F409848

General Info

Members Datasets Scaffolds Average Seq Length
329 186 328 328

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0026584|Ga0501033_0026584_1347_2438
Length 363
Sequence MAAGLNGAATRETLRPMSDTPILPPVRDLPPEARRHIFDRQPAEGPLAGLAGSPPPAPQWFEDALAQKPERRFVSVGGARIHYLRWGDPSKPGLLLIHGNAAHAWWWSFIAPFLAQDYHVAAMDLSGMGDSLWRAGQAGYSMALFAEEAMAVLEDAGMFEAPTPPVIVAHSFGGFVTMKTAADHGERLTGIVIIDSPINPPVRTEGGLGGDPVDHKPHPHKVYPSIASALARFRLMPPQPCENLFLLDWVARKSLKEVAGPKGEPGFTWKFDPAIWRHFSIGDTAELLKRTRCRVAVFRGEHSALMPPGAGDYVFDLLGRAAPVVEIPQARHHVMLDQPLALVAALRALLADWAHSVATRRRV

Samples

Sample ID Description Type Environment
1 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
63 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
64 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
65 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
105 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
108 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
109 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
110 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
111 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
112 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
113 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
114 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
115 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
116 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
117 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
118 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
119 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
120 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
121 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
122 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
123 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
125 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
126 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
127 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
128 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
130 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
140 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
141 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
142 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
143 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
144 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
145 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
146 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
147 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
158 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
159 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
160 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
170 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
173 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
174 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
175 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
176 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
182 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
183 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
184 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
185 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
186 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.52
Nodule 0
Rhizoplane 4.86
Rhizosphere 90.27
Stem 0
Stem Tuber 0
Unclassified 3.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10022937 3300003320 Bacteria 9883
2 Ga0070658_10098700 3300005327 Bacteria 2413
3 Ga0070670_100103389 3300005331 Bacteria 2454
4 Ga0070666_10000362 3300005335 Bacteria 28643
5 Ga0070666_10007703 3300005335 Bacteria 6648
6 Ga0070680_100001296 3300005336 Bacteria 18096
7 Ga0070660_100009488 3300005339 Bacteria 6847
8 Ga0070689_100189728 3300005340 Unclassified 1673
9 Ga0070691_10001684 3300005341 Bacteria 9590
10 Ga0070691_10045777 3300005341 Bacteria 2076
11 Ga0070691_10133973 3300005341 Bacteria 1257
12 Ga0070661_100003574 3300005344 Bacteria 10700
13 Ga0070661_100058522 3300005344 Bacteria 2824
14 Ga0070669_100000711 3300005353 Bacteria 24418
15 Ga0070671_100000074 3300005355 Bacteria 64319
16 Ga0070688_100081648 3300005365 Bacteria 2094
17 Ga0070659_100000316 3300005366 Bacteria 37463
18 Ga0070659_100042190 3300005366 Unclassified 3566
19 Ga0070667_100003604 3300005367 Bacteria 13171
20 Ga0070709_10001248 3300005434 Bacteria 13908
21 Ga0070714_100070589 3300005435 Bacteria 3019
22 Ga0070714_100101693 3300005435 Bacteria 2533
23 Ga0070714_100204579 3300005435 Bacteria 1807
24 Ga0070713_100000002 3300005436 Bacteria 245989
25 Ga0070713_100018089 3300005436 Bacteria 5352
26 Ga0070713_100185525 3300005436 Bacteria 1872
27 Ga0070711_100037971 3300005439 Bacteria 3234
28 Ga0070711_100051457 3300005439 Bacteria 2829
29 Ga0070705_100100669 3300005440 Bacteria 1824
30 Ga0070708_100219478 3300005445 Bacteria 1783
31 Ga0070681_10000003 3300005458 Bacteria 252785
32 Ga0070681_10007760 3300005458 Bacteria 10491
33 Ga0070681_10168357 3300005458 Bacteria 2113
34 Ga0070679_100000756 3300005530 Bacteria 27999
35 Ga0070679_100145165 3300005530 Bacteria 2351
36 Ga0068853_100003014 3300005539 Bacteria 12860
37 Ga0068853_100004228 3300005539 Bacteria 11085
38 Ga0068853_100274062 3300005539 Bacteria 1554
39 Ga0070686_100146107 3300005544 Unclassified 1651
40 Ga0070693_100011699 3300005547 Bacteria 4424
41 Ga0070693_100032119 3300005547 Bacteria 2884
42 Ga0070665_100000221 3300005548 Bacteria 95402
43 Ga0070665_100000362 3300005548 Bacteria 67720
44 Ga0068855_100000006 3300005563 Bacteria 298092
45 Ga0068855_100023239 3300005563 Bacteria 7426
46 Ga0068855_100055562 3300005563 Bacteria 4650
47 Ga0068855_100085643 3300005563 Bacteria 3645
48 Ga0068857_100000722 3300005577 Bacteria 24631
49 Ga0068854_100056272 3300005578 Bacteria 2834
50 Ga0068854_100219578 3300005578 Bacteria 1503
51 Ga0068856_100000312 3300005614 Bacteria 53339
52 Ga0068856_100006510 3300005614 Bacteria 11454
53 Ga0068852_100103808 3300005616 Bacteria 2571
54 Ga0068859_100373764 3300005617 Bacteria 1521
55 Ga0068864_100057001 3300005618 Bacteria 3376
56 Ga0068863_100000530 3300005841 Bacteria 38943
57 Ga0068858_100049085 3300005842 Bacteria 3909
58 Ga0068858_100115631 3300005842 Bacteria 2507
59 Ga0068860_100000035 3300005843 Bacteria 238993
60 Ga0068860_100009664 3300005843 Bacteria 9579
61 Ga0068862_100000072 3300005844 Bacteria 119705
62 Ga0068862_100048512 3300005844 Bacteria 3625
63 Ga0070712_100000018 3300006175 Bacteria 102923
64 Ga0070712_100000045 3300006175 Bacteria 66187
65 Ga0075362_10023750 3300006177 Bacteria 2596
66 Ga0075366_10020884 3300006195 Bacteria 3804
67 Ga0075434_100063324 3300006871 Bacteria 3681
68 Ga0068865_100001247 3300006881 Bacteria 14804
69 Ga0075436_100000255 3300006914 Bacteria 33272
70 Ga0075436_100016414 3300006914 Bacteria 5067
71 Ga0097620_100373732 3300006931 Bacteria 1521
72 Ga0075435_100050659 3300007076 Bacteria 3342
73 Ga0105240_10000357 3300009093 Bacteria 85936
74 Ga0105240_10010445 3300009093 Bacteria 13045
75 Ga0105240_10016205 3300009093 Bacteria 10101
76 Ga0105240_10054250 3300009093 Bacteria 5024
77 Ga0105240_10157420 3300009093 Bacteria 2701
78 Ga0105240_10185794 3300009093 Bacteria 2448
79 Ga0105240_10283651 3300009093 Bacteria 1901
80 Ga0105241_10196737 3300009174 Bacteria 1681
81 Ga0105248_10000001 3300009177 Bacteria 1881304
82 Ga0105248_10000097 3300009177 Bacteria 97424
83 Ga0105248_10152763 3300009177 Bacteria 2605
84 Ga0105248_10537462 3300009177 Unclassified 1318
85 Ga0105237_10001328 3300009545 Bacteria 32811
86 Ga0105238_10001436 3300009551 Bacteria 23918
87 Ga0105238_10027856 3300009551 Bacteria 5758
88 Ga0105238_10209575 3300009551 Bacteria 1925
89 Ga0105238_10416072 3300009551 Bacteria 1338
90 Ga0105238_10441399 3300009551 Unclassified 1298
91 Ga0105239_10002644 3300010375 Bacteria 22618
92 Ga0105239_10067340 3300010375 Bacteria 3934
93 Ga0105239_10121022 3300010375 Bacteria 2907
94 Ga0105239_10134072 3300010375 Bacteria 2756
95 Ga0157373_10005154 3300013100 Bacteria 9825
96 Ga0157373_10042659 3300013100 Unclassified 3242
97 Ga0157371_10060983 3300013102 Bacteria 2674
98 Ga0157370_10005953 3300013104 Bacteria 13576
99 Ga0157370_10064278 3300013104 Bacteria 3474
100 Ga0157369_10001118 3300013105 Bacteria 33541
101 Ga0157369_10041451 3300013105 Bacteria 5025
102 Ga0163162_10321489 3300013306 Bacteria 1680
103 Ga0163162_10621521 3300013306 Unclassified 1205
104 Ga0157372_10041078 3300013307 Bacteria 5113
105 Ga0157372_10288020 3300013307 Bacteria 1910
106 Ga0163163_10318523 3300014325 Bacteria 1609
107 Ga0182008_10153804 3300014497 Bacteria 1155
108 Ga0157379_10010218 3300014968 Bacteria 8176
109 Ga0157379_10010346 3300014968 Bacteria 8126
110 Ga0157379_10010756 3300014968 Bacteria 7975
111 Ga0213872_10043055 3300021361 Bacteria 2058
112 Ga0213874_10003497 3300021377 Bacteria 3491
113 Ga0213876_10000727 3300021384 Bacteria 22933
114 Ga0213875_10001099 3300021388 Bacteria 18747
115 Ga0207680_10056601 3300025903 Bacteria 2369
116 Ga0207699_10000133 3300025906 Bacteria 50958
117 Ga0207705_10000159 3300025909 Bacteria 72293
118 Ga0207654_10132226 3300025911 Bacteria 1581
119 Ga0207707_10000001 3300025912 Bacteria 1212482
120 Ga0207707_10078856 3300025912 Bacteria 2876
121 Ga0207707_10132271 3300025912 Bacteria 2182
122 Ga0207695_10000004 3300025913 Bacteria 1288665
123 Ga0207695_10007642 3300025913 Bacteria 13697
124 Ga0207695_10048189 3300025913 Bacteria 4502
125 Ga0207695_10243695 3300025913 Unclassified 1698
126 Ga0207671_10047486 3300025914 Bacteria 3178
127 Ga0207693_10000035 3300025915 Bacteria 110713
128 Ga0207693_10000145 3300025915 Bacteria 65383
129 Ga0207693_10092452 3300025915 Bacteria 2371
130 Ga0207663_10042071 3300025916 Unclassified 2789
131 Ga0207663_10049784 3300025916 Bacteria 2601
132 Ga0207660_10000806 3300025917 Bacteria 20699
133 Ga0207660_10056778 3300025917 Bacteria 2802
134 Ga0207657_10007294 3300025919 Bacteria 11342
135 Ga0207649_10000790 3300025920 Bacteria 20471
136 Ga0207649_10006099 3300025920 Bacteria 6542
137 Ga0207652_10000094 3300025921 Bacteria 98207
138 Ga0207652_10001571 3300025921 Bacteria 20110
139 Ga0207681_10000137 3300025923 Bacteria 60426
140 Ga0207694_10000014 3300025924 Bacteria 374435
141 Ga0207700_10000037 3300025928 Bacteria 115488
142 Ga0207700_10164323 3300025928 Unclassified 1846
143 Ga0207700_10230014 3300025928 Bacteria 1576
144 Ga0207664_10020187 3300025929 Bacteria 4935
145 Ga0207664_10059566 3300025929 Bacteria 3041
146 Ga0207664_10086365 3300025929 Bacteria 2563
147 Ga0207644_10000053 3300025931 Bacteria 90831
148 Ga0207690_10069660 3300025932 Bacteria 2421
149 Ga0207686_10032081 3300025934 Bacteria 3124
150 Ga0207704_10007775 3300025938 Bacteria 5087
151 Ga0207711_10000001 3300025941 Bacteria 1325674
152 Ga0207711_10008527 3300025941 Bacteria 8574
153 Ga0207711_10036752 3300025941 Bacteria 4157
154 Ga0207667_10000051 3300025949 Bacteria 233836
155 Ga0207651_10255129 3300025960 Bacteria 1437
156 Ga0207668_10126677 3300025972 Bacteria 1943
157 Ga0207640_10073938 3300025981 Bacteria 2305
158 Ga0207703_10151665 3300026035 Unclassified 2022
159 Ga0207703_10589864 3300026035 Unclassified 1050
160 Ga0207639_10002016 3300026041 Bacteria 13684
161 Ga0207639_10006879 3300026041 Bacteria 7747
162 Ga0207639_10180680 3300026041 Bacteria 1794
163 Ga0207639_10241784 3300026041 Bacteria 1570
164 Ga0207702_10000007 3300026078 Bacteria 332551
165 Ga0207702_10000012 3300026078 Bacteria 269770
166 Ga0207702_10002115 3300026078 Bacteria 19134
167 Ga0207641_10001429 3300026088 Bacteria 23483
168 Ga0207648_10065881 3300026089 Bacteria 3158
169 Ga0207676_10028760 3300026095 Bacteria 4156
170 Ga0207674_10000107 3300026116 Bacteria 95635
171 Ga0207675_100321145 3300026118 Bacteria 1511
172 Ga0207698_10085583 3300026142 Bacteria 2560
173 Ga0268266_10000005 3300028379 Bacteria 1448194
174 Ga0268266_10001938 3300028379 Bacteria 23266
175 Ga0268265_10000083 3300028380 Bacteria 120015
176 Ga0268265_10199232 3300028380 Bacteria 1736
177 Ga0268264_10000031 3300028381 Bacteria 409525
178 Ga0268264_10041458 3300028381 Bacteria 3808
179 Ga0268264_10292192 3300028381 Bacteria 1531
180 Ga0265334_10000111 3300028573 Bacteria 53728
181 Ga0265334_10034054 3300028573 Bacteria 2023
182 Ga0265318_10000107 3300028577 Bacteria 77965
183 Ga0265338_10000006 3300028800 Bacteria 570804
184 Ga0265338_10013350 3300028800 Bacteria 9280
185 Ga0265338_10030250 3300028800 Bacteria 5341
186 Ga0265338_10033503 3300028800 Bacteria 4982
187 Ga0265338_10198437 3300028800 Bacteria 1515
188 Ga0265324_10035583 3300029957 Bacteria 1734
189 Ga0265330_10005616 3300031235 Bacteria 6241
190 Ga0265330_10021582 3300031235 Bacteria 2937
191 Ga0265332_10070504 3300031238 Bacteria 1489
192 Ga0265320_10001310 3300031240 Bacteria 18189
193 Ga0265325_10000003 3300031241 Bacteria 370490
194 Ga0265325_10000079 3300031241 Bacteria 67833
195 Ga0265325_10001606 3300031241 Bacteria 15753
196 Ga0265329_10018429 3300031242 Bacteria 2387
197 Ga0265340_10000139 3300031247 Bacteria 36402
198 Ga0265340_10000245 3300031247 Bacteria 28170
199 Ga0265340_10001587 3300031247 Bacteria 13035
200 Ga0265340_10004967 3300031247 Bacteria 7395
201 Ga0265340_10032513 3300031247 Bacteria 2604
202 Ga0265339_10000132 3300031249 Bacteria 61274
203 Ga0265339_10009598 3300031249 Bacteria 6064
204 Ga0265339_10015987 3300031249 Bacteria 4483
205 Ga0265331_10000009 3300031250 Bacteria 314950
206 Ga0265331_10000193 3300031250 Bacteria 75140
207 Ga0265331_10001823 3300031250 Bacteria 15102
208 Ga0265331_10010979 3300031250 Bacteria 4973
209 Ga0265327_10000027 3300031251 Bacteria 364541
210 Ga0265327_10000036 3300031251 Bacteria 312827
211 Ga0265316_10003200 3300031344 Bacteria 16640
212 Ga0265316_10062242 3300031344 Bacteria 2896
213 Ga0307513_10008428 3300031456 Bacteria 13201
214 Ga0265313_10001937 3300031595 Bacteria 18726
215 Ga0265314_10003029 3300031711 Bacteria 16599
216 Ga0265314_10005220 3300031711 Bacteria 11783
217 Ga0265314_10005424 3300031711 Bacteria 11519
218 Ga0265314_10031367 3300031711 Bacteria 3924
219 Ga0265314_10079180 3300031711 Bacteria 2173
220 Ga0265342_10009827 3300031712 Bacteria 6693
221 Ga0265342_10032612 3300031712 Bacteria 3211
222 Ga0265342_10041560 3300031712 Bacteria 2783
223 Ga0307516_10000001 3300031730 Bacteria 510338
224 Ga0307516_10012000 3300031730 Bacteria 9366
225 Ga0373936_0015333 3300035113 Bacteria 2937
226 Ga0373936_0015953 3300035113 Bacteria 2883
227 Ga0373954_0088410 3300035118 Bacteria 1486
228 Ga0373957_0076071 3300035120 Bacteria 1320
229 Ga0373955_0043475 3300035172 Bacteria 2417
230 Ga0373931_0017047 3300035691 Bacteria 3584
231 Ga0373935_0089323 3300035692 Bacteria 2015
232 Ga0373927_0215252 3300035695 Unclassified 1262
233 Ga0373933_0069008 3300035724 Bacteria 2148
234 Ga0373937_0008234 3300036401 Bacteria 9052
235 Ga0373937_0016020 3300036401 Bacteria 6648
236 Ga0373937_0378281 3300036401 Unclassified 1343
237 Ga0373937_0393466 3300036401 Bacteria 1315
238 Ga0373925_0008822 3300037068 Bacteria 7344
239 Ga0373925_0281970 3300037068 Bacteria 1338
240 Ga0395899_0000223 3300037312 Bacteria 77606
241 Ga0395900_0000008 3300037418 Bacteria 480459
242 Ga0395900_0019152 3300037418 Bacteria 6980
243 Ga0395905_0283813 3300037471 Bacteria 1542
244 Ga0395905_0304149 3300037471 Bacteria 1482
245 Ga0395905_0337790 3300037471 Bacteria 1397
246 Ga0436364_0206190 3300037853 Bacteria 18748
247 Ga0395901_0000008 3300038443 Bacteria 495962
248 Ga0436365_0983540 3300039437 Bacteria 14300
249 Ga0436365_1168772 3300039437 Bacteria 186262
250 Ga0436361_0767272 3300039447 Bacteria 33690
251 Ga0436363_1600004 3300039450 Bacteria 3653
252 Ga0451577_0232065 3300042876 Bacteria 1669
253 Ga0451576_0027987 3300045051 Bacteria 6044
254 Ga0495651_0118207 3300046462 Bacteria 1951
255 Ga0495645_0069803 3300046543 Bacteria 2536
256 Ga0495672_0029643 3300047320 Bacteria 3443
257 Ga0495675_0212047 3300047444 Unclassified 1175
258 Ga0496100_0288772 3300048903 Unclassified 1225
259 Ga0496101_0056164 3300048904 Bacteria 2846
260 Ga0496102_0024307 3300048905 Bacteria 5385
261 Ga0496103_0021602 3300048906 Bacteria 3873
262 Ga0496104_0233968 3300048907 Unclassified 1749
263 Ga0496104_0412362 3300048907 Bacteria 1263
264 Ga0496105_0180176 3300048908 Bacteria 1730
265 Ga0496106_0003872 3300048909 Bacteria 11159
266 Ga0496107_0000157 3300048910 Bacteria 34652
267 Ga0496107_0071317 3300048910 Bacteria 2524
268 Ga0496107_0159767 3300048910 Bacteria 1670
269 Ga0496111_0063508 3300048914 Bacteria 2678
270 Ga0496112_0008113 3300048915 Bacteria 9378
271 Ga0496112_0114961 3300048915 Bacteria 2661
272 Ga0496113_0005887 3300048916 Bacteria 7696
273 Ga0496115_0063820 3300048918 Bacteria 2972
274 Ga0495682_0009269 3300049460 Bacteria 3846
275 Ga0501031_0031029 3300049568 Bacteria 3487
276 Ga0501031_0268624 3300049568 Unclassified 1108
277 Ga0501032_0047157 3300049569 Bacteria 2910
278 Ga0501032_0073022 3300049569 Unclassified 2286
279 Ga0501032_0150944 3300049569 Bacteria 1528
280 Ga0501033_0026584 3300049570 Bacteria 4354
281 Ga0501034_0061009 3300049571 Bacteria 3788
282 Ga0501034_0096127 3300049571 Bacteria 2959
283 Ga0501036_0050128 3300049572 Bacteria 3536
284 Ga0501038_0011736 3300049574 Bacteria 7992
285 Ga0501038_0216104 3300049574 Bacteria 1532
286 Ga0501039_0193723 3300049575 Bacteria 1598
287 Ga0501043_0040393 3300049579 Bacteria 3666
288 Ga0501043_0129525 3300049579 Bacteria 1977
289 Ga0501047_0003112 3300049581 Bacteria 15739
290 Ga0501047_0019275 3300049581 Bacteria 6545
291 Ga0501047_0074043 3300049581 Bacteria 3278
292 Ga0501047_0396324 3300049581 Bacteria 1214
293 Ga0501067_0029871 3300049583 Bacteria 3021
294 Ga0501069_0068439 3300049585 Bacteria 1987
295 Ga0501070_0000794 3300049586 Bacteria 28669
296 Ga0501070_0007866 3300049586 Bacteria 9034
297 Ga0501070_0011708 3300049586 Bacteria 7408
298 Ga0501072_0003480 3300049588 Bacteria 11851
299 Ga0501073_0049148 3300049589 Bacteria 2958
300 Ga0501073_0104775 3300049589 Unclassified 1963
301 Ga0501079_0158455 3300049741 Bacteria 1764
302 Ga0501080_0005272 3300049742 Bacteria 11510
303 Ga0501080_0222076 3300049742 Bacteria 1728
304 Ga0501083_0218293 3300049744 Unclassified 1242
305 Ga0501083_0224882 3300049744 Bacteria 1222
306 Ga0501035_0000425 3300049822 Bacteria 47628
307 Ga0501035_0003064 3300049822 Bacteria 16033
308 Ga0501035_0113546 3300049822 Bacteria 2373
309 Ga0501035_0188653 3300049822 Bacteria 1773
310 Ga0501035_0231412 3300049822 Bacteria 1575
311 Ga0501035_0305515 3300049822 Bacteria 1339
312 Ga0501044_0005416 3300049823 Bacteria 14177
313 Ga0501044_0024462 3300049823 Bacteria 6409
314 Ga0501044_0025679 3300049823 Bacteria 6245
315 Ga0501044_0028873 3300049823 Bacteria 5850
316 Ga0501044_0109233 3300049823 Unclassified 2775
317 Ga0501044_0123375 3300049823 Bacteria 2589
318 nmdc:mga0n895_90006_c1 3300050512 Bacteria 3070
319 nmdc:mga0rr50_135537_c1 3300050513 Bacteria 1976
320 nmdc:mga08x19_104222_c1 3300050514 Unclassified 1885
321 nmdc:mga08x19_160812_c1 3300050514 Bacteria 1525
322 nmdc:mga08x19_38_c1 3300050514 Bacteria 159604
323 Ga0500595_011408 3300053119 Bacteria 3482
324 Ga0500564_046824 3300053138 Bacteria 1983
325 Ga0500619_017856 3300053154 Bacteria 1981
326 Ga0501084_0031164 3300054114 Bacteria 4459
327 Ga0501084_0048721 3300054114 Bacteria 3546
328 Ga0501082_0169685 3300060353 Bacteria 1897

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048908 Ga0496105_0180176 Ga0496105_0180176_68_862 258
2 3300025960 Ga0207651_10255129 Ga0207651_102551292 264
3 3300049822 Ga0501035_0231412 Ga0501035_0231412_399_1244 271
4 3300053119 Ga0500595_011408 Ga0500595_011408_970_1824 277
5 3300005435 Ga0070714_100204579 Ga0070714_1002045792 282
6 3300005436 Ga0070713_100018089 Ga0070713_1000180892 282
7 3300005367 Ga0070667_100003604 Ga0070667_1000036049 285
8 3300005548 Ga0070665_100000362 Ga0070665_10000036229 285
9 3300005841 Ga0068863_100000530 Ga0068863_10000053011 285
10 3300005843 Ga0068860_100000035 Ga0068860_100000035101 285
11 3300025972 Ga0207668_10126677 Ga0207668_101266772 285
12 3300026088 Ga0207641_10001429 Ga0207641_100014294 285
13 3300028379 Ga0268266_10001938 Ga0268266_1000193813 285
14 3300028381 Ga0268264_10000031 Ga0268264_10000031303 285
15 3300053138 Ga0500564_046824 Ga0500564_046824_724_1611 285
16 3300005440 Ga0070705_100100669 Ga0070705_1001006692 286
17 3300005544 Ga0070686_100146107 Ga0070686_1001461072 286
18 3300006881 Ga0068865_100001247 Ga0068865_1000012476 286
19 3300013306 Ga0163162_10321489 Ga0163162_103214891 286
20 3300025929 Ga0207664_10020187 Ga0207664_100201874 286
21 3300025938 Ga0207704_10007775 Ga0207704_100077756 286
22 3300031250 Ga0265331_10010979 Ga0265331_100109793 286
23 3300031251 Ga0265327_10000027 Ga0265327_10000027239 286
24 3300045051 Ga0451576_0027987 Ga0451576_0027987_2651_3562 286
25 3300005445 Ga0070708_100219478 Ga0070708_1002194781 287
26 3300005365 Ga0070688_100081648 Ga0070688_1000816481 288
27 3300037471 Ga0395905_0337790 Ga0395905_0337790_87_986 288
28 3300046543 Ga0495645_0069803 Ga0495645_0069803_1170_2213 288
29 3300021388 Ga0213875_10001099 Ga0213875_1000109917 290
30 3300037853 Ga0436364_0206190 Ga0436364_0206190_7656_8684 290
31 3300005353 Ga0070669_100000711 Ga0070669_10000071118 291
32 3300025923 Ga0207681_10000137 Ga0207681_1000013734 291
33 3300005331 Ga0070670_100103389 Ga0070670_1001033892 292
34 3300005335 Ga0070666_10007703 Ga0070666_100077037 292
35 3300005340 Ga0070689_100189728 Ga0070689_1001897282 292
36 3300005355 Ga0070671_100000074 Ga0070671_10000007418 292
37 3300005617 Ga0068859_100373764 Ga0068859_1003737642 292
38 3300005618 Ga0068864_100057001 Ga0068864_1000570014 292
39 3300005842 Ga0068858_100115631 Ga0068858_1001156312 292
40 3300005843 Ga0068860_100009664 Ga0068860_1000096644 292
41 3300006931 Ga0097620_100373732 Ga0097620_1003737322 292
42 3300009177 Ga0105248_10152763 Ga0105248_101527632 292
43 3300013306 Ga0163162_10621521 Ga0163162_106215211 292
44 3300025903 Ga0207680_10056601 Ga0207680_100566013 292
45 3300025931 Ga0207644_10000053 Ga0207644_1000005349 292
46 3300025941 Ga0207711_10036752 Ga0207711_100367522 292
47 3300026035 Ga0207703_10151665 Ga0207703_101516652 292
48 3300026035 Ga0207703_10589864 Ga0207703_105898641 292
49 3300026095 Ga0207676_10028760 Ga0207676_100287602 292
50 3300028380 Ga0268265_10000083 Ga0268265_1000008398 292
51 3300028381 Ga0268264_10041458 Ga0268264_100414583 292
52 3300048904 Ga0496101_0056164 Ga0496101_0056164_407_1309 292
53 3300048905 Ga0496102_0024307 Ga0496102_0024307_2250_3152 292
54 3300048906 Ga0496103_0021602 Ga0496103_0021602_1928_2830 292
55 3300048907 Ga0496104_0412362 Ga0496104_0412362_201_1109 292
56 3300048909 Ga0496106_0003872 Ga0496106_0003872_6772_7674 292
57 3300048910 Ga0496107_0000157 Ga0496107_0000157_24657_25559 292
58 3300048915 Ga0496112_0008113 Ga0496112_0008113_3499_4401 292
59 3300048915 Ga0496112_0114961 Ga0496112_0114961_176_1072 292
60 3300048916 Ga0496113_0005887 Ga0496113_0005887_5095_5997 292
61 3300025916 Ga0207663_10042071 Ga0207663_100420712 293
62 3300028573 Ga0265334_10000111 Ga0265334_1000011122 293
63 iso_pu_bacteria 2939631187 2939633544 294
64 3300031456 Ga0307513_10008428 Ga0307513_1000842812 299
65 3300031730 Ga0307516_10000001 Ga0307516_10000001382 299
66 3300042876 Ga0451577_0232065 Ga0451577_0232065_651_1655 299
67 3300005327 Ga0070658_10098700 Ga0070658_100987002 300
68 3300005366 Ga0070659_100000316 Ga0070659_10000031619 300
69 3300005530 Ga0070679_100145165 Ga0070679_1001451651 300
70 3300005548 Ga0070665_100000221 Ga0070665_10000022174 300
71 3300028379 Ga0268266_10000005 Ga0268266_1000000573 300
72 3300037418 Ga0395900_0019152 Ga0395900_0019152_331_1404 300
73 3300037471 Ga0395905_0283813 Ga0395905_0283813_316_1389 300
74 3300037471 Ga0395905_0304149 Ga0395905_0304149_402_1457 300
75 3300048918 Ga0496115_0063820 Ga0496115_0063820_346_1401 300
76 3300005341 Ga0070691_10133973 Ga0070691_101339731 301
77 3300005435 Ga0070714_100070589 Ga0070714_1000705893 301
78 3300005458 Ga0070681_10168357 Ga0070681_101683571 301
79 3300006177 Ga0075362_10023750 Ga0075362_100237502 301
80 3300009093 Ga0105240_10054250 Ga0105240_100542506 301
81 3300009093 Ga0105240_10185794 Ga0105240_101857943 301
82 3300025912 Ga0207707_10132271 Ga0207707_101322713 301
83 3300025913 Ga0207695_10048189 Ga0207695_100481892 301
84 3300025929 Ga0207664_10059566 Ga0207664_100595663 301
85 3300035113 Ga0373936_0015953 Ga0373936_0015953_533_1576 301
86 3300037312 Ga0395899_0000223 Ga0395899_0000223_17125_18180 301
87 3300037418 Ga0395900_0000008 Ga0395900_0000008_187599_188654 301
88 3300038443 Ga0395901_0000008 Ga0395901_0000008_291812_292867 301
89 3300049581 Ga0501047_0003112 Ga0501047_0003112_10005_11066 301
90 3300026089 Ga0207648_10065881 Ga0207648_100658813 302
91 3300031235 Ga0265330_10005616 Ga0265330_100056162 302
92 3300031247 Ga0265340_10032513 Ga0265340_100325132 302
93 3300031344 Ga0265316_10062242 Ga0265316_100622422 302
94 3300031595 Ga0265313_10001937 Ga0265313_100019373 302
95 3300031712 Ga0265342_10032612 Ga0265342_100326122 302
96 3300006195 Ga0075366_10020884 Ga0075366_100208842 304
97 3300009177 Ga0105248_10000097 Ga0105248_1000009710 304
98 3300009551 Ga0105238_10209575 Ga0105238_102095752 304
99 3300014325 Ga0163163_10318523 Ga0163163_103185232 304
100 3300025934 Ga0207686_10032081 Ga0207686_100320812 304
101 3300025941 Ga0207711_10008527 Ga0207711_1000852710 304
102 3300047320 Ga0495672_0029643 Ga0495672_0029643_1351_2394 304
103 3300005844 Ga0068862_100048512 Ga0068862_1000485122 305
104 3300021361 Ga0213872_10043055 Ga0213872_100430552 305
105 3300039447 Ga0436361_0767272 Ga0436361_0767272_16828_17898 305
106 3300031247 Ga0265340_10000139 Ga0265340_1000013918 306
107 3300031344 Ga0265316_10003200 Ga0265316_100032007 306
108 3300049574 Ga0501038_0216104 Ga0501038_0216104_402_1352 306
109 3300049823 Ga0501044_0025679 Ga0501044_0025679_3187_4137 306
110 3300005844 Ga0068862_100000072 Ga0068862_10000007221 308
111 3300025928 Ga0207700_10230014 Ga0207700_102300143 308
112 3300031240 Ga0265320_10001310 Ga0265320_100013104 308
113 3300026118 Ga0207675_100321145 Ga0207675_1003211451 310
114 3300028380 Ga0268265_10199232 Ga0268265_101992322 310
115 3300028800 Ga0265338_10030250 Ga0265338_100302505 310
116 3300028800 Ga0265338_10033503 Ga0265338_100335034 310
117 3300031247 Ga0265340_10004967 Ga0265340_100049675 310
118 3300031711 Ga0265314_10031367 Ga0265314_100313672 310
119 3300028800 Ga0265338_10013350 Ga0265338_100133506 311
120 3300031235 Ga0265330_10021582 Ga0265330_100215822 311
121 3300031241 Ga0265325_10001606 Ga0265325_1000160615 311
122 3300031247 Ga0265340_10001587 Ga0265340_1000158713 311
123 3300031249 Ga0265339_10015987 Ga0265339_100159874 311
124 3300031711 Ga0265314_10005424 Ga0265314_100054249 311
125 3300031712 Ga0265342_10009827 Ga0265342_100098274 311
126 3300028800 Ga0265338_10198437 Ga0265338_101984372 312
127 3300005335 Ga0070666_10000362 Ga0070666_1000036217 313
128 3300005434 Ga0070709_10001248 Ga0070709_100012485 313
129 3300005436 Ga0070713_100000002 Ga0070713_10000000242 313
130 3300005563 Ga0068855_100055562 Ga0068855_1000555621 313
131 3300005614 Ga0068856_100000312 Ga0068856_10000031216 313
132 3300006175 Ga0070712_100000045 Ga0070712_10000004532 313
133 3300006871 Ga0075434_100063324 Ga0075434_1000633243 313
134 3300006914 Ga0075436_100000255 Ga0075436_10000025523 313
135 3300025906 Ga0207699_10000133 Ga0207699_1000013316 313
136 3300025915 Ga0207693_10000035 Ga0207693_1000003595 313
137 3300025916 Ga0207663_10049784 Ga0207663_100497841 313
138 3300025928 Ga0207700_10000037 Ga0207700_1000003726 313
139 3300025929 Ga0207664_10086365 Ga0207664_100863653 313
140 3300026078 Ga0207702_10000007 Ga0207702_10000007153 313
141 3300026078 Ga0207702_10000012 Ga0207702_1000001284 313
142 3300031238 Ga0265332_10070504 Ga0265332_100705042 313
143 3300031241 Ga0265325_10000079 Ga0265325_1000007924 313
144 3300031249 Ga0265339_10009598 Ga0265339_100095989 313
145 3300039437 Ga0436365_0983540 Ga0436365_0983540_12685_13704 313
146 3300049589 Ga0501073_0104775 Ga0501073_0104775_100_1059 313
147 3300054114 Ga0501084_0031164 Ga0501084_0031164_523_1482 313
148 3300060353 Ga0501082_0169685 Ga0501082_0169685_741_1736 317
149 3300049579 Ga0501043_0129525 Ga0501043_0129525_312_1271 318
150 3300049822 Ga0501035_0113546 Ga0501035_0113546_299_1258 318
151 3300049823 Ga0501044_0123375 Ga0501044_0123375_1120_2079 318
152 3300005336 Ga0070680_100001296 Ga0070680_1000012963 319
153 3300005344 Ga0070661_100058522 Ga0070661_1000585222 319
154 3300005458 Ga0070681_10000003 Ga0070681_10000003238 319
155 3300005530 Ga0070679_100000756 Ga0070679_1000007563 319
156 3300005539 Ga0068853_100004228 Ga0068853_1000042283 319
157 3300005539 Ga0068853_100274062 Ga0068853_1002740621 319
158 3300005563 Ga0068855_100000006 Ga0068855_10000000649 319
159 3300005616 Ga0068852_100103808 Ga0068852_1001038081 319
160 3300009093 Ga0105240_10000357 Ga0105240_1000035752 319
161 3300009093 Ga0105240_10157420 Ga0105240_101574202 319
162 3300009177 Ga0105248_10000001 Ga0105248_10000001784 319
163 3300009177 Ga0105248_10537462 Ga0105248_105374622 319
164 3300009551 Ga0105238_10441399 Ga0105238_104413992 319
165 3300010375 Ga0105239_10002644 Ga0105239_1000264420 319
166 3300010375 Ga0105239_10067340 Ga0105239_100673404 319
167 3300010375 Ga0105239_10134072 Ga0105239_101340723 319
168 3300013105 Ga0157369_10041451 Ga0157369_100414514 319
169 3300021377 Ga0213874_10003497 Ga0213874_100034974 319
170 3300021384 Ga0213876_10000727 Ga0213876_1000072718 319
171 3300025912 Ga0207707_10000001 Ga0207707_10000001816 319
172 3300025913 Ga0207695_10000004 Ga0207695_10000004814 319
173 3300025917 Ga0207660_10000806 Ga0207660_100008063 319
174 3300025920 Ga0207649_10006099 Ga0207649_100060992 319
175 3300025921 Ga0207652_10000094 Ga0207652_10000094104 319
176 3300025924 Ga0207694_10000014 Ga0207694_10000014142 319
177 3300025941 Ga0207711_10000001 Ga0207711_100000011087 319
178 3300025949 Ga0207667_10000051 Ga0207667_10000051111 319
179 3300026041 Ga0207639_10002016 Ga0207639_100020163 319
180 3300026041 Ga0207639_10241784 Ga0207639_102417843 319
181 3300026142 Ga0207698_10085583 Ga0207698_100855832 319
182 3300028573 Ga0265334_10034054 Ga0265334_100340543 319
183 3300028577 Ga0265318_10000107 Ga0265318_1000010757 319
184 3300028800 Ga0265338_10000006 Ga0265338_10000006373 319
185 3300029957 Ga0265324_10035583 Ga0265324_100355833 319
186 3300031241 Ga0265325_10000003 Ga0265325_1000000317 319
187 3300031242 Ga0265329_10018429 Ga0265329_100184291 319
188 3300031249 Ga0265339_10000132 Ga0265339_1000013242 319
189 3300031250 Ga0265331_10001823 Ga0265331_100018234 319
190 3300031711 Ga0265314_10003029 Ga0265314_1000302913 319
191 3300031712 Ga0265342_10041560 Ga0265342_100415603 319
192 3300031730 Ga0307516_10012000 Ga0307516_1001200010 319
193 3300039437 Ga0436365_1168772 Ga0436365_1168772_64550_65569 319
194 3300039450 Ga0436363_1600004 Ga0436363_1600004_1886_2896 319
195 3300046462 Ga0495651_0118207 Ga0495651_0118207_497_1498 319
196 3300047444 Ga0495675_0212047 Ga0495675_0212047_141_1139 319
197 3300049460 Ga0495682_0009269 Ga0495682_0009269_1616_2698 319
198 3300049569 Ga0501032_0150944 Ga0501032_0150944_149_1150 319
199 3300049571 Ga0501034_0061009 Ga0501034_0061009_451_1452 319
200 3300049571 Ga0501034_0096127 Ga0501034_0096127_726_1739 319
201 3300049581 Ga0501047_0019275 Ga0501047_0019275_1225_2238 319
202 3300049581 Ga0501047_0074043 Ga0501047_0074043_1571_2572 319
203 3300049581 Ga0501047_0396324 Ga0501047_0396324_92_1093 319
204 3300049583 Ga0501067_0029871 Ga0501067_0029871_1373_2374 319
205 3300049585 Ga0501069_0068439 Ga0501069_0068439_863_1861 319
206 3300049586 Ga0501070_0007866 Ga0501070_0007866_2813_3814 319
207 3300049588 Ga0501072_0003480 Ga0501072_0003480_564_1577 319
208 3300049741 Ga0501079_0158455 Ga0501079_0158455_121_1122 319
209 3300049742 Ga0501080_0222076 Ga0501080_0222076_59_1060 319
210 3300049744 Ga0501083_0224882 Ga0501083_0224882_207_1208 319
211 3300049822 Ga0501035_0003064 Ga0501035_0003064_1436_2437 319
212 3300049823 Ga0501044_0005416 Ga0501044_0005416_1927_2928 319
213 3300053154 Ga0500619_017856 Ga0500619_017856_698_1699 319
214 3300054114 Ga0501084_0048721 Ga0501084_0048721_964_1965 319
215 3300009551 Ga0105238_10416072 Ga0105238_104160722 321
216 3300035113 Ga0373936_0015333 Ga0373936_0015333_1700_2737 321
217 3300036401 Ga0373937_0393466 Ga0373937_0393466_175_1212 321
218 3300003320 rootH2_10022937 rootH2_1002293710 323
219 3300005339 Ga0070660_100009488 Ga0070660_1000094883 323
220 3300005341 Ga0070691_10001684 Ga0070691_100016846 323
221 3300005341 Ga0070691_10045777 Ga0070691_100457772 323
222 3300005344 Ga0070661_100003574 Ga0070661_1000035742 323
223 3300005366 Ga0070659_100042190 Ga0070659_1000421903 323
224 3300005435 Ga0070714_100101693 Ga0070714_1001016933 323
225 3300005436 Ga0070713_100185525 Ga0070713_1001855253 323
226 3300005439 Ga0070711_100037971 Ga0070711_1000379712 323
227 3300005439 Ga0070711_100051457 Ga0070711_1000514573 323
228 3300005458 Ga0070681_10007760 Ga0070681_100077606 323
229 3300005539 Ga0068853_100003014 Ga0068853_10000301418 323
230 3300005547 Ga0070693_100011699 Ga0070693_1000116995 323
231 3300005547 Ga0070693_100032119 Ga0070693_1000321193 323
232 3300005563 Ga0068855_100023239 Ga0068855_1000232397 323
233 3300005563 Ga0068855_100085643 Ga0068855_1000856433 323
234 3300005577 Ga0068857_100000722 Ga0068857_10000072217 323
235 3300005578 Ga0068854_100056272 Ga0068854_1000562722 323
236 3300005578 Ga0068854_100219578 Ga0068854_1002195782 323
237 3300005614 Ga0068856_100006510 Ga0068856_1000065102 323
238 3300005842 Ga0068858_100049085 Ga0068858_1000490853 323
239 3300006175 Ga0070712_100000018 Ga0070712_10000001894 323
240 3300006914 Ga0075436_100016414 Ga0075436_1000164145 323
241 3300007076 Ga0075435_100050659 Ga0075435_1000506593 323
242 3300009093 Ga0105240_10010445 Ga0105240_100104452 323
243 3300009093 Ga0105240_10016205 Ga0105240_100162052 323
244 3300009093 Ga0105240_10283651 Ga0105240_102836512 323
245 3300009174 Ga0105241_10196737 Ga0105241_101967373 323
246 3300009545 Ga0105237_10001328 Ga0105237_100013284 323
247 3300009551 Ga0105238_10001436 Ga0105238_1000143617 323
248 3300009551 Ga0105238_10027856 Ga0105238_100278563 323
249 3300010375 Ga0105239_10121022 Ga0105239_101210222 323
250 3300013100 Ga0157373_10005154 Ga0157373_100051545 323
251 3300013100 Ga0157373_10042659 Ga0157373_100426593 323
252 3300013102 Ga0157371_10060983 Ga0157371_100609833 323
253 3300013104 Ga0157370_10005953 Ga0157370_1000595317 323
254 3300013104 Ga0157370_10064278 Ga0157370_100642783 323
255 3300013105 Ga0157369_10001118 Ga0157369_1000111830 323
256 3300013307 Ga0157372_10041078 Ga0157372_100410785 323
257 3300013307 Ga0157372_10288020 Ga0157372_102880202 323
258 3300014497 Ga0182008_10153804 Ga0182008_101538041 323
259 3300014968 Ga0157379_10010218 Ga0157379_100102187 323
260 3300014968 Ga0157379_10010346 Ga0157379_100103465 323
261 3300014968 Ga0157379_10010756 Ga0157379_100107566 323
262 3300025909 Ga0207705_10000159 Ga0207705_1000015970 323
263 3300025911 Ga0207654_10132226 Ga0207654_101322263 323
264 3300025912 Ga0207707_10078856 Ga0207707_100788565 323
265 3300025913 Ga0207695_10007642 Ga0207695_100076421 323
266 3300025913 Ga0207695_10243695 Ga0207695_102436952 323
267 3300025914 Ga0207671_10047486 Ga0207671_100474863 323
268 3300025915 Ga0207693_10000145 Ga0207693_1000014557 323
269 3300025915 Ga0207693_10092452 Ga0207693_100924522 323
270 3300025917 Ga0207660_10056778 Ga0207660_100567783 323
271 3300025919 Ga0207657_10007294 Ga0207657_100072946 323
272 3300025920 Ga0207649_10000790 Ga0207649_1000079019 323
273 3300025921 Ga0207652_10001571 Ga0207652_1000157116 323
274 3300025928 Ga0207700_10164323 Ga0207700_101643232 323
275 3300025932 Ga0207690_10069660 Ga0207690_100696603 323
276 3300025981 Ga0207640_10073938 Ga0207640_100739382 323
277 3300026041 Ga0207639_10006879 Ga0207639_100068794 323
278 3300026041 Ga0207639_10180680 Ga0207639_101806803 323
279 3300026078 Ga0207702_10002115 Ga0207702_1000211517 323
280 3300026116 Ga0207674_10000107 Ga0207674_100001078 323
281 3300028381 Ga0268264_10292192 Ga0268264_102921921 323
282 3300031247 Ga0265340_10000245 Ga0265340_1000024519 323
283 3300031250 Ga0265331_10000009 Ga0265331_10000009126 323
284 3300031250 Ga0265331_10000193 Ga0265331_1000019310 323
285 3300031251 Ga0265327_10000036 Ga0265327_10000036285 323
286 3300031711 Ga0265314_10005220 Ga0265314_100052203 323
287 3300031711 Ga0265314_10079180 Ga0265314_100791802 323
288 3300035118 Ga0373954_0088410 Ga0373954_0088410_98_1105 323
289 3300035120 Ga0373957_0076071 Ga0373957_0076071_40_1047 323
290 3300035172 Ga0373955_0043475 Ga0373955_0043475_906_1913 323
291 3300035691 Ga0373931_0017047 Ga0373931_0017047_1955_2962 323
292 3300035692 Ga0373935_0089323 Ga0373935_0089323_978_1985 323
293 3300035695 Ga0373927_0215252 Ga0373927_0215252_231_1238 323
294 3300035724 Ga0373933_0069008 Ga0373933_0069008_720_1727 323
295 3300036401 Ga0373937_0008234 Ga0373937_0008234_2908_3915 323
296 3300036401 Ga0373937_0016020 Ga0373937_0016020_4947_5954 323
297 3300036401 Ga0373937_0378281 Ga0373937_0378281_70_1131 323
298 3300037068 Ga0373925_0008822 Ga0373925_0008822_5209_6216 323
299 3300037068 Ga0373925_0281970 Ga0373925_0281970_243_1250 323
300 3300048903 Ga0496100_0288772 Ga0496100_0288772_105_1112 323
301 3300048907 Ga0496104_0233968 Ga0496104_0233968_447_1454 323
302 3300048910 Ga0496107_0071317 Ga0496107_0071317_290_1297 323
303 3300048910 Ga0496107_0159767 Ga0496107_0159767_382_1389 323
304 3300048914 Ga0496111_0063508 Ga0496111_0063508_1591_2598 323
305 3300049568 Ga0501031_0031029 Ga0501031_0031029_2238_3209 323
306 3300049568 Ga0501031_0268624 Ga0501031_0268624_28_1032 323
307 3300049569 Ga0501032_0047157 Ga0501032_0047157_917_1888 323
308 3300049569 Ga0501032_0073022 Ga0501032_0073022_306_1310 323
309 3300049570 Ga0501033_0026584 Ga0501033_0026584_1347_2438 323
310 3300049572 Ga0501036_0050128 Ga0501036_0050128_595_1599 323
311 3300049574 Ga0501038_0011736 Ga0501038_0011736_6755_7726 323
312 3300049575 Ga0501039_0193723 Ga0501039_0193723_144_1115 323
313 3300049579 Ga0501043_0040393 Ga0501043_0040393_1017_2021 323
314 3300049586 Ga0501070_0000794 Ga0501070_0000794_12773_13744 323
315 3300049586 Ga0501070_0011708 Ga0501070_0011708_4136_5170 323
316 3300049589 Ga0501073_0049148 Ga0501073_0049148_1615_2619 323
317 3300049742 Ga0501080_0005272 Ga0501080_0005272_6099_7070 323
318 3300049744 Ga0501083_0218293 Ga0501083_0218293_31_1035 323
319 3300049822 Ga0501035_0000425 Ga0501035_0000425_43278_44249 323
320 3300049822 Ga0501035_0188653 Ga0501035_0188653_436_1440 323
321 3300049822 Ga0501035_0305515 Ga0501035_0305515_160_1203 323
322 3300049823 Ga0501044_0024462 Ga0501044_0024462_3072_4163 323
323 3300049823 Ga0501044_0028873 Ga0501044_0028873_4715_5686 323
324 3300049823 Ga0501044_0109233 Ga0501044_0109233_613_1584 323
325 3300050512 nmdc:mga0n895_90006_c1 nmdc:mga0n895_90006_c1_23_1030 323
326 3300050513 nmdc:mga0rr50_135537_c1 nmdc:mga0rr50_135537_c1_421_1428 323
327 3300050514 nmdc:mga08x19_104222_c1 nmdc:mga08x19_104222_c1_838_1845 323
328 3300050514 nmdc:mga08x19_160812_c1 nmdc:mga08x19_160812_c1_114_1121 323
329 3300050514 nmdc:mga08x19_38_c1 nmdc:mga08x19_38_c1_144242_145249 323

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12146

Hydrolase_4

Serine aminopeptidase, S33

88

339

0.71

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

92

339

0.66

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

94

346

0.65

Structural Annotation

Top 5 Hits

ID Description Score Start End
8b6p-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.8694 44 164
8b6n-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) 0.8674 43 164
3bdi-assembly1.cif.gz_A crystal structure of predicted cib-like hydrolase (np_393672.1) from thermoplasma acidophilum at 1.45 a resolution 0.8419 43 313
8b6o-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) fused to m13 0.8283 36 164
3qit-assembly2.cif.gz_D thioesterase domain from curacin biosynthetic pathway 0.8276 43 309
ID Description Score Start End Superfamily
af_A0A0R0KMM0_1_93_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8798 42 129 3.40.50.12270
af_Q54CU1_1_267_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8753 57 159 3.40.50.1820
af_Q0IY30_3_145_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8674 257 313 3.40.50.1820
af_Q10QZ0_32_236_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.85 49 167 3.40.50.1820
af_Q9NQF3_11_190_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.849 44 175 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A7U4QVT7-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9759 22 318 GO:0006654
GO:0042171
GO:0052689
GO:0055088
AF-A0A258BYP3-F1-model_v4 Alpha/beta hydrolase 0.9702 32 110 GO:0016787
AF-A0A0F2P5T9-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9537 25 318 GO:0016020
AF-A0A7W9B7E5-F1-model_v4 Pimeloyl-ACP methyl ester carboxylesterase 0.9516 42 314
AF-A0A382Y1L5-F1-model_v4 AB hydrolase-1 domain-containing protein 0.95 29 103

Feature Viewer

pLDDT pTM Quality
92.95 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map