F409848
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 329 | 186 | 328 | 328 |
Family's Representative Sequence
| Representative Sequence | 3300049570|Ga0501033_0026584|Ga0501033_0026584_1347_2438 |
| Length | 363 |
| Sequence | MAAGLNGAATRETLRPMSDTPILPPVRDLPPEARRHIFDRQPAEGPLAGLAGSPPPAPQWFEDALAQKPERRFVSVGGARIHYLRWGDPSKPGLLLIHGNAAHAWWWSFIAPFLAQDYHVAAMDLSGMGDSLWRAGQAGYSMALFAEEAMAVLEDAGMFEAPTPPVIVAHSFGGFVTMKTAADHGERLTGIVIIDSPINPPVRTEGGLGGDPVDHKPHPHKVYPSIASALARFRLMPPQPCENLFLLDWVARKSLKEVAGPKGEPGFTWKFDPAIWRHFSIGDTAELLKRTRCRVAVFRGEHSALMPPGAGDYVFDLLGRAAPVVEIPQARHHVMLDQPLALVAALRALLADWAHSVATRRRV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 30 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 33 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 34 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 35 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 36 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 37 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 38 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 39 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 41 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 42 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 43 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 44 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 45 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 47 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 61 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 63 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 64 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 65 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 66 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 105 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 106 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 107 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 108 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 109 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 110 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 111 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 112 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 113 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 114 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 115 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 116 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 117 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 118 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 119 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 120 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 121 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 122 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 123 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 124 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 125 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 126 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 127 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 128 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 129 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 130 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 131 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 132 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 133 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 134 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 135 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 136 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 137 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 138 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 139 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 140 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 141 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 142 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 143 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 148 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 149 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 150 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 151 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 152 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 153 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 154 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 155 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 156 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 157 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 158 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 159 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 161 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 183 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 184 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 185 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.7 |
| Metatranscriptomes | 0 |
| Isolates | 0.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.52 |
| Nodule | 0 |
| Rhizoplane | 4.86 |
| Rhizosphere | 90.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10022937 | 3300003320 | Bacteria | 9883 |
| 2 | Ga0070658_10098700 | 3300005327 | Bacteria | 2413 |
| 3 | Ga0070670_100103389 | 3300005331 | Bacteria | 2454 |
| 4 | Ga0070666_10000362 | 3300005335 | Bacteria | 28643 |
| 5 | Ga0070666_10007703 | 3300005335 | Bacteria | 6648 |
| 6 | Ga0070680_100001296 | 3300005336 | Bacteria | 18096 |
| 7 | Ga0070660_100009488 | 3300005339 | Bacteria | 6847 |
| 8 | Ga0070689_100189728 | 3300005340 | Unclassified | 1673 |
| 9 | Ga0070691_10001684 | 3300005341 | Bacteria | 9590 |
| 10 | Ga0070691_10045777 | 3300005341 | Bacteria | 2076 |
| 11 | Ga0070691_10133973 | 3300005341 | Bacteria | 1257 |
| 12 | Ga0070661_100003574 | 3300005344 | Bacteria | 10700 |
| 13 | Ga0070661_100058522 | 3300005344 | Bacteria | 2824 |
| 14 | Ga0070669_100000711 | 3300005353 | Bacteria | 24418 |
| 15 | Ga0070671_100000074 | 3300005355 | Bacteria | 64319 |
| 16 | Ga0070688_100081648 | 3300005365 | Bacteria | 2094 |
| 17 | Ga0070659_100000316 | 3300005366 | Bacteria | 37463 |
| 18 | Ga0070659_100042190 | 3300005366 | Unclassified | 3566 |
| 19 | Ga0070667_100003604 | 3300005367 | Bacteria | 13171 |
| 20 | Ga0070709_10001248 | 3300005434 | Bacteria | 13908 |
| 21 | Ga0070714_100070589 | 3300005435 | Bacteria | 3019 |
| 22 | Ga0070714_100101693 | 3300005435 | Bacteria | 2533 |
| 23 | Ga0070714_100204579 | 3300005435 | Bacteria | 1807 |
| 24 | Ga0070713_100000002 | 3300005436 | Bacteria | 245989 |
| 25 | Ga0070713_100018089 | 3300005436 | Bacteria | 5352 |
| 26 | Ga0070713_100185525 | 3300005436 | Bacteria | 1872 |
| 27 | Ga0070711_100037971 | 3300005439 | Bacteria | 3234 |
| 28 | Ga0070711_100051457 | 3300005439 | Bacteria | 2829 |
| 29 | Ga0070705_100100669 | 3300005440 | Bacteria | 1824 |
| 30 | Ga0070708_100219478 | 3300005445 | Bacteria | 1783 |
| 31 | Ga0070681_10000003 | 3300005458 | Bacteria | 252785 |
| 32 | Ga0070681_10007760 | 3300005458 | Bacteria | 10491 |
| 33 | Ga0070681_10168357 | 3300005458 | Bacteria | 2113 |
| 34 | Ga0070679_100000756 | 3300005530 | Bacteria | 27999 |
| 35 | Ga0070679_100145165 | 3300005530 | Bacteria | 2351 |
| 36 | Ga0068853_100003014 | 3300005539 | Bacteria | 12860 |
| 37 | Ga0068853_100004228 | 3300005539 | Bacteria | 11085 |
| 38 | Ga0068853_100274062 | 3300005539 | Bacteria | 1554 |
| 39 | Ga0070686_100146107 | 3300005544 | Unclassified | 1651 |
| 40 | Ga0070693_100011699 | 3300005547 | Bacteria | 4424 |
| 41 | Ga0070693_100032119 | 3300005547 | Bacteria | 2884 |
| 42 | Ga0070665_100000221 | 3300005548 | Bacteria | 95402 |
| 43 | Ga0070665_100000362 | 3300005548 | Bacteria | 67720 |
| 44 | Ga0068855_100000006 | 3300005563 | Bacteria | 298092 |
| 45 | Ga0068855_100023239 | 3300005563 | Bacteria | 7426 |
| 46 | Ga0068855_100055562 | 3300005563 | Bacteria | 4650 |
| 47 | Ga0068855_100085643 | 3300005563 | Bacteria | 3645 |
| 48 | Ga0068857_100000722 | 3300005577 | Bacteria | 24631 |
| 49 | Ga0068854_100056272 | 3300005578 | Bacteria | 2834 |
| 50 | Ga0068854_100219578 | 3300005578 | Bacteria | 1503 |
| 51 | Ga0068856_100000312 | 3300005614 | Bacteria | 53339 |
| 52 | Ga0068856_100006510 | 3300005614 | Bacteria | 11454 |
| 53 | Ga0068852_100103808 | 3300005616 | Bacteria | 2571 |
| 54 | Ga0068859_100373764 | 3300005617 | Bacteria | 1521 |
| 55 | Ga0068864_100057001 | 3300005618 | Bacteria | 3376 |
| 56 | Ga0068863_100000530 | 3300005841 | Bacteria | 38943 |
| 57 | Ga0068858_100049085 | 3300005842 | Bacteria | 3909 |
| 58 | Ga0068858_100115631 | 3300005842 | Bacteria | 2507 |
| 59 | Ga0068860_100000035 | 3300005843 | Bacteria | 238993 |
| 60 | Ga0068860_100009664 | 3300005843 | Bacteria | 9579 |
| 61 | Ga0068862_100000072 | 3300005844 | Bacteria | 119705 |
| 62 | Ga0068862_100048512 | 3300005844 | Bacteria | 3625 |
| 63 | Ga0070712_100000018 | 3300006175 | Bacteria | 102923 |
| 64 | Ga0070712_100000045 | 3300006175 | Bacteria | 66187 |
| 65 | Ga0075362_10023750 | 3300006177 | Bacteria | 2596 |
| 66 | Ga0075366_10020884 | 3300006195 | Bacteria | 3804 |
| 67 | Ga0075434_100063324 | 3300006871 | Bacteria | 3681 |
| 68 | Ga0068865_100001247 | 3300006881 | Bacteria | 14804 |
| 69 | Ga0075436_100000255 | 3300006914 | Bacteria | 33272 |
| 70 | Ga0075436_100016414 | 3300006914 | Bacteria | 5067 |
| 71 | Ga0097620_100373732 | 3300006931 | Bacteria | 1521 |
| 72 | Ga0075435_100050659 | 3300007076 | Bacteria | 3342 |
| 73 | Ga0105240_10000357 | 3300009093 | Bacteria | 85936 |
| 74 | Ga0105240_10010445 | 3300009093 | Bacteria | 13045 |
| 75 | Ga0105240_10016205 | 3300009093 | Bacteria | 10101 |
| 76 | Ga0105240_10054250 | 3300009093 | Bacteria | 5024 |
| 77 | Ga0105240_10157420 | 3300009093 | Bacteria | 2701 |
| 78 | Ga0105240_10185794 | 3300009093 | Bacteria | 2448 |
| 79 | Ga0105240_10283651 | 3300009093 | Bacteria | 1901 |
| 80 | Ga0105241_10196737 | 3300009174 | Bacteria | 1681 |
| 81 | Ga0105248_10000001 | 3300009177 | Bacteria | 1881304 |
| 82 | Ga0105248_10000097 | 3300009177 | Bacteria | 97424 |
| 83 | Ga0105248_10152763 | 3300009177 | Bacteria | 2605 |
| 84 | Ga0105248_10537462 | 3300009177 | Unclassified | 1318 |
| 85 | Ga0105237_10001328 | 3300009545 | Bacteria | 32811 |
| 86 | Ga0105238_10001436 | 3300009551 | Bacteria | 23918 |
| 87 | Ga0105238_10027856 | 3300009551 | Bacteria | 5758 |
| 88 | Ga0105238_10209575 | 3300009551 | Bacteria | 1925 |
| 89 | Ga0105238_10416072 | 3300009551 | Bacteria | 1338 |
| 90 | Ga0105238_10441399 | 3300009551 | Unclassified | 1298 |
| 91 | Ga0105239_10002644 | 3300010375 | Bacteria | 22618 |
| 92 | Ga0105239_10067340 | 3300010375 | Bacteria | 3934 |
| 93 | Ga0105239_10121022 | 3300010375 | Bacteria | 2907 |
| 94 | Ga0105239_10134072 | 3300010375 | Bacteria | 2756 |
| 95 | Ga0157373_10005154 | 3300013100 | Bacteria | 9825 |
| 96 | Ga0157373_10042659 | 3300013100 | Unclassified | 3242 |
| 97 | Ga0157371_10060983 | 3300013102 | Bacteria | 2674 |
| 98 | Ga0157370_10005953 | 3300013104 | Bacteria | 13576 |
| 99 | Ga0157370_10064278 | 3300013104 | Bacteria | 3474 |
| 100 | Ga0157369_10001118 | 3300013105 | Bacteria | 33541 |
| 101 | Ga0157369_10041451 | 3300013105 | Bacteria | 5025 |
| 102 | Ga0163162_10321489 | 3300013306 | Bacteria | 1680 |
| 103 | Ga0163162_10621521 | 3300013306 | Unclassified | 1205 |
| 104 | Ga0157372_10041078 | 3300013307 | Bacteria | 5113 |
| 105 | Ga0157372_10288020 | 3300013307 | Bacteria | 1910 |
| 106 | Ga0163163_10318523 | 3300014325 | Bacteria | 1609 |
| 107 | Ga0182008_10153804 | 3300014497 | Bacteria | 1155 |
| 108 | Ga0157379_10010218 | 3300014968 | Bacteria | 8176 |
| 109 | Ga0157379_10010346 | 3300014968 | Bacteria | 8126 |
| 110 | Ga0157379_10010756 | 3300014968 | Bacteria | 7975 |
| 111 | Ga0213872_10043055 | 3300021361 | Bacteria | 2058 |
| 112 | Ga0213874_10003497 | 3300021377 | Bacteria | 3491 |
| 113 | Ga0213876_10000727 | 3300021384 | Bacteria | 22933 |
| 114 | Ga0213875_10001099 | 3300021388 | Bacteria | 18747 |
| 115 | Ga0207680_10056601 | 3300025903 | Bacteria | 2369 |
| 116 | Ga0207699_10000133 | 3300025906 | Bacteria | 50958 |
| 117 | Ga0207705_10000159 | 3300025909 | Bacteria | 72293 |
| 118 | Ga0207654_10132226 | 3300025911 | Bacteria | 1581 |
| 119 | Ga0207707_10000001 | 3300025912 | Bacteria | 1212482 |
| 120 | Ga0207707_10078856 | 3300025912 | Bacteria | 2876 |
| 121 | Ga0207707_10132271 | 3300025912 | Bacteria | 2182 |
| 122 | Ga0207695_10000004 | 3300025913 | Bacteria | 1288665 |
| 123 | Ga0207695_10007642 | 3300025913 | Bacteria | 13697 |
| 124 | Ga0207695_10048189 | 3300025913 | Bacteria | 4502 |
| 125 | Ga0207695_10243695 | 3300025913 | Unclassified | 1698 |
| 126 | Ga0207671_10047486 | 3300025914 | Bacteria | 3178 |
| 127 | Ga0207693_10000035 | 3300025915 | Bacteria | 110713 |
| 128 | Ga0207693_10000145 | 3300025915 | Bacteria | 65383 |
| 129 | Ga0207693_10092452 | 3300025915 | Bacteria | 2371 |
| 130 | Ga0207663_10042071 | 3300025916 | Unclassified | 2789 |
| 131 | Ga0207663_10049784 | 3300025916 | Bacteria | 2601 |
| 132 | Ga0207660_10000806 | 3300025917 | Bacteria | 20699 |
| 133 | Ga0207660_10056778 | 3300025917 | Bacteria | 2802 |
| 134 | Ga0207657_10007294 | 3300025919 | Bacteria | 11342 |
| 135 | Ga0207649_10000790 | 3300025920 | Bacteria | 20471 |
| 136 | Ga0207649_10006099 | 3300025920 | Bacteria | 6542 |
| 137 | Ga0207652_10000094 | 3300025921 | Bacteria | 98207 |
| 138 | Ga0207652_10001571 | 3300025921 | Bacteria | 20110 |
| 139 | Ga0207681_10000137 | 3300025923 | Bacteria | 60426 |
| 140 | Ga0207694_10000014 | 3300025924 | Bacteria | 374435 |
| 141 | Ga0207700_10000037 | 3300025928 | Bacteria | 115488 |
| 142 | Ga0207700_10164323 | 3300025928 | Unclassified | 1846 |
| 143 | Ga0207700_10230014 | 3300025928 | Bacteria | 1576 |
| 144 | Ga0207664_10020187 | 3300025929 | Bacteria | 4935 |
| 145 | Ga0207664_10059566 | 3300025929 | Bacteria | 3041 |
| 146 | Ga0207664_10086365 | 3300025929 | Bacteria | 2563 |
| 147 | Ga0207644_10000053 | 3300025931 | Bacteria | 90831 |
| 148 | Ga0207690_10069660 | 3300025932 | Bacteria | 2421 |
| 149 | Ga0207686_10032081 | 3300025934 | Bacteria | 3124 |
| 150 | Ga0207704_10007775 | 3300025938 | Bacteria | 5087 |
| 151 | Ga0207711_10000001 | 3300025941 | Bacteria | 1325674 |
| 152 | Ga0207711_10008527 | 3300025941 | Bacteria | 8574 |
| 153 | Ga0207711_10036752 | 3300025941 | Bacteria | 4157 |
| 154 | Ga0207667_10000051 | 3300025949 | Bacteria | 233836 |
| 155 | Ga0207651_10255129 | 3300025960 | Bacteria | 1437 |
| 156 | Ga0207668_10126677 | 3300025972 | Bacteria | 1943 |
| 157 | Ga0207640_10073938 | 3300025981 | Bacteria | 2305 |
| 158 | Ga0207703_10151665 | 3300026035 | Unclassified | 2022 |
| 159 | Ga0207703_10589864 | 3300026035 | Unclassified | 1050 |
| 160 | Ga0207639_10002016 | 3300026041 | Bacteria | 13684 |
| 161 | Ga0207639_10006879 | 3300026041 | Bacteria | 7747 |
| 162 | Ga0207639_10180680 | 3300026041 | Bacteria | 1794 |
| 163 | Ga0207639_10241784 | 3300026041 | Bacteria | 1570 |
| 164 | Ga0207702_10000007 | 3300026078 | Bacteria | 332551 |
| 165 | Ga0207702_10000012 | 3300026078 | Bacteria | 269770 |
| 166 | Ga0207702_10002115 | 3300026078 | Bacteria | 19134 |
| 167 | Ga0207641_10001429 | 3300026088 | Bacteria | 23483 |
| 168 | Ga0207648_10065881 | 3300026089 | Bacteria | 3158 |
| 169 | Ga0207676_10028760 | 3300026095 | Bacteria | 4156 |
| 170 | Ga0207674_10000107 | 3300026116 | Bacteria | 95635 |
| 171 | Ga0207675_100321145 | 3300026118 | Bacteria | 1511 |
| 172 | Ga0207698_10085583 | 3300026142 | Bacteria | 2560 |
| 173 | Ga0268266_10000005 | 3300028379 | Bacteria | 1448194 |
| 174 | Ga0268266_10001938 | 3300028379 | Bacteria | 23266 |
| 175 | Ga0268265_10000083 | 3300028380 | Bacteria | 120015 |
| 176 | Ga0268265_10199232 | 3300028380 | Bacteria | 1736 |
| 177 | Ga0268264_10000031 | 3300028381 | Bacteria | 409525 |
| 178 | Ga0268264_10041458 | 3300028381 | Bacteria | 3808 |
| 179 | Ga0268264_10292192 | 3300028381 | Bacteria | 1531 |
| 180 | Ga0265334_10000111 | 3300028573 | Bacteria | 53728 |
| 181 | Ga0265334_10034054 | 3300028573 | Bacteria | 2023 |
| 182 | Ga0265318_10000107 | 3300028577 | Bacteria | 77965 |
| 183 | Ga0265338_10000006 | 3300028800 | Bacteria | 570804 |
| 184 | Ga0265338_10013350 | 3300028800 | Bacteria | 9280 |
| 185 | Ga0265338_10030250 | 3300028800 | Bacteria | 5341 |
| 186 | Ga0265338_10033503 | 3300028800 | Bacteria | 4982 |
| 187 | Ga0265338_10198437 | 3300028800 | Bacteria | 1515 |
| 188 | Ga0265324_10035583 | 3300029957 | Bacteria | 1734 |
| 189 | Ga0265330_10005616 | 3300031235 | Bacteria | 6241 |
| 190 | Ga0265330_10021582 | 3300031235 | Bacteria | 2937 |
| 191 | Ga0265332_10070504 | 3300031238 | Bacteria | 1489 |
| 192 | Ga0265320_10001310 | 3300031240 | Bacteria | 18189 |
| 193 | Ga0265325_10000003 | 3300031241 | Bacteria | 370490 |
| 194 | Ga0265325_10000079 | 3300031241 | Bacteria | 67833 |
| 195 | Ga0265325_10001606 | 3300031241 | Bacteria | 15753 |
| 196 | Ga0265329_10018429 | 3300031242 | Bacteria | 2387 |
| 197 | Ga0265340_10000139 | 3300031247 | Bacteria | 36402 |
| 198 | Ga0265340_10000245 | 3300031247 | Bacteria | 28170 |
| 199 | Ga0265340_10001587 | 3300031247 | Bacteria | 13035 |
| 200 | Ga0265340_10004967 | 3300031247 | Bacteria | 7395 |
| 201 | Ga0265340_10032513 | 3300031247 | Bacteria | 2604 |
| 202 | Ga0265339_10000132 | 3300031249 | Bacteria | 61274 |
| 203 | Ga0265339_10009598 | 3300031249 | Bacteria | 6064 |
| 204 | Ga0265339_10015987 | 3300031249 | Bacteria | 4483 |
| 205 | Ga0265331_10000009 | 3300031250 | Bacteria | 314950 |
| 206 | Ga0265331_10000193 | 3300031250 | Bacteria | 75140 |
| 207 | Ga0265331_10001823 | 3300031250 | Bacteria | 15102 |
| 208 | Ga0265331_10010979 | 3300031250 | Bacteria | 4973 |
| 209 | Ga0265327_10000027 | 3300031251 | Bacteria | 364541 |
| 210 | Ga0265327_10000036 | 3300031251 | Bacteria | 312827 |
| 211 | Ga0265316_10003200 | 3300031344 | Bacteria | 16640 |
| 212 | Ga0265316_10062242 | 3300031344 | Bacteria | 2896 |
| 213 | Ga0307513_10008428 | 3300031456 | Bacteria | 13201 |
| 214 | Ga0265313_10001937 | 3300031595 | Bacteria | 18726 |
| 215 | Ga0265314_10003029 | 3300031711 | Bacteria | 16599 |
| 216 | Ga0265314_10005220 | 3300031711 | Bacteria | 11783 |
| 217 | Ga0265314_10005424 | 3300031711 | Bacteria | 11519 |
| 218 | Ga0265314_10031367 | 3300031711 | Bacteria | 3924 |
| 219 | Ga0265314_10079180 | 3300031711 | Bacteria | 2173 |
| 220 | Ga0265342_10009827 | 3300031712 | Bacteria | 6693 |
| 221 | Ga0265342_10032612 | 3300031712 | Bacteria | 3211 |
| 222 | Ga0265342_10041560 | 3300031712 | Bacteria | 2783 |
| 223 | Ga0307516_10000001 | 3300031730 | Bacteria | 510338 |
| 224 | Ga0307516_10012000 | 3300031730 | Bacteria | 9366 |
| 225 | Ga0373936_0015333 | 3300035113 | Bacteria | 2937 |
| 226 | Ga0373936_0015953 | 3300035113 | Bacteria | 2883 |
| 227 | Ga0373954_0088410 | 3300035118 | Bacteria | 1486 |
| 228 | Ga0373957_0076071 | 3300035120 | Bacteria | 1320 |
| 229 | Ga0373955_0043475 | 3300035172 | Bacteria | 2417 |
| 230 | Ga0373931_0017047 | 3300035691 | Bacteria | 3584 |
| 231 | Ga0373935_0089323 | 3300035692 | Bacteria | 2015 |
| 232 | Ga0373927_0215252 | 3300035695 | Unclassified | 1262 |
| 233 | Ga0373933_0069008 | 3300035724 | Bacteria | 2148 |
| 234 | Ga0373937_0008234 | 3300036401 | Bacteria | 9052 |
| 235 | Ga0373937_0016020 | 3300036401 | Bacteria | 6648 |
| 236 | Ga0373937_0378281 | 3300036401 | Unclassified | 1343 |
| 237 | Ga0373937_0393466 | 3300036401 | Bacteria | 1315 |
| 238 | Ga0373925_0008822 | 3300037068 | Bacteria | 7344 |
| 239 | Ga0373925_0281970 | 3300037068 | Bacteria | 1338 |
| 240 | Ga0395899_0000223 | 3300037312 | Bacteria | 77606 |
| 241 | Ga0395900_0000008 | 3300037418 | Bacteria | 480459 |
| 242 | Ga0395900_0019152 | 3300037418 | Bacteria | 6980 |
| 243 | Ga0395905_0283813 | 3300037471 | Bacteria | 1542 |
| 244 | Ga0395905_0304149 | 3300037471 | Bacteria | 1482 |
| 245 | Ga0395905_0337790 | 3300037471 | Bacteria | 1397 |
| 246 | Ga0436364_0206190 | 3300037853 | Bacteria | 18748 |
| 247 | Ga0395901_0000008 | 3300038443 | Bacteria | 495962 |
| 248 | Ga0436365_0983540 | 3300039437 | Bacteria | 14300 |
| 249 | Ga0436365_1168772 | 3300039437 | Bacteria | 186262 |
| 250 | Ga0436361_0767272 | 3300039447 | Bacteria | 33690 |
| 251 | Ga0436363_1600004 | 3300039450 | Bacteria | 3653 |
| 252 | Ga0451577_0232065 | 3300042876 | Bacteria | 1669 |
| 253 | Ga0451576_0027987 | 3300045051 | Bacteria | 6044 |
| 254 | Ga0495651_0118207 | 3300046462 | Bacteria | 1951 |
| 255 | Ga0495645_0069803 | 3300046543 | Bacteria | 2536 |
| 256 | Ga0495672_0029643 | 3300047320 | Bacteria | 3443 |
| 257 | Ga0495675_0212047 | 3300047444 | Unclassified | 1175 |
| 258 | Ga0496100_0288772 | 3300048903 | Unclassified | 1225 |
| 259 | Ga0496101_0056164 | 3300048904 | Bacteria | 2846 |
| 260 | Ga0496102_0024307 | 3300048905 | Bacteria | 5385 |
| 261 | Ga0496103_0021602 | 3300048906 | Bacteria | 3873 |
| 262 | Ga0496104_0233968 | 3300048907 | Unclassified | 1749 |
| 263 | Ga0496104_0412362 | 3300048907 | Bacteria | 1263 |
| 264 | Ga0496105_0180176 | 3300048908 | Bacteria | 1730 |
| 265 | Ga0496106_0003872 | 3300048909 | Bacteria | 11159 |
| 266 | Ga0496107_0000157 | 3300048910 | Bacteria | 34652 |
| 267 | Ga0496107_0071317 | 3300048910 | Bacteria | 2524 |
| 268 | Ga0496107_0159767 | 3300048910 | Bacteria | 1670 |
| 269 | Ga0496111_0063508 | 3300048914 | Bacteria | 2678 |
| 270 | Ga0496112_0008113 | 3300048915 | Bacteria | 9378 |
| 271 | Ga0496112_0114961 | 3300048915 | Bacteria | 2661 |
| 272 | Ga0496113_0005887 | 3300048916 | Bacteria | 7696 |
| 273 | Ga0496115_0063820 | 3300048918 | Bacteria | 2972 |
| 274 | Ga0495682_0009269 | 3300049460 | Bacteria | 3846 |
| 275 | Ga0501031_0031029 | 3300049568 | Bacteria | 3487 |
| 276 | Ga0501031_0268624 | 3300049568 | Unclassified | 1108 |
| 277 | Ga0501032_0047157 | 3300049569 | Bacteria | 2910 |
| 278 | Ga0501032_0073022 | 3300049569 | Unclassified | 2286 |
| 279 | Ga0501032_0150944 | 3300049569 | Bacteria | 1528 |
| 280 | Ga0501033_0026584 | 3300049570 | Bacteria | 4354 |
| 281 | Ga0501034_0061009 | 3300049571 | Bacteria | 3788 |
| 282 | Ga0501034_0096127 | 3300049571 | Bacteria | 2959 |
| 283 | Ga0501036_0050128 | 3300049572 | Bacteria | 3536 |
| 284 | Ga0501038_0011736 | 3300049574 | Bacteria | 7992 |
| 285 | Ga0501038_0216104 | 3300049574 | Bacteria | 1532 |
| 286 | Ga0501039_0193723 | 3300049575 | Bacteria | 1598 |
| 287 | Ga0501043_0040393 | 3300049579 | Bacteria | 3666 |
| 288 | Ga0501043_0129525 | 3300049579 | Bacteria | 1977 |
| 289 | Ga0501047_0003112 | 3300049581 | Bacteria | 15739 |
| 290 | Ga0501047_0019275 | 3300049581 | Bacteria | 6545 |
| 291 | Ga0501047_0074043 | 3300049581 | Bacteria | 3278 |
| 292 | Ga0501047_0396324 | 3300049581 | Bacteria | 1214 |
| 293 | Ga0501067_0029871 | 3300049583 | Bacteria | 3021 |
| 294 | Ga0501069_0068439 | 3300049585 | Bacteria | 1987 |
| 295 | Ga0501070_0000794 | 3300049586 | Bacteria | 28669 |
| 296 | Ga0501070_0007866 | 3300049586 | Bacteria | 9034 |
| 297 | Ga0501070_0011708 | 3300049586 | Bacteria | 7408 |
| 298 | Ga0501072_0003480 | 3300049588 | Bacteria | 11851 |
| 299 | Ga0501073_0049148 | 3300049589 | Bacteria | 2958 |
| 300 | Ga0501073_0104775 | 3300049589 | Unclassified | 1963 |
| 301 | Ga0501079_0158455 | 3300049741 | Bacteria | 1764 |
| 302 | Ga0501080_0005272 | 3300049742 | Bacteria | 11510 |
| 303 | Ga0501080_0222076 | 3300049742 | Bacteria | 1728 |
| 304 | Ga0501083_0218293 | 3300049744 | Unclassified | 1242 |
| 305 | Ga0501083_0224882 | 3300049744 | Bacteria | 1222 |
| 306 | Ga0501035_0000425 | 3300049822 | Bacteria | 47628 |
| 307 | Ga0501035_0003064 | 3300049822 | Bacteria | 16033 |
| 308 | Ga0501035_0113546 | 3300049822 | Bacteria | 2373 |
| 309 | Ga0501035_0188653 | 3300049822 | Bacteria | 1773 |
| 310 | Ga0501035_0231412 | 3300049822 | Bacteria | 1575 |
| 311 | Ga0501035_0305515 | 3300049822 | Bacteria | 1339 |
| 312 | Ga0501044_0005416 | 3300049823 | Bacteria | 14177 |
| 313 | Ga0501044_0024462 | 3300049823 | Bacteria | 6409 |
| 314 | Ga0501044_0025679 | 3300049823 | Bacteria | 6245 |
| 315 | Ga0501044_0028873 | 3300049823 | Bacteria | 5850 |
| 316 | Ga0501044_0109233 | 3300049823 | Unclassified | 2775 |
| 317 | Ga0501044_0123375 | 3300049823 | Bacteria | 2589 |
| 318 | nmdc:mga0n895_90006_c1 | 3300050512 | Bacteria | 3070 |
| 319 | nmdc:mga0rr50_135537_c1 | 3300050513 | Bacteria | 1976 |
| 320 | nmdc:mga08x19_104222_c1 | 3300050514 | Unclassified | 1885 |
| 321 | nmdc:mga08x19_160812_c1 | 3300050514 | Bacteria | 1525 |
| 322 | nmdc:mga08x19_38_c1 | 3300050514 | Bacteria | 159604 |
| 323 | Ga0500595_011408 | 3300053119 | Bacteria | 3482 |
| 324 | Ga0500564_046824 | 3300053138 | Bacteria | 1983 |
| 325 | Ga0500619_017856 | 3300053154 | Bacteria | 1981 |
| 326 | Ga0501084_0031164 | 3300054114 | Bacteria | 4459 |
| 327 | Ga0501084_0048721 | 3300054114 | Bacteria | 3546 |
| 328 | Ga0501082_0169685 | 3300060353 | Bacteria | 1897 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048908 | Ga0496105_0180176 | Ga0496105_0180176_68_862 | 258 |
| 2 | 3300025960 | Ga0207651_10255129 | Ga0207651_102551292 | 264 |
| 3 | 3300049822 | Ga0501035_0231412 | Ga0501035_0231412_399_1244 | 271 |
| 4 | 3300053119 | Ga0500595_011408 | Ga0500595_011408_970_1824 | 277 |
| 5 | 3300005435 | Ga0070714_100204579 | Ga0070714_1002045792 | 282 |
| 6 | 3300005436 | Ga0070713_100018089 | Ga0070713_1000180892 | 282 |
| 7 | 3300005367 | Ga0070667_100003604 | Ga0070667_1000036049 | 285 |
| 8 | 3300005548 | Ga0070665_100000362 | Ga0070665_10000036229 | 285 |
| 9 | 3300005841 | Ga0068863_100000530 | Ga0068863_10000053011 | 285 |
| 10 | 3300005843 | Ga0068860_100000035 | Ga0068860_100000035101 | 285 |
| 11 | 3300025972 | Ga0207668_10126677 | Ga0207668_101266772 | 285 |
| 12 | 3300026088 | Ga0207641_10001429 | Ga0207641_100014294 | 285 |
| 13 | 3300028379 | Ga0268266_10001938 | Ga0268266_1000193813 | 285 |
| 14 | 3300028381 | Ga0268264_10000031 | Ga0268264_10000031303 | 285 |
| 15 | 3300053138 | Ga0500564_046824 | Ga0500564_046824_724_1611 | 285 |
| 16 | 3300005440 | Ga0070705_100100669 | Ga0070705_1001006692 | 286 |
| 17 | 3300005544 | Ga0070686_100146107 | Ga0070686_1001461072 | 286 |
| 18 | 3300006881 | Ga0068865_100001247 | Ga0068865_1000012476 | 286 |
| 19 | 3300013306 | Ga0163162_10321489 | Ga0163162_103214891 | 286 |
| 20 | 3300025929 | Ga0207664_10020187 | Ga0207664_100201874 | 286 |
| 21 | 3300025938 | Ga0207704_10007775 | Ga0207704_100077756 | 286 |
| 22 | 3300031250 | Ga0265331_10010979 | Ga0265331_100109793 | 286 |
| 23 | 3300031251 | Ga0265327_10000027 | Ga0265327_10000027239 | 286 |
| 24 | 3300045051 | Ga0451576_0027987 | Ga0451576_0027987_2651_3562 | 286 |
| 25 | 3300005445 | Ga0070708_100219478 | Ga0070708_1002194781 | 287 |
| 26 | 3300005365 | Ga0070688_100081648 | Ga0070688_1000816481 | 288 |
| 27 | 3300037471 | Ga0395905_0337790 | Ga0395905_0337790_87_986 | 288 |
| 28 | 3300046543 | Ga0495645_0069803 | Ga0495645_0069803_1170_2213 | 288 |
| 29 | 3300021388 | Ga0213875_10001099 | Ga0213875_1000109917 | 290 |
| 30 | 3300037853 | Ga0436364_0206190 | Ga0436364_0206190_7656_8684 | 290 |
| 31 | 3300005353 | Ga0070669_100000711 | Ga0070669_10000071118 | 291 |
| 32 | 3300025923 | Ga0207681_10000137 | Ga0207681_1000013734 | 291 |
| 33 | 3300005331 | Ga0070670_100103389 | Ga0070670_1001033892 | 292 |
| 34 | 3300005335 | Ga0070666_10007703 | Ga0070666_100077037 | 292 |
| 35 | 3300005340 | Ga0070689_100189728 | Ga0070689_1001897282 | 292 |
| 36 | 3300005355 | Ga0070671_100000074 | Ga0070671_10000007418 | 292 |
| 37 | 3300005617 | Ga0068859_100373764 | Ga0068859_1003737642 | 292 |
| 38 | 3300005618 | Ga0068864_100057001 | Ga0068864_1000570014 | 292 |
| 39 | 3300005842 | Ga0068858_100115631 | Ga0068858_1001156312 | 292 |
| 40 | 3300005843 | Ga0068860_100009664 | Ga0068860_1000096644 | 292 |
| 41 | 3300006931 | Ga0097620_100373732 | Ga0097620_1003737322 | 292 |
| 42 | 3300009177 | Ga0105248_10152763 | Ga0105248_101527632 | 292 |
| 43 | 3300013306 | Ga0163162_10621521 | Ga0163162_106215211 | 292 |
| 44 | 3300025903 | Ga0207680_10056601 | Ga0207680_100566013 | 292 |
| 45 | 3300025931 | Ga0207644_10000053 | Ga0207644_1000005349 | 292 |
| 46 | 3300025941 | Ga0207711_10036752 | Ga0207711_100367522 | 292 |
| 47 | 3300026035 | Ga0207703_10151665 | Ga0207703_101516652 | 292 |
| 48 | 3300026035 | Ga0207703_10589864 | Ga0207703_105898641 | 292 |
| 49 | 3300026095 | Ga0207676_10028760 | Ga0207676_100287602 | 292 |
| 50 | 3300028380 | Ga0268265_10000083 | Ga0268265_1000008398 | 292 |
| 51 | 3300028381 | Ga0268264_10041458 | Ga0268264_100414583 | 292 |
| 52 | 3300048904 | Ga0496101_0056164 | Ga0496101_0056164_407_1309 | 292 |
| 53 | 3300048905 | Ga0496102_0024307 | Ga0496102_0024307_2250_3152 | 292 |
| 54 | 3300048906 | Ga0496103_0021602 | Ga0496103_0021602_1928_2830 | 292 |
| 55 | 3300048907 | Ga0496104_0412362 | Ga0496104_0412362_201_1109 | 292 |
| 56 | 3300048909 | Ga0496106_0003872 | Ga0496106_0003872_6772_7674 | 292 |
| 57 | 3300048910 | Ga0496107_0000157 | Ga0496107_0000157_24657_25559 | 292 |
| 58 | 3300048915 | Ga0496112_0008113 | Ga0496112_0008113_3499_4401 | 292 |
| 59 | 3300048915 | Ga0496112_0114961 | Ga0496112_0114961_176_1072 | 292 |
| 60 | 3300048916 | Ga0496113_0005887 | Ga0496113_0005887_5095_5997 | 292 |
| 61 | 3300025916 | Ga0207663_10042071 | Ga0207663_100420712 | 293 |
| 62 | 3300028573 | Ga0265334_10000111 | Ga0265334_1000011122 | 293 |
| 63 | iso_pu_bacteria | 2939631187 | 2939633544 | 294 |
| 64 | 3300031456 | Ga0307513_10008428 | Ga0307513_1000842812 | 299 |
| 65 | 3300031730 | Ga0307516_10000001 | Ga0307516_10000001382 | 299 |
| 66 | 3300042876 | Ga0451577_0232065 | Ga0451577_0232065_651_1655 | 299 |
| 67 | 3300005327 | Ga0070658_10098700 | Ga0070658_100987002 | 300 |
| 68 | 3300005366 | Ga0070659_100000316 | Ga0070659_10000031619 | 300 |
| 69 | 3300005530 | Ga0070679_100145165 | Ga0070679_1001451651 | 300 |
| 70 | 3300005548 | Ga0070665_100000221 | Ga0070665_10000022174 | 300 |
| 71 | 3300028379 | Ga0268266_10000005 | Ga0268266_1000000573 | 300 |
| 72 | 3300037418 | Ga0395900_0019152 | Ga0395900_0019152_331_1404 | 300 |
| 73 | 3300037471 | Ga0395905_0283813 | Ga0395905_0283813_316_1389 | 300 |
| 74 | 3300037471 | Ga0395905_0304149 | Ga0395905_0304149_402_1457 | 300 |
| 75 | 3300048918 | Ga0496115_0063820 | Ga0496115_0063820_346_1401 | 300 |
| 76 | 3300005341 | Ga0070691_10133973 | Ga0070691_101339731 | 301 |
| 77 | 3300005435 | Ga0070714_100070589 | Ga0070714_1000705893 | 301 |
| 78 | 3300005458 | Ga0070681_10168357 | Ga0070681_101683571 | 301 |
| 79 | 3300006177 | Ga0075362_10023750 | Ga0075362_100237502 | 301 |
| 80 | 3300009093 | Ga0105240_10054250 | Ga0105240_100542506 | 301 |
| 81 | 3300009093 | Ga0105240_10185794 | Ga0105240_101857943 | 301 |
| 82 | 3300025912 | Ga0207707_10132271 | Ga0207707_101322713 | 301 |
| 83 | 3300025913 | Ga0207695_10048189 | Ga0207695_100481892 | 301 |
| 84 | 3300025929 | Ga0207664_10059566 | Ga0207664_100595663 | 301 |
| 85 | 3300035113 | Ga0373936_0015953 | Ga0373936_0015953_533_1576 | 301 |
| 86 | 3300037312 | Ga0395899_0000223 | Ga0395899_0000223_17125_18180 | 301 |
| 87 | 3300037418 | Ga0395900_0000008 | Ga0395900_0000008_187599_188654 | 301 |
| 88 | 3300038443 | Ga0395901_0000008 | Ga0395901_0000008_291812_292867 | 301 |
| 89 | 3300049581 | Ga0501047_0003112 | Ga0501047_0003112_10005_11066 | 301 |
| 90 | 3300026089 | Ga0207648_10065881 | Ga0207648_100658813 | 302 |
| 91 | 3300031235 | Ga0265330_10005616 | Ga0265330_100056162 | 302 |
| 92 | 3300031247 | Ga0265340_10032513 | Ga0265340_100325132 | 302 |
| 93 | 3300031344 | Ga0265316_10062242 | Ga0265316_100622422 | 302 |
| 94 | 3300031595 | Ga0265313_10001937 | Ga0265313_100019373 | 302 |
| 95 | 3300031712 | Ga0265342_10032612 | Ga0265342_100326122 | 302 |
| 96 | 3300006195 | Ga0075366_10020884 | Ga0075366_100208842 | 304 |
| 97 | 3300009177 | Ga0105248_10000097 | Ga0105248_1000009710 | 304 |
| 98 | 3300009551 | Ga0105238_10209575 | Ga0105238_102095752 | 304 |
| 99 | 3300014325 | Ga0163163_10318523 | Ga0163163_103185232 | 304 |
| 100 | 3300025934 | Ga0207686_10032081 | Ga0207686_100320812 | 304 |
| 101 | 3300025941 | Ga0207711_10008527 | Ga0207711_1000852710 | 304 |
| 102 | 3300047320 | Ga0495672_0029643 | Ga0495672_0029643_1351_2394 | 304 |
| 103 | 3300005844 | Ga0068862_100048512 | Ga0068862_1000485122 | 305 |
| 104 | 3300021361 | Ga0213872_10043055 | Ga0213872_100430552 | 305 |
| 105 | 3300039447 | Ga0436361_0767272 | Ga0436361_0767272_16828_17898 | 305 |
| 106 | 3300031247 | Ga0265340_10000139 | Ga0265340_1000013918 | 306 |
| 107 | 3300031344 | Ga0265316_10003200 | Ga0265316_100032007 | 306 |
| 108 | 3300049574 | Ga0501038_0216104 | Ga0501038_0216104_402_1352 | 306 |
| 109 | 3300049823 | Ga0501044_0025679 | Ga0501044_0025679_3187_4137 | 306 |
| 110 | 3300005844 | Ga0068862_100000072 | Ga0068862_10000007221 | 308 |
| 111 | 3300025928 | Ga0207700_10230014 | Ga0207700_102300143 | 308 |
| 112 | 3300031240 | Ga0265320_10001310 | Ga0265320_100013104 | 308 |
| 113 | 3300026118 | Ga0207675_100321145 | Ga0207675_1003211451 | 310 |
| 114 | 3300028380 | Ga0268265_10199232 | Ga0268265_101992322 | 310 |
| 115 | 3300028800 | Ga0265338_10030250 | Ga0265338_100302505 | 310 |
| 116 | 3300028800 | Ga0265338_10033503 | Ga0265338_100335034 | 310 |
| 117 | 3300031247 | Ga0265340_10004967 | Ga0265340_100049675 | 310 |
| 118 | 3300031711 | Ga0265314_10031367 | Ga0265314_100313672 | 310 |
| 119 | 3300028800 | Ga0265338_10013350 | Ga0265338_100133506 | 311 |
| 120 | 3300031235 | Ga0265330_10021582 | Ga0265330_100215822 | 311 |
| 121 | 3300031241 | Ga0265325_10001606 | Ga0265325_1000160615 | 311 |
| 122 | 3300031247 | Ga0265340_10001587 | Ga0265340_1000158713 | 311 |
| 123 | 3300031249 | Ga0265339_10015987 | Ga0265339_100159874 | 311 |
| 124 | 3300031711 | Ga0265314_10005424 | Ga0265314_100054249 | 311 |
| 125 | 3300031712 | Ga0265342_10009827 | Ga0265342_100098274 | 311 |
| 126 | 3300028800 | Ga0265338_10198437 | Ga0265338_101984372 | 312 |
| 127 | 3300005335 | Ga0070666_10000362 | Ga0070666_1000036217 | 313 |
| 128 | 3300005434 | Ga0070709_10001248 | Ga0070709_100012485 | 313 |
| 129 | 3300005436 | Ga0070713_100000002 | Ga0070713_10000000242 | 313 |
| 130 | 3300005563 | Ga0068855_100055562 | Ga0068855_1000555621 | 313 |
| 131 | 3300005614 | Ga0068856_100000312 | Ga0068856_10000031216 | 313 |
| 132 | 3300006175 | Ga0070712_100000045 | Ga0070712_10000004532 | 313 |
| 133 | 3300006871 | Ga0075434_100063324 | Ga0075434_1000633243 | 313 |
| 134 | 3300006914 | Ga0075436_100000255 | Ga0075436_10000025523 | 313 |
| 135 | 3300025906 | Ga0207699_10000133 | Ga0207699_1000013316 | 313 |
| 136 | 3300025915 | Ga0207693_10000035 | Ga0207693_1000003595 | 313 |
| 137 | 3300025916 | Ga0207663_10049784 | Ga0207663_100497841 | 313 |
| 138 | 3300025928 | Ga0207700_10000037 | Ga0207700_1000003726 | 313 |
| 139 | 3300025929 | Ga0207664_10086365 | Ga0207664_100863653 | 313 |
| 140 | 3300026078 | Ga0207702_10000007 | Ga0207702_10000007153 | 313 |
| 141 | 3300026078 | Ga0207702_10000012 | Ga0207702_1000001284 | 313 |
| 142 | 3300031238 | Ga0265332_10070504 | Ga0265332_100705042 | 313 |
| 143 | 3300031241 | Ga0265325_10000079 | Ga0265325_1000007924 | 313 |
| 144 | 3300031249 | Ga0265339_10009598 | Ga0265339_100095989 | 313 |
| 145 | 3300039437 | Ga0436365_0983540 | Ga0436365_0983540_12685_13704 | 313 |
| 146 | 3300049589 | Ga0501073_0104775 | Ga0501073_0104775_100_1059 | 313 |
| 147 | 3300054114 | Ga0501084_0031164 | Ga0501084_0031164_523_1482 | 313 |
| 148 | 3300060353 | Ga0501082_0169685 | Ga0501082_0169685_741_1736 | 317 |
| 149 | 3300049579 | Ga0501043_0129525 | Ga0501043_0129525_312_1271 | 318 |
| 150 | 3300049822 | Ga0501035_0113546 | Ga0501035_0113546_299_1258 | 318 |
| 151 | 3300049823 | Ga0501044_0123375 | Ga0501044_0123375_1120_2079 | 318 |
| 152 | 3300005336 | Ga0070680_100001296 | Ga0070680_1000012963 | 319 |
| 153 | 3300005344 | Ga0070661_100058522 | Ga0070661_1000585222 | 319 |
| 154 | 3300005458 | Ga0070681_10000003 | Ga0070681_10000003238 | 319 |
| 155 | 3300005530 | Ga0070679_100000756 | Ga0070679_1000007563 | 319 |
| 156 | 3300005539 | Ga0068853_100004228 | Ga0068853_1000042283 | 319 |
| 157 | 3300005539 | Ga0068853_100274062 | Ga0068853_1002740621 | 319 |
| 158 | 3300005563 | Ga0068855_100000006 | Ga0068855_10000000649 | 319 |
| 159 | 3300005616 | Ga0068852_100103808 | Ga0068852_1001038081 | 319 |
| 160 | 3300009093 | Ga0105240_10000357 | Ga0105240_1000035752 | 319 |
| 161 | 3300009093 | Ga0105240_10157420 | Ga0105240_101574202 | 319 |
| 162 | 3300009177 | Ga0105248_10000001 | Ga0105248_10000001784 | 319 |
| 163 | 3300009177 | Ga0105248_10537462 | Ga0105248_105374622 | 319 |
| 164 | 3300009551 | Ga0105238_10441399 | Ga0105238_104413992 | 319 |
| 165 | 3300010375 | Ga0105239_10002644 | Ga0105239_1000264420 | 319 |
| 166 | 3300010375 | Ga0105239_10067340 | Ga0105239_100673404 | 319 |
| 167 | 3300010375 | Ga0105239_10134072 | Ga0105239_101340723 | 319 |
| 168 | 3300013105 | Ga0157369_10041451 | Ga0157369_100414514 | 319 |
| 169 | 3300021377 | Ga0213874_10003497 | Ga0213874_100034974 | 319 |
| 170 | 3300021384 | Ga0213876_10000727 | Ga0213876_1000072718 | 319 |
| 171 | 3300025912 | Ga0207707_10000001 | Ga0207707_10000001816 | 319 |
| 172 | 3300025913 | Ga0207695_10000004 | Ga0207695_10000004814 | 319 |
| 173 | 3300025917 | Ga0207660_10000806 | Ga0207660_100008063 | 319 |
| 174 | 3300025920 | Ga0207649_10006099 | Ga0207649_100060992 | 319 |
| 175 | 3300025921 | Ga0207652_10000094 | Ga0207652_10000094104 | 319 |
| 176 | 3300025924 | Ga0207694_10000014 | Ga0207694_10000014142 | 319 |
| 177 | 3300025941 | Ga0207711_10000001 | Ga0207711_100000011087 | 319 |
| 178 | 3300025949 | Ga0207667_10000051 | Ga0207667_10000051111 | 319 |
| 179 | 3300026041 | Ga0207639_10002016 | Ga0207639_100020163 | 319 |
| 180 | 3300026041 | Ga0207639_10241784 | Ga0207639_102417843 | 319 |
| 181 | 3300026142 | Ga0207698_10085583 | Ga0207698_100855832 | 319 |
| 182 | 3300028573 | Ga0265334_10034054 | Ga0265334_100340543 | 319 |
| 183 | 3300028577 | Ga0265318_10000107 | Ga0265318_1000010757 | 319 |
| 184 | 3300028800 | Ga0265338_10000006 | Ga0265338_10000006373 | 319 |
| 185 | 3300029957 | Ga0265324_10035583 | Ga0265324_100355833 | 319 |
| 186 | 3300031241 | Ga0265325_10000003 | Ga0265325_1000000317 | 319 |
| 187 | 3300031242 | Ga0265329_10018429 | Ga0265329_100184291 | 319 |
| 188 | 3300031249 | Ga0265339_10000132 | Ga0265339_1000013242 | 319 |
| 189 | 3300031250 | Ga0265331_10001823 | Ga0265331_100018234 | 319 |
| 190 | 3300031711 | Ga0265314_10003029 | Ga0265314_1000302913 | 319 |
| 191 | 3300031712 | Ga0265342_10041560 | Ga0265342_100415603 | 319 |
| 192 | 3300031730 | Ga0307516_10012000 | Ga0307516_1001200010 | 319 |
| 193 | 3300039437 | Ga0436365_1168772 | Ga0436365_1168772_64550_65569 | 319 |
| 194 | 3300039450 | Ga0436363_1600004 | Ga0436363_1600004_1886_2896 | 319 |
| 195 | 3300046462 | Ga0495651_0118207 | Ga0495651_0118207_497_1498 | 319 |
| 196 | 3300047444 | Ga0495675_0212047 | Ga0495675_0212047_141_1139 | 319 |
| 197 | 3300049460 | Ga0495682_0009269 | Ga0495682_0009269_1616_2698 | 319 |
| 198 | 3300049569 | Ga0501032_0150944 | Ga0501032_0150944_149_1150 | 319 |
| 199 | 3300049571 | Ga0501034_0061009 | Ga0501034_0061009_451_1452 | 319 |
| 200 | 3300049571 | Ga0501034_0096127 | Ga0501034_0096127_726_1739 | 319 |
| 201 | 3300049581 | Ga0501047_0019275 | Ga0501047_0019275_1225_2238 | 319 |
| 202 | 3300049581 | Ga0501047_0074043 | Ga0501047_0074043_1571_2572 | 319 |
| 203 | 3300049581 | Ga0501047_0396324 | Ga0501047_0396324_92_1093 | 319 |
| 204 | 3300049583 | Ga0501067_0029871 | Ga0501067_0029871_1373_2374 | 319 |
| 205 | 3300049585 | Ga0501069_0068439 | Ga0501069_0068439_863_1861 | 319 |
| 206 | 3300049586 | Ga0501070_0007866 | Ga0501070_0007866_2813_3814 | 319 |
| 207 | 3300049588 | Ga0501072_0003480 | Ga0501072_0003480_564_1577 | 319 |
| 208 | 3300049741 | Ga0501079_0158455 | Ga0501079_0158455_121_1122 | 319 |
| 209 | 3300049742 | Ga0501080_0222076 | Ga0501080_0222076_59_1060 | 319 |
| 210 | 3300049744 | Ga0501083_0224882 | Ga0501083_0224882_207_1208 | 319 |
| 211 | 3300049822 | Ga0501035_0003064 | Ga0501035_0003064_1436_2437 | 319 |
| 212 | 3300049823 | Ga0501044_0005416 | Ga0501044_0005416_1927_2928 | 319 |
| 213 | 3300053154 | Ga0500619_017856 | Ga0500619_017856_698_1699 | 319 |
| 214 | 3300054114 | Ga0501084_0048721 | Ga0501084_0048721_964_1965 | 319 |
| 215 | 3300009551 | Ga0105238_10416072 | Ga0105238_104160722 | 321 |
| 216 | 3300035113 | Ga0373936_0015333 | Ga0373936_0015333_1700_2737 | 321 |
| 217 | 3300036401 | Ga0373937_0393466 | Ga0373937_0393466_175_1212 | 321 |
| 218 | 3300003320 | rootH2_10022937 | rootH2_1002293710 | 323 |
| 219 | 3300005339 | Ga0070660_100009488 | Ga0070660_1000094883 | 323 |
| 220 | 3300005341 | Ga0070691_10001684 | Ga0070691_100016846 | 323 |
| 221 | 3300005341 | Ga0070691_10045777 | Ga0070691_100457772 | 323 |
| 222 | 3300005344 | Ga0070661_100003574 | Ga0070661_1000035742 | 323 |
| 223 | 3300005366 | Ga0070659_100042190 | Ga0070659_1000421903 | 323 |
| 224 | 3300005435 | Ga0070714_100101693 | Ga0070714_1001016933 | 323 |
| 225 | 3300005436 | Ga0070713_100185525 | Ga0070713_1001855253 | 323 |
| 226 | 3300005439 | Ga0070711_100037971 | Ga0070711_1000379712 | 323 |
| 227 | 3300005439 | Ga0070711_100051457 | Ga0070711_1000514573 | 323 |
| 228 | 3300005458 | Ga0070681_10007760 | Ga0070681_100077606 | 323 |
| 229 | 3300005539 | Ga0068853_100003014 | Ga0068853_10000301418 | 323 |
| 230 | 3300005547 | Ga0070693_100011699 | Ga0070693_1000116995 | 323 |
| 231 | 3300005547 | Ga0070693_100032119 | Ga0070693_1000321193 | 323 |
| 232 | 3300005563 | Ga0068855_100023239 | Ga0068855_1000232397 | 323 |
| 233 | 3300005563 | Ga0068855_100085643 | Ga0068855_1000856433 | 323 |
| 234 | 3300005577 | Ga0068857_100000722 | Ga0068857_10000072217 | 323 |
| 235 | 3300005578 | Ga0068854_100056272 | Ga0068854_1000562722 | 323 |
| 236 | 3300005578 | Ga0068854_100219578 | Ga0068854_1002195782 | 323 |
| 237 | 3300005614 | Ga0068856_100006510 | Ga0068856_1000065102 | 323 |
| 238 | 3300005842 | Ga0068858_100049085 | Ga0068858_1000490853 | 323 |
| 239 | 3300006175 | Ga0070712_100000018 | Ga0070712_10000001894 | 323 |
| 240 | 3300006914 | Ga0075436_100016414 | Ga0075436_1000164145 | 323 |
| 241 | 3300007076 | Ga0075435_100050659 | Ga0075435_1000506593 | 323 |
| 242 | 3300009093 | Ga0105240_10010445 | Ga0105240_100104452 | 323 |
| 243 | 3300009093 | Ga0105240_10016205 | Ga0105240_100162052 | 323 |
| 244 | 3300009093 | Ga0105240_10283651 | Ga0105240_102836512 | 323 |
| 245 | 3300009174 | Ga0105241_10196737 | Ga0105241_101967373 | 323 |
| 246 | 3300009545 | Ga0105237_10001328 | Ga0105237_100013284 | 323 |
| 247 | 3300009551 | Ga0105238_10001436 | Ga0105238_1000143617 | 323 |
| 248 | 3300009551 | Ga0105238_10027856 | Ga0105238_100278563 | 323 |
| 249 | 3300010375 | Ga0105239_10121022 | Ga0105239_101210222 | 323 |
| 250 | 3300013100 | Ga0157373_10005154 | Ga0157373_100051545 | 323 |
| 251 | 3300013100 | Ga0157373_10042659 | Ga0157373_100426593 | 323 |
| 252 | 3300013102 | Ga0157371_10060983 | Ga0157371_100609833 | 323 |
| 253 | 3300013104 | Ga0157370_10005953 | Ga0157370_1000595317 | 323 |
| 254 | 3300013104 | Ga0157370_10064278 | Ga0157370_100642783 | 323 |
| 255 | 3300013105 | Ga0157369_10001118 | Ga0157369_1000111830 | 323 |
| 256 | 3300013307 | Ga0157372_10041078 | Ga0157372_100410785 | 323 |
| 257 | 3300013307 | Ga0157372_10288020 | Ga0157372_102880202 | 323 |
| 258 | 3300014497 | Ga0182008_10153804 | Ga0182008_101538041 | 323 |
| 259 | 3300014968 | Ga0157379_10010218 | Ga0157379_100102187 | 323 |
| 260 | 3300014968 | Ga0157379_10010346 | Ga0157379_100103465 | 323 |
| 261 | 3300014968 | Ga0157379_10010756 | Ga0157379_100107566 | 323 |
| 262 | 3300025909 | Ga0207705_10000159 | Ga0207705_1000015970 | 323 |
| 263 | 3300025911 | Ga0207654_10132226 | Ga0207654_101322263 | 323 |
| 264 | 3300025912 | Ga0207707_10078856 | Ga0207707_100788565 | 323 |
| 265 | 3300025913 | Ga0207695_10007642 | Ga0207695_100076421 | 323 |
| 266 | 3300025913 | Ga0207695_10243695 | Ga0207695_102436952 | 323 |
| 267 | 3300025914 | Ga0207671_10047486 | Ga0207671_100474863 | 323 |
| 268 | 3300025915 | Ga0207693_10000145 | Ga0207693_1000014557 | 323 |
| 269 | 3300025915 | Ga0207693_10092452 | Ga0207693_100924522 | 323 |
| 270 | 3300025917 | Ga0207660_10056778 | Ga0207660_100567783 | 323 |
| 271 | 3300025919 | Ga0207657_10007294 | Ga0207657_100072946 | 323 |
| 272 | 3300025920 | Ga0207649_10000790 | Ga0207649_1000079019 | 323 |
| 273 | 3300025921 | Ga0207652_10001571 | Ga0207652_1000157116 | 323 |
| 274 | 3300025928 | Ga0207700_10164323 | Ga0207700_101643232 | 323 |
| 275 | 3300025932 | Ga0207690_10069660 | Ga0207690_100696603 | 323 |
| 276 | 3300025981 | Ga0207640_10073938 | Ga0207640_100739382 | 323 |
| 277 | 3300026041 | Ga0207639_10006879 | Ga0207639_100068794 | 323 |
| 278 | 3300026041 | Ga0207639_10180680 | Ga0207639_101806803 | 323 |
| 279 | 3300026078 | Ga0207702_10002115 | Ga0207702_1000211517 | 323 |
| 280 | 3300026116 | Ga0207674_10000107 | Ga0207674_100001078 | 323 |
| 281 | 3300028381 | Ga0268264_10292192 | Ga0268264_102921921 | 323 |
| 282 | 3300031247 | Ga0265340_10000245 | Ga0265340_1000024519 | 323 |
| 283 | 3300031250 | Ga0265331_10000009 | Ga0265331_10000009126 | 323 |
| 284 | 3300031250 | Ga0265331_10000193 | Ga0265331_1000019310 | 323 |
| 285 | 3300031251 | Ga0265327_10000036 | Ga0265327_10000036285 | 323 |
| 286 | 3300031711 | Ga0265314_10005220 | Ga0265314_100052203 | 323 |
| 287 | 3300031711 | Ga0265314_10079180 | Ga0265314_100791802 | 323 |
| 288 | 3300035118 | Ga0373954_0088410 | Ga0373954_0088410_98_1105 | 323 |
| 289 | 3300035120 | Ga0373957_0076071 | Ga0373957_0076071_40_1047 | 323 |
| 290 | 3300035172 | Ga0373955_0043475 | Ga0373955_0043475_906_1913 | 323 |
| 291 | 3300035691 | Ga0373931_0017047 | Ga0373931_0017047_1955_2962 | 323 |
| 292 | 3300035692 | Ga0373935_0089323 | Ga0373935_0089323_978_1985 | 323 |
| 293 | 3300035695 | Ga0373927_0215252 | Ga0373927_0215252_231_1238 | 323 |
| 294 | 3300035724 | Ga0373933_0069008 | Ga0373933_0069008_720_1727 | 323 |
| 295 | 3300036401 | Ga0373937_0008234 | Ga0373937_0008234_2908_3915 | 323 |
| 296 | 3300036401 | Ga0373937_0016020 | Ga0373937_0016020_4947_5954 | 323 |
| 297 | 3300036401 | Ga0373937_0378281 | Ga0373937_0378281_70_1131 | 323 |
| 298 | 3300037068 | Ga0373925_0008822 | Ga0373925_0008822_5209_6216 | 323 |
| 299 | 3300037068 | Ga0373925_0281970 | Ga0373925_0281970_243_1250 | 323 |
| 300 | 3300048903 | Ga0496100_0288772 | Ga0496100_0288772_105_1112 | 323 |
| 301 | 3300048907 | Ga0496104_0233968 | Ga0496104_0233968_447_1454 | 323 |
| 302 | 3300048910 | Ga0496107_0071317 | Ga0496107_0071317_290_1297 | 323 |
| 303 | 3300048910 | Ga0496107_0159767 | Ga0496107_0159767_382_1389 | 323 |
| 304 | 3300048914 | Ga0496111_0063508 | Ga0496111_0063508_1591_2598 | 323 |
| 305 | 3300049568 | Ga0501031_0031029 | Ga0501031_0031029_2238_3209 | 323 |
| 306 | 3300049568 | Ga0501031_0268624 | Ga0501031_0268624_28_1032 | 323 |
| 307 | 3300049569 | Ga0501032_0047157 | Ga0501032_0047157_917_1888 | 323 |
| 308 | 3300049569 | Ga0501032_0073022 | Ga0501032_0073022_306_1310 | 323 |
| 309 | 3300049570 | Ga0501033_0026584 | Ga0501033_0026584_1347_2438 | 323 |
| 310 | 3300049572 | Ga0501036_0050128 | Ga0501036_0050128_595_1599 | 323 |
| 311 | 3300049574 | Ga0501038_0011736 | Ga0501038_0011736_6755_7726 | 323 |
| 312 | 3300049575 | Ga0501039_0193723 | Ga0501039_0193723_144_1115 | 323 |
| 313 | 3300049579 | Ga0501043_0040393 | Ga0501043_0040393_1017_2021 | 323 |
| 314 | 3300049586 | Ga0501070_0000794 | Ga0501070_0000794_12773_13744 | 323 |
| 315 | 3300049586 | Ga0501070_0011708 | Ga0501070_0011708_4136_5170 | 323 |
| 316 | 3300049589 | Ga0501073_0049148 | Ga0501073_0049148_1615_2619 | 323 |
| 317 | 3300049742 | Ga0501080_0005272 | Ga0501080_0005272_6099_7070 | 323 |
| 318 | 3300049744 | Ga0501083_0218293 | Ga0501083_0218293_31_1035 | 323 |
| 319 | 3300049822 | Ga0501035_0000425 | Ga0501035_0000425_43278_44249 | 323 |
| 320 | 3300049822 | Ga0501035_0188653 | Ga0501035_0188653_436_1440 | 323 |
| 321 | 3300049822 | Ga0501035_0305515 | Ga0501035_0305515_160_1203 | 323 |
| 322 | 3300049823 | Ga0501044_0024462 | Ga0501044_0024462_3072_4163 | 323 |
| 323 | 3300049823 | Ga0501044_0028873 | Ga0501044_0028873_4715_5686 | 323 |
| 324 | 3300049823 | Ga0501044_0109233 | Ga0501044_0109233_613_1584 | 323 |
| 325 | 3300050512 | nmdc:mga0n895_90006_c1 | nmdc:mga0n895_90006_c1_23_1030 | 323 |
| 326 | 3300050513 | nmdc:mga0rr50_135537_c1 | nmdc:mga0rr50_135537_c1_421_1428 | 323 |
| 327 | 3300050514 | nmdc:mga08x19_104222_c1 | nmdc:mga08x19_104222_c1_838_1845 | 323 |
| 328 | 3300050514 | nmdc:mga08x19_160812_c1 | nmdc:mga08x19_160812_c1_114_1121 | 323 |
| 329 | 3300050514 | nmdc:mga08x19_38_c1 | nmdc:mga08x19_38_c1_144242_145249 | 323 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8b6p-assembly1.cif.gz_A | x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) | 0.8694 | 44 | 164 |
| 8b6n-assembly1.cif.gz_A | x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) | 0.8674 | 43 | 164 |
| 3bdi-assembly1.cif.gz_A | crystal structure of predicted cib-like hydrolase (np_393672.1) from thermoplasma acidophilum at 1.45 a resolution | 0.8419 | 43 | 313 |
| 8b6o-assembly1.cif.gz_A | x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) fused to m13 | 0.8283 | 36 | 164 |
| 3qit-assembly2.cif.gz_D | thioesterase domain from curacin biosynthetic pathway | 0.8276 | 43 | 309 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0KMM0_1_93_3.40.50.12270 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8798 | 42 | 129 | 3.40.50.12270 |
| af_Q54CU1_1_267_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8753 | 57 | 159 | 3.40.50.1820 |
| af_Q0IY30_3_145_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8674 | 257 | 313 | 3.40.50.1820 |
| af_Q10QZ0_32_236_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.85 | 49 | 167 | 3.40.50.1820 |
| af_Q9NQF3_11_190_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.849 | 44 | 175 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7U4QVT7-F1-model_v4 | AB hydrolase-1 domain-containing protein | 0.9759 | 22 | 318 |
GO:0006654
GO:0042171 GO:0052689 GO:0055088 |
| AF-A0A258BYP3-F1-model_v4 | Alpha/beta hydrolase | 0.9702 | 32 | 110 |
GO:0016787
|
| AF-A0A0F2P5T9-F1-model_v4 | AB hydrolase-1 domain-containing protein | 0.9537 | 25 | 318 |
GO:0016020
|
| AF-A0A7W9B7E5-F1-model_v4 | Pimeloyl-ACP methyl ester carboxylesterase | 0.9516 | 42 | 314 |
|
| AF-A0A382Y1L5-F1-model_v4 | AB hydrolase-1 domain-containing protein | 0.95 | 29 | 103 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar