F409735

General Info

Members Datasets Scaffolds Average Seq Length
329 223 658 98

Family's Representative Sequence

Representative Sequence 3300032005|Ga0307411_10081744|Ga0307411_100817443
Length 97
Sequence MTAFNAVRFKVKPGRDQEFLDAHLSVDRDWPGLQRVNLIQTGEHDYCIIGEWDDMDSLGAARPHMVATLDSFRDTLEEIDGRGVTDPVSGPVVLELK

Samples

Sample ID Description Type Environment
1 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
11 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
90 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
91 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
92 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
93 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
94 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
95 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
157 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
158 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
159 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
160 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
161 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
162 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
163 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
164 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
165 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
166 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
167 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
168 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
169 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
170 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
171 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
172 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
173 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
174 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
178 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
179 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
180 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
181 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
182 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
185 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
186 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
187 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
188 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
189 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
190 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
191 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
192 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
193 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
194 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
195 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
196 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
199 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
200 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
201 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
215 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
216 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
217 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
221 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
222 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
223 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.91
Nodule 0
Rhizoplane 6.99
Rhizosphere 92.1
Stem 0
Stem Tuber 0
Unclassified 17.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307411_10081744 3300032005 Bacteria 2226
2 2214544952 2209111006 Bacteria 6057
3 ARcpr5oldR_c000033 3300000041 Bacteria 27450
4 ARSoilYngRDRAFT_c00013 3300000042 Bacteria 27224
5 ARcpr5yngRDRAFT_c000033 3300000043 Bacteria 21895
6 ARCol0oldRDRAFT_c00264 3300000045 Bacteria 4993
7 ARCol0yngRDRAFT_1000097 3300000652 Bacteria 16244
8 JGI24737J22298_10002829 3300001990 Bacteria 6149
9 JGI24742J22300_10105213 3300002244 Unclassified 548
10 Ga0065717_1001974 3300005276 Bacteria 4433
11 Ga0065716_1001719 3300005277 Bacteria 3847
12 Ga0065704_10075446 3300005289 Bacteria 5585
13 Ga0065712_10071540 3300005290 Bacteria 5201
14 Ga0065715_10002396 3300005293 Bacteria 4823
15 Ga0070676_10889274 3300005328 Unclassified 663
16 Ga0070676_11391816 3300005328 Unclassified 538
17 Ga0070670_100783297 3300005331 Unclassified 860
18 Ga0070670_101022183 3300005331 Bacteria 752
19 Ga0070680_100080092 3300005336 Bacteria 2693
20 Ga0070680_100366760 3300005336 Bacteria 1225
21 Ga0070680_101331874 3300005336 Bacteria 621
22 Ga0070682_100281428 3300005337 Bacteria 1212
23 Ga0070660_100153115 3300005339 Bacteria 1855
24 Ga0070689_100032322 3300005340 Bacteria 3979
25 Ga0070691_10256660 3300005341 Unclassified 939
26 Ga0070687_100923935 3300005343 Bacteria 627
27 Ga0070692_10133953 3300005345 Unclassified 1396
28 Ga0070668_100064329 3300005347 Bacteria 2844
29 Ga0070668_100470519 3300005347 Bacteria 1084
30 Ga0070668_100694591 3300005347 Bacteria 897
31 Ga0070669_101844722 3300005353 Bacteria 528
32 Ga0070675_100030716 3300005354 Bacteria 4338
33 Ga0070675_100653286 3300005354 Bacteria 956
34 Ga0070671_100506023 3300005355 Bacteria 1039
35 Ga0070671_100795959 3300005355 Bacteria 823
36 Ga0070674_101756868 3300005356 Bacteria 562
37 Ga0070673_100274258 3300005364 Bacteria 1477
38 Ga0070688_100075603 3300005365 Bacteria 2165
39 Ga0070659_100015250 3300005366 Bacteria 5752
40 Ga0070659_100846734 3300005366 Bacteria 797
41 Ga0070659_100905222 3300005366 Unclassified 771
42 Ga0070667_100151130 3300005367 Bacteria 2040
43 Ga0070714_101388914 3300005435 Bacteria 686
44 Ga0070713_102455536 3300005436 Bacteria 504
45 Ga0070701_10161529 3300005438 Bacteria 1298
46 Ga0070701_10448746 3300005438 Bacteria 827
47 Ga0070711_101739273 3300005439 Bacteria 547
48 Ga0070705_100529486 3300005440 Unclassified 900
49 Ga0070700_100013443 3300005441 Bacteria 4598
50 Ga0070700_101096894 3300005441 Unclassified 659
51 Ga0070694_100025893 3300005444 Bacteria 3798
52 Ga0070663_101464989 3300005455 Bacteria 606
53 Ga0070678_100549389 3300005456 Bacteria 1025
54 Ga0070678_100731265 3300005456 Bacteria 894
55 Ga0070662_100017666 3300005457 Bacteria 4812
56 Ga0070662_100332726 3300005457 Bacteria 1241
57 Ga0070662_101570252 3300005457 Bacteria 568
58 Ga0070681_10093692 3300005458 Bacteria 2952
59 Ga0070681_10399249 3300005458 Bacteria 1286
60 Ga0070685_10015453 3300005466 Bacteria 4055
61 Ga0070699_101706477 3300005518 Unclassified 577
62 Ga0070679_100651940 3300005530 Bacteria 995
63 Ga0070679_100801683 3300005530 Bacteria 885
64 Ga0070684_100150675 3300005535 Bacteria 2107
65 Ga0070684_100268293 3300005535 Bacteria 1562
66 Ga0068853_100783466 3300005539 Unclassified 912
67 Ga0070672_101528203 3300005543 Bacteria 598
68 Ga0070686_100031588 3300005544 Bacteria 3239
69 Ga0070695_100000617 3300005545 Bacteria 18898
70 Ga0070696_100199634 3300005546 Bacteria 1492
71 Ga0070696_100422754 3300005546 Bacteria 1046
72 Ga0070693_100339621 3300005547 Unclassified 1025
73 Ga0070665_100386892 3300005548 Unclassified 1406
74 Ga0068855_101675565 3300005563 Bacteria 649
75 Ga0070664_100387073 3300005564 Bacteria 1277
76 Ga0068856_100571069 3300005614 Bacteria 1152
77 Ga0070702_100604821 3300005615 Bacteria 822
78 Ga0070702_101190631 3300005615 Unclassified 614
79 Ga0068859_100030931 3300005617 Bacteria 5372
80 Ga0068859_100457542 3300005617 Bacteria 1372
81 Ga0068864_100587992 3300005618 Bacteria 1079
82 Ga0068863_100381571 3300005841 Bacteria 1376
83 Ga0068858_100128900 3300005842 Bacteria 2371
84 Ga0068860_101320163 3300005843 Bacteria 742
85 Ga0068862_100777123 3300005844 Bacteria 934
86 Ga0081455_10016328 3300005937 Bacteria 7173
87 Ga0070717_10208219 3300006028 Bacteria 1715
88 Ga0075363_100495766 3300006048 Unclassified 725
89 Ga0070712_101129197 3300006175 Bacteria 681
90 Ga0097621_100203020 3300006237 Bacteria 1722
91 Ga0097621_100480552 3300006237 Bacteria 1123
92 Ga0075370_10306468 3300006353 Bacteria 945
93 Ga0068871_100130654 3300006358 Bacteria 2129
94 Ga0068871_100252036 3300006358 Bacteria 1538
95 Ga0068871_101211256 3300006358 Unclassified 708
96 Ga0075428_100070939 3300006844 Bacteria 3808
97 Ga0075433_10373445 3300006852 Bacteria 1259
98 Ga0075434_100131366 3300006871 Bacteria 2523
99 Ga0097620_100030929 3300006931 Bacteria 5372
100 Ga0097620_100457487 3300006931 Bacteria 1372
101 Ga0099795_10427458 3300007788 Unclassified 606
102 Ga0105240_10270968 3300009093 Bacteria 1954
103 Ga0105240_11226224 3300009093 Bacteria 794
104 Ga0111539_10004171 3300009094 Bacteria 18956
105 Ga0111539_13361930 3300009094 Unclassified 515
106 Ga0105245_10015432 3300009098 Bacteria 6660
107 Ga0105247_10065716 3300009101 Bacteria 2257
108 Ga0105243_10372435 3300009148 Bacteria 1318
109 Ga0105243_10599574 3300009148 Bacteria 1060
110 Ga0105241_10492095 3300009174 Bacteria 1092
111 Ga0105242_10162679 3300009176 Bacteria 1955
112 Ga0105242_11602144 3300009176 Bacteria 685
113 Ga0105248_12797845 3300009177 Unclassified 556
114 Ga0105237_10028091 3300009545 Bacteria 5732
115 Ga0105237_10814767 3300009545 Bacteria 940
116 Ga0105238_10167544 3300009551 Bacteria 2173
117 Ga0105249_10618656 3300009553 Bacteria 1139
118 Ga0105249_11940567 3300009553 Bacteria 661
119 Ga0105249_12073962 3300009553 Bacteria 641
120 Ga0105249_12303007 3300009553 Unclassified 611
121 Ga0105239_11154127 3300010375 Bacteria 892
122 Ga0157337_1022910 3300012483 Unclassified 590
123 Ga0157343_1033425 3300012488 Unclassified 529
124 Ga0157335_1002032 3300012492 Bacteria 1178
125 Ga0157323_1027261 3300012495 Unclassified 585
126 Ga0157339_1000743 3300012505 Bacteria 1777
127 Ga0157326_1040087 3300012513 Unclassified 654
128 Ga0157338_1012644 3300012515 Unclassified 885
129 Ga0157373_11424942 3300013100 Unclassified 527
130 Ga0157378_10580729 3300013297 Unclassified 1130
131 Ga0157378_10950719 3300013297 Unclassified 892
132 Ga0163162_10014965 3300013306 Bacteria 7577
133 Ga0163162_10309069 3300013306 Bacteria 1713
134 Ga0163162_11000707 3300013306 Bacteria 945
135 Ga0157372_10104133 3300013307 Bacteria 3243
136 Ga0157375_10034829 3300013308 Bacteria 4800
137 Ga0163163_10738475 3300014325 Bacteria 1048
138 Ga0163163_10795924 3300014325 Bacteria 1009
139 Ga0163163_12844551 3300014325 Unclassified 540
140 Ga0157379_10941117 3300014968 Bacteria 821
141 Ga0157376_10876169 3300014969 Bacteria 914
142 Ga0207697_10007720 3300025315 Bacteria 4767
143 Ga0207710_10118527 3300025900 Bacteria 1262
144 Ga0207645_10165520 3300025907 Unclassified 1448
145 Ga0207645_10977032 3300025907 Unclassified 574
146 Ga0207645_11165934 3300025907 Unclassified 518
147 Ga0207684_11146970 3300025910 Unclassified 645
148 Ga0207707_10329274 3300025912 Bacteria 1318
149 Ga0207707_10357015 3300025912 Bacteria 1259
150 Ga0207707_11023705 3300025912 Bacteria 677
151 Ga0207671_10980967 3300025914 Unclassified 666
152 Ga0207660_10364316 3300025917 Bacteria 1160
153 Ga0207662_10624498 3300025918 Bacteria 751
154 Ga0207657_10071241 3300025919 Unclassified 2944
155 Ga0207652_10664276 3300025921 Bacteria 931
156 Ga0207652_10968825 3300025921 Bacteria 749
157 Ga0207646_11854224 3300025922 Unclassified 515
158 Ga0207659_10133529 3300025926 Bacteria 1919
159 Ga0207659_10462961 3300025926 Bacteria 1069
160 Ga0207687_10004397 3300025927 Bacteria 9405
161 Ga0207700_10533087 3300025928 Bacteria 1041
162 Ga0207644_11086387 3300025931 Unclassified 672
163 Ga0207690_10439445 3300025932 Bacteria 1047
164 Ga0207690_10493911 3300025932 Bacteria 989
165 Ga0207706_10601021 3300025933 Bacteria 945
166 Ga0207706_10945459 3300025933 Bacteria 726
167 Ga0207686_10648517 3300025934 Bacteria 835
168 Ga0207686_10681114 3300025934 Unclassified 816
169 Ga0207709_10001173 3300025935 Bacteria 18975
170 Ga0207709_10347333 3300025935 Bacteria 1119
171 Ga0207669_10437535 3300025937 Bacteria 1033
172 Ga0207711_10889218 3300025941 Unclassified 828
173 Ga0207661_10141361 3300025944 Bacteria 2072
174 Ga0207679_10195703 3300025945 Bacteria 1685
175 Ga0207651_10246649 3300025960 Bacteria 1459
176 Ga0207651_11898030 3300025960 Unclassified 536
177 Ga0207712_10728863 3300025961 Bacteria 867
178 Ga0207712_10852499 3300025961 Bacteria 803
179 Ga0207668_10193149 3300025972 Bacteria 1615
180 Ga0207668_10790808 3300025972 Bacteria 839
181 Ga0207668_11795018 3300025972 Bacteria 553
182 Ga0207658_10053359 3300025986 Bacteria 2987
183 Ga0207677_10128273 3300026023 Bacteria 1921
184 Ga0207677_11591224 3300026023 Bacteria 605
185 Ga0207703_12206135 3300026035 Bacteria 527
186 Ga0207639_10755532 3300026041 Unclassified 904
187 Ga0207678_10336993 3300026067 Bacteria 1299
188 Ga0207678_11888523 3300026067 Unclassified 521
189 Ga0207708_10023852 3300026075 Bacteria 4626
190 Ga0207648_10176315 3300026089 Bacteria 1891
191 Ga0207676_10556852 3300026095 Bacteria 1096
192 Ga0207674_10184749 3300026116 Bacteria 2035
193 Ga0207675_100108389 3300026118 Bacteria 2619
194 Ga0207675_101099125 3300026118 Bacteria 815
195 Ga0207683_10595471 3300026121 Bacteria 1023
196 Ga0209998_10003722 3300027717 Bacteria 3303
197 Ga0207428_10000678 3300027907 Bacteria 39859
198 Ga0268266_11357039 3300028379 Unclassified 686
199 Ga0268266_11458357 3300028379 Unclassified 660
200 Ga0268265_10122347 3300028380 Bacteria 2146
201 Ga0268265_10813464 3300028380 Bacteria 912
202 Ga0268265_11577750 3300028380 Bacteria 661
203 Ga0268264_11125256 3300028381 Bacteria 794
204 Ga0307408_100048498 3300031548 Bacteria 3047
205 Ga0307408_100290514 3300031548 Bacteria 1365
206 Ga0307408_101074042 3300031548 Bacteria 745
207 Ga0307405_10090898 3300031731 Bacteria 2021
208 Ga0307405_10206281 3300031731 Bacteria 1431
209 Ga0307413_10001304 3300031824 Bacteria 9319
210 Ga0307413_10102396 3300031824 Bacteria 1895
211 Ga0307413_10124969 3300031824 Bacteria 1750
212 Ga0307410_10007645 3300031852 Bacteria 5929
213 Ga0307410_10040681 3300031852 Bacteria 3060
214 Ga0307410_10119226 3300031852 Bacteria 1921
215 Ga0307410_10992075 3300031852 Bacteria 724
216 Ga0307410_11666641 3300031852 Unclassified 564
217 Ga0307406_10141912 3300031901 Bacteria 1701
218 Ga0307406_11973877 3300031901 Unclassified 521
219 Ga0307407_10008326 3300031903 Bacteria 4752
220 Ga0307407_10141082 3300031903 Bacteria 1554
221 Ga0307407_10373957 3300031903 Bacteria 1015
222 Ga0307412_10324442 3300031911 Bacteria 1226
223 Ga0307412_10667725 3300031911 Bacteria 888
224 Ga0307409_100024104 3300031995 Bacteria 4235
225 Ga0307409_100024459 3300031995 Bacteria 4212
226 Ga0307409_100247791 3300031995 Bacteria 1627
227 Ga0307409_100265824 3300031995 Bacteria 1577
228 Ga0307409_100469744 3300031995 Bacteria 1218
229 Ga0307409_100927966 3300031995 Unclassified 885
230 Ga0307409_101224667 3300031995 Bacteria 774
231 Ga0307409_101375173 3300031995 Bacteria 732
232 Ga0307416_100007873 3300032002 Bacteria 6816
233 Ga0307416_100119060 3300032002 Bacteria 2348
234 Ga0307416_100448262 3300032002 Bacteria 1342
235 Ga0307416_101213288 3300032002 Unclassified 860
236 Ga0307416_102581137 3300032002 Bacteria 606
237 Ga0307414_10019716 3300032004 Bacteria 4186
238 Ga0307414_10156133 3300032004 Bacteria 1806
239 Ga0307414_11002131 3300032004 Bacteria 769
240 Ga0307411_10039458 3300032005 Bacteria 2987
241 Ga0307411_10040785 3300032005 Bacteria 2947
242 Ga0307411_10062295 3300032005 Bacteria 2487
243 Ga0307411_10094518 3300032005 Bacteria 2096
244 Ga0307415_100003305 3300032126 Bacteria 8186
245 Ga0307415_100016710 3300032126 Bacteria 4381
246 Ga0307415_101167861 3300032126 Bacteria 724
247 Ga0373930_0000766 3300034816 Bacteria 4560
248 Ga0373950_0009552 3300034818 Bacteria 1551
249 Ga0373958_0002481 3300034819 Bacteria 2594
250 Ga0373959_0002707 3300034820 Bacteria 2810
251 Ga0373938_0007722 3300034957 Bacteria 1900
252 Ga0373929_0001433 3300035085 Bacteria 4560
253 Ga0373940_0000016 3300035088 Bacteria 20620
254 Ga0373949_0001846 3300035090 Bacteria 5764
255 Ga0373951_0007715 3300035091 Bacteria 2441
256 Ga0373952_0000255 3300035092 Bacteria 8698
257 Ga0373932_0000833 3300035112 Bacteria 9113
258 Ga0373939_0001758 3300035114 Bacteria 5216
259 Ga0373941_0000257 3300035115 Bacteria 10203
260 Ga0373957_0369259 3300035120 Bacteria 614
261 Ga0373960_0000119 3300035121 Bacteria 12681
262 Ga0373942_0000440 3300035207 Bacteria 11637
263 Ga0373961_0000997 3300035241 Bacteria 9304
264 Ga0373931_0025621 3300035691 Bacteria 2995
265 Ga0373937_0038296 3300036401 Bacteria 4369
266 Ga0373937_0302083 3300036401 Bacteria 1513
267 Ga0373925_0281169 3300037068 Bacteria 1340
268 Ga0439465_0385861 3300041413 Bacteria 532
269 Ga0439449_0053421 3300042007 Bacteria 1493
270 Ga0439446_0210089 3300042156 Bacteria 660
271 Ga0466961_0281519 3300044693 Bacteria 1018
272 Ga0453684_0278119 3300044712 Bacteria 1910
273 Ga0466959_0052356 3300045049 Bacteria 2990
274 Ga0451576_0018446 3300045051 Bacteria 7649
275 Ga0495629_0116527 3300046459 Bacteria 1862
276 Ga0495662_0180954 3300046476 Bacteria 1039
277 Ga0495664_0579319 3300046477 Bacteria 668
278 Ga0495631_0526998 3300046518 Unclassified 503
279 Ga0495663_0006464 3300046525 Bacteria 3237
280 Ga0495598_0005475 3300046537 Bacteria 2817
281 Ga0495621_0008070 3300046539 Bacteria 3140
282 Ga0495621_0045047 3300046539 Bacteria 1561
283 Ga0495633_0001909 3300046558 Bacteria 15173
284 Ga0495667_0962233 3300046559 Bacteria 522
285 Ga0495634_0052903 3300046642 Bacteria 2721
286 Ga0495659_0447872 3300046664 Unclassified 562
287 Ga0495657_0341398 3300046675 Bacteria 888
288 Ga0495669_0009216 3300046684 Bacteria 4160
289 Ga0495613_0401675 3300046689 Unclassified 935
290 Ga0495670_0008222 3300046691 Bacteria 5128
291 Ga0495674_0444465 3300047319 Bacteria 1042
292 Ga0495677_0364791 3300047445 Unclassified 570
293 Ga0495602_0500399 3300048088 Bacteria 850
294 Ga0496102_0567716 3300048905 Bacteria 1057
295 Ga0496104_0007035 3300048907 Bacteria 9921
296 Ga0496104_0031431 3300048907 Bacteria 4937
297 Ga0496104_0053978 3300048907 Bacteria 3798
298 Ga0496105_0031644 3300048908 Bacteria 4337
299 Ga0496105_0032893 3300048908 Bacteria 4256
300 Ga0496105_0209415 3300048908 Bacteria 1589
301 Ga0496106_0870706 3300048909 Unclassified 712
302 Ga0496108_0162369 3300048911 Bacteria 1931
303 Ga0496108_0694291 3300048911 Unclassified 883
304 Ga0496109_0011968 3300048912 Bacteria 7471
305 Ga0496110_0052687 3300048913 Bacteria 3576
306 Ga0496110_0109350 3300048913 Bacteria 2482
307 Ga0496111_0377549 3300048914 Unclassified 1048
308 Ga0496112_0112238 3300048915 Bacteria 2695
309 Ga0496112_0707521 3300048915 Bacteria 935
310 Ga0496112_1191007 3300048915 Bacteria 679
311 Ga0496113_0005312 3300048916 Bacteria 8019
312 Ga0496114_0347318 3300048917 Unclassified 1312
313 Ga0496114_1178396 3300048917 Bacteria 652
314 Ga0496115_0156816 3300048918 Unclassified 1881
315 Ga0496115_0410481 3300048918 Bacteria 1098
316 Ga0496115_1442143 3300048918 Unclassified 507
317 Ga0501242_058375 3300049674 Bacteria 582
318 Ga0501080_0445732 3300049742 Bacteria 1161
319 Ga0501083_0083779 3300049744 Bacteria 2112
320 Ga0501083_0617308 3300049744 Bacteria 705
321 Ga0501268_009047 3300049765 Bacteria 1523
322 nmdc:mga08y16_10745_c1 3300050511 Bacteria 9609
323 nmdc:mga0n895_1494446_c1 3300050512 Bacteria 642
324 nmdc:mga0n895_202149_c1 3300050512 Bacteria 2017
325 nmdc:mga0n895_41153_c1 3300050512 Bacteria 4491
326 nmdc:mga0a205_17106_c1 3300050515 Bacteria 4805
327 Ga0495612_0547786 3300053078 Unclassified 533
328 Ga0500616_0016101 3300053153 Bacteria 4264
329 Ga0501082_0000460 3300060353 Bacteria 35943
330 Ga0307411_10081744
331 2214544952
332 ARcpr5oldR_c000033
333 ARSoilYngRDRAFT_c00013
334 ARcpr5yngRDRAFT_c000033
335 ARCol0oldRDRAFT_c00264
336 ARCol0yngRDRAFT_1000097
337 JGI24737J22298_10002829
338 JGI24742J22300_10105213
339 Ga0065717_1001974
340 Ga0065716_1001719
341 Ga0065704_10075446
342 Ga0065712_10071540
343 Ga0065715_10002396
344 Ga0070676_10889274
345 Ga0070676_11391816
346 Ga0070670_100783297
347 Ga0070670_101022183
348 Ga0070680_100080092
349 Ga0070680_100366760
350 Ga0070680_101331874
351 Ga0070682_100281428
352 Ga0070660_100153115
353 Ga0070689_100032322
354 Ga0070691_10256660
355 Ga0070687_100923935
356 Ga0070692_10133953
357 Ga0070668_100064329
358 Ga0070668_100470519
359 Ga0070668_100694591
360 Ga0070669_101844722
361 Ga0070675_100030716
362 Ga0070675_100653286
363 Ga0070671_100506023
364 Ga0070671_100795959
365 Ga0070674_101756868
366 Ga0070673_100274258
367 Ga0070688_100075603
368 Ga0070659_100015250
369 Ga0070659_100846734
370 Ga0070659_100905222
371 Ga0070667_100151130
372 Ga0070714_101388914
373 Ga0070713_102455536
374 Ga0070701_10161529
375 Ga0070701_10448746
376 Ga0070711_101739273
377 Ga0070705_100529486
378 Ga0070700_100013443
379 Ga0070700_101096894
380 Ga0070694_100025893
381 Ga0070663_101464989
382 Ga0070678_100549389
383 Ga0070678_100731265
384 Ga0070662_100017666
385 Ga0070662_100332726
386 Ga0070662_101570252
387 Ga0070681_10093692
388 Ga0070681_10399249
389 Ga0070685_10015453
390 Ga0070699_101706477
391 Ga0070679_100651940
392 Ga0070679_100801683
393 Ga0070684_100150675
394 Ga0070684_100268293
395 Ga0068853_100783466
396 Ga0070672_101528203
397 Ga0070686_100031588
398 Ga0070695_100000617
399 Ga0070696_100199634
400 Ga0070696_100422754
401 Ga0070693_100339621
402 Ga0070665_100386892
403 Ga0068855_101675565
404 Ga0070664_100387073
405 Ga0068856_100571069
406 Ga0070702_100604821
407 Ga0070702_101190631
408 Ga0068859_100030931
409 Ga0068859_100457542
410 Ga0068864_100587992
411 Ga0068863_100381571
412 Ga0068858_100128900
413 Ga0068860_101320163
414 Ga0068862_100777123
415 Ga0081455_10016328
416 Ga0070717_10208219
417 Ga0075363_100495766
418 Ga0070712_101129197
419 Ga0097621_100203020
420 Ga0097621_100480552
421 Ga0075370_10306468
422 Ga0068871_100130654
423 Ga0068871_100252036
424 Ga0068871_101211256
425 Ga0075428_100070939
426 Ga0075433_10373445
427 Ga0075434_100131366
428 Ga0097620_100030929
429 Ga0097620_100457487
430 Ga0099795_10427458
431 Ga0105240_10270968
432 Ga0105240_11226224
433 Ga0111539_10004171
434 Ga0111539_13361930
435 Ga0105245_10015432
436 Ga0105247_10065716
437 Ga0105243_10372435
438 Ga0105243_10599574
439 Ga0105241_10492095
440 Ga0105242_10162679
441 Ga0105242_11602144
442 Ga0105248_12797845
443 Ga0105237_10028091
444 Ga0105237_10814767
445 Ga0105238_10167544
446 Ga0105249_10618656
447 Ga0105249_11940567
448 Ga0105249_12073962
449 Ga0105249_12303007
450 Ga0105239_11154127
451 Ga0157337_1022910
452 Ga0157343_1033425
453 Ga0157335_1002032
454 Ga0157323_1027261
455 Ga0157339_1000743
456 Ga0157326_1040087
457 Ga0157338_1012644
458 Ga0157373_11424942
459 Ga0157378_10580729
460 Ga0157378_10950719
461 Ga0163162_10014965
462 Ga0163162_10309069
463 Ga0163162_11000707
464 Ga0157372_10104133
465 Ga0157375_10034829
466 Ga0163163_10738475
467 Ga0163163_10795924
468 Ga0163163_12844551
469 Ga0157379_10941117
470 Ga0157376_10876169
471 Ga0207697_10007720
472 Ga0207710_10118527
473 Ga0207645_10165520
474 Ga0207645_10977032
475 Ga0207645_11165934
476 Ga0207684_11146970
477 Ga0207707_10329274
478 Ga0207707_10357015
479 Ga0207707_11023705
480 Ga0207671_10980967
481 Ga0207660_10364316
482 Ga0207662_10624498
483 Ga0207657_10071241
484 Ga0207652_10664276
485 Ga0207652_10968825
486 Ga0207646_11854224
487 Ga0207659_10133529
488 Ga0207659_10462961
489 Ga0207687_10004397
490 Ga0207700_10533087
491 Ga0207644_11086387
492 Ga0207690_10439445
493 Ga0207690_10493911
494 Ga0207706_10601021
495 Ga0207706_10945459
496 Ga0207686_10648517
497 Ga0207686_10681114
498 Ga0207709_10001173
499 Ga0207709_10347333
500 Ga0207669_10437535
501 Ga0207711_10889218
502 Ga0207661_10141361
503 Ga0207679_10195703
504 Ga0207651_10246649
505 Ga0207651_11898030
506 Ga0207712_10728863
507 Ga0207712_10852499
508 Ga0207668_10193149
509 Ga0207668_10790808
510 Ga0207668_11795018
511 Ga0207658_10053359
512 Ga0207677_10128273
513 Ga0207677_11591224
514 Ga0207703_12206135
515 Ga0207639_10755532
516 Ga0207678_10336993
517 Ga0207678_11888523
518 Ga0207708_10023852
519 Ga0207648_10176315
520 Ga0207676_10556852
521 Ga0207674_10184749
522 Ga0207675_100108389
523 Ga0207675_101099125
524 Ga0207683_10595471
525 Ga0209998_10003722
526 Ga0207428_10000678
527 Ga0268266_11357039
528 Ga0268266_11458357
529 Ga0268265_10122347
530 Ga0268265_10813464
531 Ga0268265_11577750
532 Ga0268264_11125256
533 Ga0307408_100048498
534 Ga0307408_100290514
535 Ga0307408_101074042
536 Ga0307405_10090898
537 Ga0307405_10206281
538 Ga0307413_10001304
539 Ga0307413_10102396
540 Ga0307413_10124969
541 Ga0307410_10007645
542 Ga0307410_10040681
543 Ga0307410_10119226
544 Ga0307410_10992075
545 Ga0307410_11666641
546 Ga0307406_10141912
547 Ga0307406_11973877
548 Ga0307407_10008326
549 Ga0307407_10141082
550 Ga0307407_10373957
551 Ga0307412_10324442
552 Ga0307412_10667725
553 Ga0307409_100024104
554 Ga0307409_100024459
555 Ga0307409_100247791
556 Ga0307409_100265824
557 Ga0307409_100469744
558 Ga0307409_100927966
559 Ga0307409_101224667
560 Ga0307409_101375173
561 Ga0307416_100007873
562 Ga0307416_100119060
563 Ga0307416_100448262
564 Ga0307416_101213288
565 Ga0307416_102581137
566 Ga0307414_10019716
567 Ga0307414_10156133
568 Ga0307414_11002131
569 Ga0307411_10039458
570 Ga0307411_10040785
571 Ga0307411_10062295
572 Ga0307411_10094518
573 Ga0307415_100003305
574 Ga0307415_100016710
575 Ga0307415_101167861
576 Ga0373930_0000766
577 Ga0373950_0009552
578 Ga0373958_0002481
579 Ga0373959_0002707
580 Ga0373938_0007722
581 Ga0373929_0001433
582 Ga0373940_0000016
583 Ga0373949_0001846
584 Ga0373951_0007715
585 Ga0373952_0000255
586 Ga0373932_0000833
587 Ga0373939_0001758
588 Ga0373941_0000257
589 Ga0373957_0369259
590 Ga0373960_0000119
591 Ga0373942_0000440
592 Ga0373961_0000997
593 Ga0373931_0025621
594 Ga0373937_0038296
595 Ga0373937_0302083
596 Ga0373925_0281169
597 Ga0439465_0385861
598 Ga0439449_0053421
599 Ga0439446_0210089
600 Ga0466961_0281519
601 Ga0453684_0278119
602 Ga0466959_0052356
603 Ga0451576_0018446
604 Ga0495629_0116527
605 Ga0495662_0180954
606 Ga0495664_0579319
607 Ga0495631_0526998
608 Ga0495663_0006464
609 Ga0495598_0005475
610 Ga0495621_0008070
611 Ga0495621_0045047
612 Ga0495633_0001909
613 Ga0495667_0962233
614 Ga0495634_0052903
615 Ga0495659_0447872
616 Ga0495657_0341398
617 Ga0495669_0009216
618 Ga0495613_0401675
619 Ga0495670_0008222
620 Ga0495674_0444465
621 Ga0495677_0364791
622 Ga0495602_0500399
623 Ga0496102_0567716
624 Ga0496104_0007035
625 Ga0496104_0031431
626 Ga0496104_0053978
627 Ga0496105_0031644
628 Ga0496105_0032893
629 Ga0496105_0209415
630 Ga0496106_0870706
631 Ga0496108_0162369
632 Ga0496108_0694291
633 Ga0496109_0011968
634 Ga0496110_0052687
635 Ga0496110_0109350
636 Ga0496111_0377549
637 Ga0496112_0112238
638 Ga0496112_0707521
639 Ga0496112_1191007
640 Ga0496113_0005312
641 Ga0496114_0347318
642 Ga0496114_1178396
643 Ga0496115_0156816
644 Ga0496115_0410481
645 Ga0496115_1442143
646 Ga0501242_058375
647 Ga0501080_0445732
648 Ga0501083_0083779
649 Ga0501083_0617308
650 Ga0501268_009047
651 nmdc:mga08y16_10745_c1
652 nmdc:mga0n895_1494446_c1
653 nmdc:mga0n895_202149_c1
654 nmdc:mga0n895_41153_c1
655 nmdc:mga0a205_17106_c1
656 Ga0495612_0547786
657 Ga0500616_0016101
658 Ga0501082_0000460

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03992

ABM

Antibiotic biosynthesis monooxygenase

2

78

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dpo-assembly1.cif.gz_B crystal structure of a conserved protein mm_1583 from methanosarcina mazei go1 0.8426 1 77
2bbe-assembly1.cif.gz_A crystal structure of protein so0527 from shewanella oneidensis 0.8018 2 77
3mcs-assembly1.cif.gz_A crystal structure of putative monooxygenase (fn1347) from fusobacterium nucleatum subsp. nucleatum atcc 25586 at 2.55 a resolution 0.7971 2 77
2pgc-assembly1.cif.gz_C crystal structure of a a marine metagenome protein (jcvi_pep_1096685590403) from uncultured marine organism at 2.53 a resolution 0.7935 3 77
6fxd-assembly1.cif.gz_B-2 crystal structure of mupz from pseudomonas fluorescens 0.793 2 77
ID Description Score Start End Superfamily
3gz7B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8026 1 88 3.30.70.100
2bbeA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8018 2 77 3.30.70.100
3fgvB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7943 3 87 3.30.70.100
af_P9WLA3_114_212_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7908 2 71 3.30.70.100
af_Q55CR9_1_97_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7859 2 78 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A7Z9M6G9-F1-model_v4 ABM domain-containing protein 0.9638 1 76
AF-A0A382LTA5-F1-model_v4 ABM domain-containing protein 0.96 4 77
AF-A0A017HNH6-F1-model_v4 ABM domain-containing protein 0.9322 1 94
AF-F2I1S1-F1-model_v4 ABM domain-containing protein 0.9286 2 95
AF-A0A2D6ZRM9-F1-model_v4 ABM domain-containing protein 0.9278 3 94

Map