300 Ga0501044_0016885 3300049823 Bacteria 7831
301 Ga0501044_0109934 3300049823 Bacteria 2765
302 Ga0501044_0505062 3300049823 Bacteria 1110
303 Ga0501045_0134090 3300049824 Bacteria 1841
304 Ga0501045_0320100 3300049824 Bacteria 1154
305 nmdc:mga0yw44_110045_c1 3300050492 Bacteria 1764
306 nmdc:mga0n895_1151463_c1 3300050512 Bacteria 751
307 Ga0495601_0157806 3300053077 Bacteria 1482
308 Ga0495601_0259846 3300053077 Bacteria 1134
309 Ga0495595_0069270 3300053084 Bacteria 1665
310 Ga0495595_0244549 3300053084 Bacteria 898
311 Ga0495619_0087296 3300053085 Bacteria 2109
312 Ga0500556_0000443 3300053104 Bacteria 29482
313 Ga0500593_000103 3300053117 Bacteria 32439
314 Ga0500573_0157235 3300053140 Bacteria 1240
315 Ga0501084_0242371 3300054114 Bacteria 1522
316 Ga0587107_029735 3300059652 Bacteria 824
317 Ga0466962_0082173 3300061719 Bacteria 1541
318 Ga0530510_0337908 3300061734 Bacteria 1130
319 2643827534 2643221561 Bacteria 4984412
320 2644533636 2643221696 Bacteria 5431823
321 2644537797 2643221697 Bacteria 3575694
322 2774394677 2773857762 Bacteria 5971770
323 2809194479 2808606439 Bacteria 5952208
324 2812349228 2811994878 Bacteria 5992952
325 2816428131 2816332119 Bacteria 8120218
326 2837273142 2837268691 Bacteria 7850704
327 2891973061 2891968417 Bacteria 5821697
328 2904433170 2904430863 Bacteria 3486923
329 8053950258 8053945823 Bacteria 8962862
330 Ga0501037_0293185
331 LJQas_1010496
332 JGI24740J21852_10021843
333 JGI24739J22299_10005169
334 JGI24739J22299_10072240
335 JGI24737J22298_10014454
336 JGI24737J22298_10115075
337 Ga0070683_100131951
338 Ga0070670_100524677
339 Ga0070682_100122313
340 Ga0070682_100304696
341 Ga0068868_100216898
342 Ga0070660_100533252
343 Ga0070692_10829083
344 Ga0070668_100262567
345 Ga0070668_101765551
346 Ga0070674_101602717
347 Ga0070667_100480153
348 Ga0070705_100547916
349 Ga0070663_100281457
350 Ga0070662_100100789
351 Ga0070681_10312868
352 Ga0070699_100864017
353 Ga0070679_100600527
354 Ga0070684_100199204
355 Ga0068855_100451942
356 Ga0068857_100673316
357 Ga0068857_100811562
358 Ga0068856_100251472
359 Ga0068859_100306069
360 Ga0081455_10055955
361 Ga0081539_10042861
362 Ga0075368_10288235
363 Ga0075363_100323158
364 Ga0075362_10180325
365 Ga0068871_100668124
366 Ga0075430_100086179
367 Ga0075434_100602923
368 Ga0097620_100306048
369 Ga0105243_10436490
370 Ga0105241_10579783
371 Ga0105241_10725015
372 Ga0105238_11641892
373 Ga0105249_11146128
374 Ga0105246_10305612
375 Ga0157323_1000396
376 Ga0157319_1001238
377 Ga0157314_1017874
378 Ga0157324_1000948
379 Ga0157315_1014709
380 Ga0157326_1005566
381 Ga0157371_10343507
382 Ga0157370_10552172
383 Ga0163162_11556071
384 Ga0157372_10666977
385 Ga0157377_10258677
386 Ga0157376_11073340
387 Ga0163161_10134483
388 Ga0206356_11302453
389 Ga0206351_10168757
390 Ga0206352_10763204
391 Ga0206350_10132833
392 Ga0206354_11556067
393 Ga0224712_10034957
394 Ga0224712_10265506
395 Ga0207688_10147476
396 Ga0207647_10168809
397 Ga0207671_10205848
398 Ga0207662_10106876
399 Ga0207649_10790050
400 Ga0207687_11105365
401 Ga0207644_10431394
402 Ga0207706_10093317
403 Ga0207669_10510358
404 Ga0207661_10327614
405 Ga0207661_10444341
406 Ga0207661_11420327
407 Ga0207667_10322384
408 Ga0207668_10075196
409 Ga0207668_10665301
410 Ga0207668_11651071
411 Ga0207658_10461842
412 Ga0207658_10496539
413 Ga0207658_10677919
414 Ga0207677_10309669
415 Ga0207639_11296758
416 Ga0207674_10029988
417 Ga0207674_10532262
418 Ga0207698_10513687
419 Ga0207698_10696477
420 Ga0209970_1057378
421 Ga0209998_10121846
422 Ga0307517_10255823
423 Ga0307515_10267907
424 Ga0307512_10084166
425 Ga0314311_1111643
426 Ga0316178_1009907
427 Ga0316180_1128086
428 Ga0316181_1113417
429 Ga0316181_1123035
430 Ga0316182_1385471
431 Ga0307513_10115730
432 Ga0307408_100073559
433 Ga0307508_10379677
434 Ga0307508_10746107
435 Ga0316576_10003593
436 Ga0316578_10012372
437 Ga0307405_10393333
438 Ga0316577_10022330
439 Ga0307413_10102470
440 Ga0307413_10403999
441 Ga0307413_10465724
442 Ga0307410_10284867
443 Ga0307410_10709345
444 Ga0307406_10972249
445 Ga0307407_10234787
446 Ga0307407_10361969
447 Ga0307412_10176585
448 Ga0307412_10952713
449 Ga0307409_100356056
450 Ga0307409_100969999
451 Ga0307409_101476422
452 Ga0307416_100222650
453 Ga0307416_100468765
454 Ga0307416_101187430
455 Ga0307416_101841709
456 Ga0307414_10510356
457 Ga0307414_10931991
458 Ga0307411_10199363
459 Ga0307411_10381330
460 Ga0307415_100501667
461 Ga0307415_100856664
462 Ga0316585_10004851
463 Ga0316580_10015364
464 Ga0316596_1104916
465 Ga0373938_0135676
466 Ga0373952_0220071
467 Ga0373941_0063214
468 Ga0373954_0278021
469 Ga0373956_0000984
470 Ga0316574_0193758
471 Ga0373931_0107534
472 Ga0316582_0037539
473 Ga0395900_1053877
474 Ga0395898_0423911
475 Ga0395898_0511685
476 Ga0395905_0228981
477 Ga0395901_0596346
478 Ga0436362_0259477
479 Ga0439438_017991
480 Ga0439461_0165012
481 Ga0439465_0174293
482 Ga0451795_1242544
483 Ga0451800_0320896
484 Ga0451802_0060820
485 Ga0451802_0760563
486 Ga0451837_0458295
487 Ga0451843_1031454
488 Ga0439446_0076498
489 Ga0451577_0102302
490 Ga0466969_0089294
491 Ga0466972_0047317
492 Ga0466972_0306277
493 Ga0466965_0026295
494 Ga0466965_0136163
495 Ga0466965_0328756
496 Ga0466966_0055464
497 Ga0466966_0280558
498 Ga0466966_0517679
499 Ga0466961_0350812
500 Ga0466961_0693022
501 Ga0466964_0070091
502 Ga0466964_0105145
503 Ga0466964_0415806
504 Ga0466971_0506502
505 Ga0466970_0025386
506 Ga0466970_0066417
507 Ga0466970_0088382
508 Ga0466970_0099115
509 Ga0466970_0103675
510 Ga0466970_0129063
511 Ga0466970_0288205
512 Ga0466970_0409647
513 Ga0466970_0434331
514 Ga0466957_0018498
515 Ga0466957_0216314
516 Ga0466957_0562391
517 Ga0466960_0122354
518 Ga0466960_0233976
519 Ga0466960_0300222
520 Ga0466960_0399461
521 Ga0466960_0461270
522 Ga0466960_0662715
523 Ga0466959_0122880
524 Ga0466959_0198708
525 Ga0466958_0476039
526 Ga0466967_0044372
527 Ga0466967_0127443
528 Ga0466967_0219989
529 Ga0466967_0284498
530 Ga0466967_0313024
531 Ga0466967_0414338
532 Ga0495650_0050551
533 Ga0495639_0387616
534 Ga0495664_0137461
535 Ga0495596_0288698
536 Ga0495658_0488790
537 Ga0496100_0082400
538 Ga0496100_0430544
539 Ga0496101_0890267
540 Ga0496102_0046347
541 Ga0496103_0117621
542 Ga0496104_0166964
543 Ga0496104_0213807
544 Ga0496104_0417424
545 Ga0496105_0351886
546 Ga0496106_0041190
547 Ga0496107_0168561
548 Ga0496107_0177089
549 Ga0496108_0497249
550 Ga0496108_1090005
551 Ga0496109_0025461
552 Ga0496109_0244217
553 Ga0496109_0283568
554 Ga0496109_0508769
555 Ga0496110_0343243
556 Ga0496111_0253645
557 Ga0496111_0323646
558 Ga0496113_0123446
559 Ga0496113_0314017
560 Ga0496114_0135597
561 Ga0496114_0224311
562 Ga0496114_0294993
563 Ga0496114_0664743
564 Ga0496115_0259379
565 Ga0496115_0302067
566 Ga0496117_0092672
567 Ga0496124_0022333
568 Ga0496124_0072562
569 Ga0501317_017776
570 Ga0501317_073729
571 Ga0501318_029569
572 Ga0501031_0231796
573 Ga0501031_0385706
574 Ga0501032_0009653
575 Ga0501033_0009731
576 Ga0501033_0124769
577 Ga0501033_0316796
578 Ga0501033_0491023
579 Ga0501034_0043346
580 Ga0501034_0044842
581 Ga0501036_0007694
582 Ga0501036_0105154
583 Ga0501036_0349226
584 Ga0501037_0000627
585 Ga0501037_0020081
586 Ga0501038_0005560
587 Ga0501038_0005868
588 Ga0501038_0066148
589 Ga0501038_1003264
590 Ga0501039_0016788
591 Ga0501041_0695354
592 Ga0501041_0743993
593 Ga0501042_0016896
594 Ga0501042_0331768
595 Ga0501042_0519654
596 Ga0501043_0094985
597 Ga0501043_0248905
598 Ga0501043_0489358
599 Ga0501046_0000919
600 Ga0501046_0003412
601 Ga0501046_0139783
602 Ga0501047_0028832
603 Ga0501047_0097111
604 Ga0501047_0714189
605 Ga0501048_0002214
606 Ga0501048_0206445
607 Ga0501048_0474205
608 Ga0501067_0175755
609 Ga0501067_0403922
610 Ga0501068_0108058
611 Ga0501068_0388809
612 Ga0501068_0721989
613 Ga0501070_0064094
614 Ga0501071_0370888
615 Ga0501071_0521291
616 Ga0501071_0662286
617 Ga0501071_1015013
618 Ga0501073_0163648
619 Ga0501074_0110488
620 Ga0501075_0928436
621 Ga0501076_0943667
622 Ga0501243_022651
623 Ga0501079_0241671
624 Ga0501079_0830495
625 Ga0501079_1001831
626 Ga0501080_0437540
627 Ga0501081_0457325
628 Ga0501035_0017166
629 Ga0501044_0016885
630 Ga0501044_0109934
631 Ga0501044_0505062
632 Ga0501045_0134090
633 Ga0501045_0320100
634 nmdc:mga0yw44_110045_c1
635 nmdc:mga0n895_1151463_c1
636 Ga0495601_0157806
637 Ga0495601_0259846
638 Ga0495595_0069270
639 Ga0495595_0244549
640 Ga0495619_0087296
641 Ga0500556_0000443
642 Ga0500593_000103
643 Ga0500573_0157235
644 Ga0501084_0242371
645 Ga0587107_029735
646 Ga0466962_0082173
647 Ga0530510_0337908
648 2643827534
649 2644533636
650 2644537797
651 2774394677
652 2809194479
653 2812349228
654 2816428131
655 2837273142
656 2891973061
657 2904433170
658 8053950258

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22811

NrdR-like_N

Transcriptional repressor NrdR-like, N-terminal domain

1

42

0.99

PF03477

ATP-cone

ATP cone domain

46

119

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xlr-assembly2.cif.gz_A joint-functions of protein residues and nadp(h) in oxygen-activation by flavin-containing monooxygenase: asn78asp mutant 0.7886 10 45
5olk-assembly1.cif.gz_B crystal structure of the atp-cone-containing nrdb from leeuwenhoekiella blandensis 0.7821 51 134
5im3-assembly1.cif.gz_A crystal structure of the class i ribonucleotide reductase from pseudomonas aeruginosa in complex with datp 0.7551 50 143
3hnc-assembly1.cif.gz_B crystal structure of human ribonucleotide reductase 1 bound to the effector ttp 0.7497 50 129
2vq7-assembly2.cif.gz_C bacterial flavin-containing monooxygenase in complex with nadp: native data 0.7413 10 45
ID Description Score Start End Superfamily
af_P9WIZ1_46_134_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9801 50 138 1.10.10.10
af_P9WIZ1_46_134_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9694 50 138 1.10.10.10
af_Q6NWH1_354_507_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8627 7 50 2.130.10.10
af_P0A8D0_49_137_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8426 51 137 1.10.10.10
af_Q2FXP3_49_137_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8412 50 138 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A4D4LDM2-F1-model_v4 Transcriptional repressor NrdR 0.9683 52 151 GO:0003677
GO:0005524
GO:0008270
GO:0045892
AF-A0A380MB30-F1-model_v4 deleted 0.9579 52 149
AF-A0A2A9D0K7-F1-model_v4 Transcriptional repressor NrdR 0.9536 1 151 GO:0003677
GO:0005524
GO:0008270
GO:0045892
AF-A0A7W7M3B1-F1-model_v4 Transcriptional repressor NrdR 0.953 48 151 GO:0003677
GO:0005524
GO:0008270
GO:0045892
AF-S3ZLE7-F1-model_v4 Transcriptional repressor NrdR 0.9528 46 156 GO:0003677
GO:0005524
GO:0008270
GO:0045892

Map