F409509

General Info

Members Datasets Scaffolds Average Seq Length
329 156 302 211

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10001024|Ga0065704_100010243
Length 207
Sequence MAFLIQIHPQNPQARLVRQAIAAIRDGSVVVYPTDSSYALGCLIGDKEAMERIRRIRDVDVKHHNFTLVCRDLSEIAHYARVDNSQYRTLKAFTPGPYTFLLEATREVPKRLQNPKRRTIGLRVPDNAIVRMLLAELGEPIMSSTLLLPGETQSPTDPAEIKERLDHLVDLVIDGGTGGVEPSSVVDLSGVVPVVVRRGKGDVSAFE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231024 Pseudomonas sp. GM84 Isolate Nodule
3 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
4 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
5 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
6 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
7 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
8 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
9 2765235841 Pseudomonas putida AA7 Isolate Unclassified
10 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
11 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
12 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
13 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
14 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
15 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
16 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
17 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
18 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
19 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
20 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
21 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
22 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
23 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
24 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
25 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
40 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
41 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
59 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
62 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
63 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
64 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
65 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
66 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
67 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
68 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
69 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
70 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
71 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
72 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
73 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
74 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
75 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
76 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
77 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
83 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
84 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
85 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
86 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
87 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
88 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
89 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
90 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
91 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
92 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
93 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
94 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
95 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
96 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
97 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
98 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
99 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
100 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
101 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
102 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
103 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
104 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
105 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
109 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
110 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
111 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
112 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
113 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
114 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
115 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
116 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
117 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
118 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
119 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
120 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
121 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
122 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
123 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
124 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
125 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
126 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
127 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
128 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
129 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
130 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
131 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
132 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
133 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
134 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
135 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
136 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
137 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
138 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
146 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
149 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
150 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
151 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
152 8052494512 Pseudomonas putida LD6 Isolate Unclassified
153 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
154 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
155 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
156 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.19
Metatranscriptomes 7.6
Isolates 8.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.91
Nodule 0.61
Rhizoplane 2.13
Rhizosphere 66.87
Stem 0
Stem Tuber 0
Unclassified 29.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1943499 2162886007 Bacteria 2923
2 SwRhRL2b_contig_2814049 2162886007 Bacteria 4078
3 rootH2_10316524 3300003320 Bacteria 1138
4 rootH1_10012258 3300003323 Bacteria 148276
5 Ga0065704_10001024 3300005289 Bacteria 10443
6 Ga0065712_10323617 3300005290 Unclassified 824
7 Ga0070670_100168063 3300005331 Bacteria 1902
8 Ga0070689_101205908 3300005340 Unclassified 679
9 Ga0070669_100130235 3300005353 Bacteria 1929
10 Ga0070673_100460360 3300005364 Bacteria 1145
11 Ga0070665_100335679 3300005548 Bacteria 1516
12 Ga0068859_100042106 3300005617 Bacteria 4587
13 Ga0068864_100023874 3300005618 Bacteria 5139
14 Ga0068863_100021902 3300005841 Bacteria 6098
15 Ga0068862_100152002 3300005844 Bacteria 2061
16 Ga0068871_100253583 3300006358 Bacteria 1533
17 Ga0097620_100042107 3300006931 Bacteria 4587
18 Ga0105251_10014011 3300009011 Bacteria 4453
19 Ga0105251_10053810 3300009011 Bacteria 1913
20 Ga0105251_10200213 3300009011 Bacteria 900
21 Ga0105244_10009660 3300009036 Bacteria 5908
22 Ga0105244_10060149 3300009036 Bacteria 1914
23 Ga0105244_10208972 3300009036 Bacteria 918
24 Ga0105250_10025335 3300009092 Bacteria 2391
25 Ga0105243_10029070 3300009148 Bacteria 4248
26 Ga0105248_10171386 3300009177 Bacteria 2446
27 Ga0105249_10007124 3300009553 Bacteria 9757
28 Ga0157373_10010864 3300013100 Bacteria 6701
29 Ga0157370_10043679 3300013104 Bacteria 4312
30 Ga0157372_10009752 3300013307 Bacteria 10213
31 Ga0157372_10035325 3300013307 Bacteria 5502
32 Ga0209676_1001049 3300025292 Bacteria 31809
33 Ga0207696_1000010 3300025711 Bacteria 534681
34 Ga0207696_1002950 3300025711 Bacteria 7969
35 Ga0207696_1011416 3300025711 Bacteria 3199
36 Ga0207655_1000175 3300025728 Bacteria 115631
37 Ga0207655_1000558 3300025728 Bacteria 46519
38 Ga0207655_1001489 3300025728 Bacteria 21420
39 Ga0207655_1002712 3300025728 Bacteria 13858
40 Ga0207655_1015181 3300025728 Bacteria 4299
41 Ga0207713_1000102 3300025735 Bacteria 139512
42 Ga0207713_1000937 3300025735 Bacteria 26175
43 Ga0207713_1007706 3300025735 Bacteria 6294
44 Ga0207713_1009363 3300025735 Bacteria 5524
45 Ga0207709_10023856 3300025935 Bacteria 3487
46 Ga0207711_10640945 3300025941 Unclassified 991
47 Ga0207689_10227140 3300025942 Bacteria 1543
48 Ga0207679_10766426 3300025945 Bacteria 878
49 Ga0207712_10070588 3300025961 Bacteria 2510
50 Ga0207676_10083674 3300026095 Bacteria 2599
51 Ga0209389_1000063 3300027296 Bacteria 102403
52 Ga0209371_1000237 3300027312 Bacteria 69091
53 Ga0268265_10124631 3300028380 Bacteria 2129
54 Ga0268256_1001693 3300030500 Bacteria 12583
55 Ga0265327_10003150 3300031251 Bacteria 16180
56 Ga0307408_100011413 3300031548 Bacteria 5870
57 Ga0307408_100954373 3300031548 Bacteria 788
58 Ga0316575_10007914 3300031665 Bacteria 3857
59 Ga0316575_10058122 3300031665 Bacteria 1542
60 Ga0316575_10090008 3300031665 Bacteria 1242
61 Ga0316579_10000143 3300031691 Bacteria 20021
62 Ga0316579_10003387 3300031691 Bacteria 6204
63 Ga0316579_10006847 3300031691 Bacteria 4674
64 Ga0316579_10018105 3300031691 Bacteria 3096
65 Ga0316579_10051594 3300031691 Bacteria 1925
66 Ga0316576_10012034 3300031727 Bacteria 5700
67 Ga0316576_10023555 3300031727 Bacteria 4290
68 Ga0316576_10027719 3300031727 Bacteria 3984
69 Ga0316576_10047625 3300031727 Bacteria 3107
70 Ga0316576_10100452 3300031727 Bacteria 2162
71 Ga0316576_10104409 3300031727 Bacteria 2120
72 Ga0316576_10164742 3300031727 Bacteria 1672
73 Ga0316576_10194986 3300031727 Bacteria 1526
74 Ga0316576_10205672 3300031727 Bacteria 1482
75 Ga0316576_10274139 3300031727 Bacteria 1264
76 Ga0316578_10007595 3300031728 Bacteria 5451
77 Ga0316578_10024840 3300031728 Bacteria 3364
78 Ga0316578_10028963 3300031728 Bacteria 3139
79 Ga0316578_10035683 3300031728 Bacteria 2859
80 Ga0316578_10101428 3300031728 Bacteria 1725
81 Ga0316578_10190566 3300031728 Bacteria 1235
82 Ga0316578_10247230 3300031728 Bacteria 1070
83 Ga0316577_10002453 3300031733 Bacteria 9194
84 Ga0316577_10008639 3300031733 Bacteria 5463
85 Ga0316577_10030004 3300031733 Bacteria 3035
86 Ga0316577_10080078 3300031733 Unclassified 1825
87 Ga0316577_10086073 3300031733 Bacteria 1759
88 Ga0316577_10257504 3300031733 Bacteria 987
89 Ga0316577_10294977 3300031733 Bacteria 918
90 Ga0307413_10024052 3300031824 Bacteria 3313
91 Ga0307409_101097833 3300031995 Bacteria 817
92 Ga0307416_100629037 3300032002 Bacteria 1156
93 Ga0307411_10010349 3300032005 Bacteria 4967
94 Ga0307415_100216167 3300032126 Bacteria 1533
95 Ga0316583_10005389 3300032133 Bacteria 4591
96 Ga0316583_10006140 3300032133 Bacteria 4323
97 Ga0316583_10018162 3300032133 Bacteria 2526
98 Ga0316583_10051616 3300032133 Bacteria 1447
99 Ga0316585_10012532 3300032137 Bacteria 2513
100 Ga0316585_10032554 3300032137 Bacteria 1642
101 Ga0316585_10129368 3300032137 Bacteria 832
102 Ga0316580_10003876 3300032139 Bacteria 4293
103 Ga0316580_10048972 3300032139 Bacteria 1302
104 Ga0316580_10081688 3300032139 Bacteria 988
105 Ga0316580_10085015 3300032139 Bacteria 968
106 Ga0316593_10001247 3300032168 Bacteria 5500
107 Ga0316593_10002953 3300032168 Bacteria 4135
108 Ga0316593_10003086 3300032168 Bacteria 4074
109 Ga0316593_10003254 3300032168 Bacteria 3998
110 Ga0316593_10007358 3300032168 Bacteria 3021
111 Ga0316593_10011874 3300032168 Bacteria 2543
112 Ga0316593_10015049 3300032168 Bacteria 2320
113 Ga0316593_10017170 3300032168 Bacteria 2204
114 Ga0316593_10020964 3300032168 Bacteria 2038
115 Ga0316593_10023334 3300032168 Bacteria 1951
116 Ga0316593_10180446 3300032168 Bacteria 776
117 Ga0316592_1003377 3300033524 Bacteria 2872
118 Ga0316592_1005906 3300033524 Bacteria 2342
119 Ga0316592_1012742 3300033524 Unclassified 1727
120 Ga0316592_1014257 3300033524 Bacteria 1647
121 Ga0316588_1000466 3300033528 Bacteria 5461
122 Ga0316588_1001272 3300033528 Bacteria 4061
123 Ga0316588_1001422 3300033528 Bacteria 3911
124 Ga0316588_1005699 3300033528 Bacteria 2445
125 Ga0316588_1006549 3300033528 Bacteria 2332
126 Ga0316587_1004818 3300033529 Bacteria 1986
127 Ga0316596_1000872 3300033541 Bacteria 5667
128 Ga0316596_1005090 3300033541 Bacteria 2989
129 Ga0316596_1012959 3300033541 Bacteria 2056
130 Ga0316596_1018347 3300033541 Bacteria 1767
131 Ga0316574_0004118 3300035398 Bacteria 7579
132 Ga0316574_0005771 3300035398 Bacteria 6638
133 Ga0316574_0024890 3300035398 Bacteria 3587
134 Ga0316574_0032847 3300035398 Bacteria 3156
135 Ga0316574_0045396 3300035398 Unclassified 2721
136 Ga0316574_0251371 3300035398 Bacteria 1129
137 Ga0316582_0002409 3300036647 Bacteria 8769
138 Ga0316582_0003473 3300036647 Bacteria 7737
139 Ga0316582_0013068 3300036647 Bacteria 4660
140 Ga0316582_0032731 3300036647 Bacteria 3188
141 Ga0316582_0063698 3300036647 Bacteria 2370
142 Ga0316582_0077910 3300036647 Bacteria 2158
143 Ga0316582_0113710 3300036647 Bacteria 1804
144 Ga0316582_0182465 3300036647 Bacteria 1428
145 Ga0316582_0187858 3300036647 Bacteria 1407
146 Ga0316582_0461799 3300036647 Bacteria 875
147 Ga0316584_0004769 3300036712 Bacteria 8993
148 Ga0316584_0009244 3300036712 Bacteria 6830
149 Ga0316584_0012325 3300036712 Bacteria 6027
150 Ga0316584_0019502 3300036712 Bacteria 4903
151 Ga0316584_0020149 3300036712 Bacteria 4831
152 Ga0316584_0029483 3300036712 Bacteria 4050
153 Ga0316584_0035145 3300036712 Bacteria 3718
154 Ga0316584_0113622 3300036712 Bacteria 2026
155 Ga0316584_0129934 3300036712 Bacteria 1881
156 Ga0316584_0580535 3300036712 Bacteria 779
157 Ga0316581_0021062 3300037588 Bacteria 1913
158 Ga0316581_0031117 3300037588 Bacteria 1608
159 Ga0316581_0063917 3300037588 Bacteria 1130
160 Ga0400484_11910 3300038725 Bacteria 5099
161 Ga0400484_15183 3300038725 Bacteria 13471
162 Ga0400484_29508 3300038725 Bacteria 16874
163 Ga0400490_00731 3300038726 Bacteria 33699
164 Ga0400490_12869 3300038726 Bacteria 2194
165 Ga0400490_23755 3300038726 Bacteria 1878
166 Ga0400490_30897 3300038726 Bacteria 40161
167 Ga0400490_31014 3300038726 Bacteria 32492
168 Ga0400490_44681 3300038726 Bacteria 22328
169 Ga0400490_55188 3300038726 Bacteria 7561
170 Ga0400490_57276 3300038726 Bacteria 13433
171 Ga0400490_59722 3300038726 Bacteria 3919
172 Ga0400490_60783 3300038726 Bacteria 8098
173 Ga0400491_00612 3300038727 Bacteria 2093
174 Ga0400491_07747 3300038727 Bacteria 2489
175 Ga0400491_11079 3300038727 Bacteria 6550
176 Ga0400485_07884 3300038735 Bacteria 123132
177 Ga0400485_12800 3300038735 Bacteria 1895
178 Ga0400485_13100 3300038735 Bacteria 12869
179 Ga0400485_17575 3300038735 Bacteria 1781
180 Ga0400488_01208 3300038741 Bacteria 1440
181 Ga0400488_02727 3300038741 Bacteria 6980
182 Ga0400488_14489 3300038741 Bacteria 5565
183 Ga0400488_27215 3300038741 Bacteria 1660
184 Ga0400488_53669 3300038741 Bacteria 15576
185 Ga0400488_56793 3300038741 Bacteria 3898
186 Ga0400488_63303 3300038741 Bacteria 1669
187 Ga0400486_00705 3300038742 Bacteria 5509
188 Ga0400486_02836 3300038742 Bacteria 1618
189 Ga0400486_07973 3300038742 Bacteria 5699
190 Ga0400486_22452 3300038742 Bacteria 5282
191 Ga0400486_28685 3300038742 Bacteria 138069
192 Ga0400483_002296 3300039062 Bacteria 2824
193 Ga0400483_009792 3300039062 Bacteria 11029
194 Ga0400483_015651 3300039062 Bacteria 1567
195 Ga0400483_074278 3300039062 Bacteria 2760
196 Ga0400483_078872 3300039062 Bacteria 19759
197 Ga0400483_118920 3300039062 Bacteria 1570
198 Ga0400483_123146 3300039062 Bacteria 21415
199 Ga0400483_155685 3300039062 Bacteria 16978
200 Ga0400483_209406 3300039062 Bacteria 5890
201 Ga0400483_212376 3300039062 Bacteria 1142
202 Ga0400483_222043 3300039062 Bacteria 1486
203 Ga0400483_254178 3300039062 Bacteria 2797
204 Ga0400489_74764 3300039093 Bacteria 10506
205 Ga0400489_75723 3300039093 Bacteria 3741
206 Ga0400487_12631 3300039110 Unclassified 2323
207 Ga0400487_25127 3300039110 Bacteria 3043
208 Ga0400487_27219 3300039110 Bacteria 3133
209 Ga0400487_32397 3300039110 Bacteria 69683
210 Ga0400487_43934 3300039110 Bacteria 27890
211 Ga0400487_63494 3300039110 Bacteria 48331
212 Ga0436362_1122012 3300039453 Bacteria 1289
213 Ga0439432_012606 3300042006 Bacteria 2889
214 Ga0439456_000027 3300042013 Bacteria 54335
215 Ga0450891_001953 3300042129 Bacteria 2111
216 Ga0450900_014454 3300042136 Bacteria 1053
217 Ga0450902_002139 3300042137 Bacteria 2779
218 Ga0450905_002043 3300042142 Bacteria 2576
219 Ga0450905_002139 3300042142 Bacteria 2525
220 Ga0439464_0019999 3300042439 Bacteria 1831
221 Ga0450901_000887 3300042533 Bacteria 3504
222 Ga0451577_0007794 3300042876 Bacteria 10494
223 Ga0451577_0054493 3300042876 Bacteria 3569
224 Ga0453683_0017287 3300044673 Bacteria 4646
225 Ga0453684_0043720 3300044712 Bacteria 6014
226 Ga0453684_0069239 3300044712 Bacteria 4476
227 Ga0453684_0346124 3300044712 Bacteria 1677
228 Ga0451576_0060401 3300045051 Bacteria 3955
229 Ga0451576_0194590 3300045051 Bacteria 2118
230 Ga0451576_0446395 3300045051 Bacteria 1358
231 Ga0495627_028198 3300046453 Bacteria 1795
232 Ga0495603_0016586 3300046455 Bacteria 4457
233 Ga0495591_000023 3300046458 Bacteria 191598
234 Ga0495591_012881 3300046458 Bacteria 3089
235 Ga0495605_0000291 3300046474 Bacteria 55348
236 Ga0495607_0001998 3300046501 Bacteria 17161
237 Ga0495637_0012328 3300046520 Bacteria 4092
238 Ga0495637_0119537 3300046520 Bacteria 1015
239 Ga0495637_0137699 3300046520 Bacteria 928
240 Ga0495643_0008064 3300046522 Bacteria 6713
241 Ga0495597_0000016 3300046542 Bacteria 167456
242 Ga0495597_0008329 3300046542 Bacteria 5197
243 Ga0495622_0014006 3300046557 Bacteria 3721
244 Ga0495649_0000343 3300046694 Bacteria 40082
245 Ga0495649_0264637 3300046694 Bacteria 881
246 Ga0495660_0001406 3300046810 Bacteria 16523
247 Ga0495672_0086316 3300047320 Bacteria 1736
248 Ga0495676_0066193 3300047321 Bacteria 2801
249 Ga0495680_0062775 3300047322 Bacteria 2855
250 Ga0495683_0000216 3300047323 Bacteria 54311
251 Ga0495673_0000834 3300047469 Bacteria 28754
252 Ga0496101_0298228 3300048904 Bacteria 1262
253 Ga0496110_0639481 3300048913 Bacteria 963
254 Ga0496114_0074108 3300048917 Bacteria 2866
255 Ga0496114_0164425 3300048917 Bacteria 1931
256 Ga0496117_0021938 3300048920 Bacteria 5141
257 Ga0496117_0062495 3300048920 Bacteria 2551
258 Ga0496118_0006597 3300048921 Bacteria 12676
259 Ga0496118_0043677 3300048921 Bacteria 3519
260 Ga0496118_0084662 3300048921 Bacteria 2211
261 Ga0496119_0000383 3300048922 Bacteria 60980
262 Ga0496119_0050855 3300048922 Bacteria 2551
263 Ga0496120_0000824 3300048923 Bacteria 44330
264 Ga0496121_0037496 3300048924 Bacteria 4304
265 Ga0496121_0249175 3300048924 Bacteria 1233
266 Ga0496122_0000703 3300048925 Bacteria 66086
267 Ga0496122_0007476 3300048925 Bacteria 12126
268 Ga0496122_0060619 3300048925 Bacteria 2785
269 Ga0496122_0216259 3300048925 Bacteria 1104
270 Ga0496123_0000175 3300048926 Bacteria 130079
271 Ga0496123_0001665 3300048926 Bacteria 29798
272 Ga0496123_0079780 3300048926 Bacteria 1998
273 Ga0496123_0113249 3300048926 Bacteria 1545
274 Ga0496124_0007618 3300048927 Bacteria 11475
275 Ga0496124_0010658 3300048927 Bacteria 9275
276 Ga0496124_0017428 3300048927 Bacteria 6768
277 Ga0496124_0360498 3300048927 Bacteria 1024
278 Ga0496125_0001171 3300048928 Bacteria 39699
279 Ga0496125_0016212 3300048928 Bacteria 7163
280 Ga0496125_0056209 3300048928 Bacteria 3198
281 Ga0496125_0249837 3300048928 Bacteria 1120
282 Ga0496125_0319700 3300048928 Bacteria 942
283 Ga0496126_0033435 3300048929 Bacteria 4838
284 Ga0495678_079035 3300049459 Bacteria 1186
285 Ga0501032_0091325 3300049569 Unclassified 2020
286 Ga0501032_0112470 3300049569 Bacteria 1801
287 Ga0501034_0000041 3300049571 Bacteria 229264
288 Ga0501037_0004006 3300049573 Bacteria 10681
289 Ga0501037_0007619 3300049573 Bacteria 7927
290 Ga0501038_0000746 3300049574 Bacteria 29017
291 Ga0501040_0001964 3300049576 Bacteria 13246
292 Ga0501040_0573860 3300049576 Bacteria 814
293 Ga0501042_0003594 3300049578 Bacteria 9779
294 Ga0501042_0376543 3300049578 Bacteria 1027
295 Ga0501047_0457475 3300049581 Unclassified 1105
296 Ga0501067_0127979 3300049583 Bacteria 1413
297 Ga0501069_0028355 3300049585 Bacteria 3069
298 Ga0501070_0115379 3300049586 Bacteria 2218
299 Ga0501075_0150616 3300049591 Unclassified 1773
300 Ga0501080_0010993 3300049742 Bacteria 8286
301 Ga0500618_007232 3300053125 Bacteria 3184
302 Ga0500659_0001773 3300053135 Bacteria 13486

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005290 Ga0065712_10323617 Ga0065712_103236171 203
2 3300005331 Ga0070670_100168063 Ga0070670_1001680632 203
3 3300005340 Ga0070689_101205908 Ga0070689_1012059081 203
4 3300005353 Ga0070669_100130235 Ga0070669_1001302351 203
5 3300005548 Ga0070665_100335679 Ga0070665_1003356792 203
6 3300005617 Ga0068859_100042106 Ga0068859_1000421067 203
7 3300005618 Ga0068864_100023874 Ga0068864_1000238743 203
8 3300005841 Ga0068863_100021902 Ga0068863_1000219024 203
9 3300005844 Ga0068862_100152002 Ga0068862_1001520022 203
10 3300006931 Ga0097620_100042107 Ga0097620_1000421077 203
11 3300009177 Ga0105248_10171386 Ga0105248_101713863 203
12 3300009553 Ga0105249_10007124 Ga0105249_100071246 203
13 3300025941 Ga0207711_10640945 Ga0207711_106409451 203
14 3300025961 Ga0207712_10070588 Ga0207712_100705882 203
15 3300026095 Ga0207676_10083674 Ga0207676_100836744 203
16 3300028380 Ga0268265_10124631 Ga0268265_101246313 203
17 3300047322 Ga0495680_0062775 Ga0495680_0062775_177_788 203
18 iso_pu_bacteria 2738541276 2738715261 204
19 iso_pu_bacteria 2808606379 2808940478 204
20 iso_pu_bacteria 2823421272 2823424191 204
21 iso_pu_bacteria 2919501602 2919503907 204
22 iso_pu_bacteria 2926063275 2926065520 204
23 iso_pu_bacteria 2599185155 2599327090 205
24 iso_pu_bacteria 2600255283 2601626648 205
25 iso_pu_bacteria 2738541271 2738690916 205
26 iso_pu_bacteria 2738543016 2739266690 205
27 iso_pu_bacteria 2806310737 2807409566 205
28 iso_pu_bacteria 2806310745 2807457868 205
29 iso_pu_bacteria 2826581358 2826585846 205
30 iso_pu_bacteria 2842815866 2842818889 205
31 iso_pu_bacteria 2842849001 2842850249 205
32 iso_pu_bacteria 2912963787 2912965229 205
33 iso_pu_bacteria 2919155634 2919158175 205
34 iso_pu_bacteria 2939651529 2939656708 205
35 2162886007 SwRhRL2b_contig_2814049 SwRhRL2b_0390.00001870 206
36 3300005289 Ga0065704_10001024 Ga0065704_100010243 206
37 3300005364 Ga0070673_100460360 Ga0070673_1004603602 206
38 3300006358 Ga0068871_100253583 Ga0068871_1002535832 206
39 3300025942 Ga0207689_10227140 Ga0207689_102271402 206
40 3300025945 Ga0207679_10766426 Ga0207679_107664261 206
41 3300031251 Ga0265327_10003150 Ga0265327_100031506 206
42 3300031548 Ga0307408_100954373 Ga0307408_1009543731 206
43 3300031665 Ga0316575_10058122 Ga0316575_100581222 206
44 3300031665 Ga0316575_10090008 Ga0316575_100900082 206
45 3300031691 Ga0316579_10003387 Ga0316579_100033872 206
46 3300031727 Ga0316576_10047625 Ga0316576_100476252 206
47 3300031728 Ga0316578_10101428 Ga0316578_101014282 206
48 3300031728 Ga0316578_10247230 Ga0316578_102472301 206
49 3300031733 Ga0316577_10257504 Ga0316577_102575041 206
50 3300031995 Ga0307409_101097833 Ga0307409_1010978332 206
51 3300032002 Ga0307416_100629037 Ga0307416_1006290372 206
52 3300032005 Ga0307411_10010349 Ga0307411_100103495 206
53 3300032126 Ga0307415_100216167 Ga0307415_1002161672 206
54 3300032133 Ga0316583_10018162 Ga0316583_100181623 206
55 3300032137 Ga0316585_10012532 Ga0316585_100125323 206
56 3300032137 Ga0316585_10129368 Ga0316585_101293681 206
57 3300032139 Ga0316580_10085015 Ga0316580_100850152 206
58 3300032168 Ga0316593_10180446 Ga0316593_101804461 206
59 3300035398 Ga0316574_0005771 Ga0316574_0005771_4481_5101 206
60 3300035398 Ga0316574_0045396 Ga0316574_0045396_354_974 206
61 3300035398 Ga0316574_0251371 Ga0316574_0251371_138_758 206
62 3300036712 Ga0316584_0129934 Ga0316584_0129934_74_694 206
63 3300036712 Ga0316584_0580535 Ga0316584_0580535_88_708 206
64 3300037588 Ga0316581_0063917 Ga0316581_0063917_484_1104 206
65 3300038726 Ga0400490_55188 Ga0400490_55188_1773_2393 206
66 3300038741 Ga0400488_27215 Ga0400488_27215_198_818 206
67 3300038741 Ga0400488_56793 Ga0400488_56793_1493_2113 206
68 3300038742 Ga0400486_00705 Ga0400486_00705_2288_2908 206
69 3300039062 Ga0400483_074278 Ga0400483_074278_2037_2657 206
70 3300039062 Ga0400483_222043 Ga0400483_222043_103_723 206
71 3300039093 Ga0400489_74764 Ga0400489_74764_3001_3621 206
72 3300039110 Ga0400487_27219 Ga0400487_27219_2226_2846 206
73 3300039453 Ga0436362_1122012 Ga0436362_1122012_140_760 206
74 3300042876 Ga0451577_0007794 Ga0451577_0007794_6158_6778 206
75 3300042876 Ga0451577_0054493 Ga0451577_0054493_495_1118 206
76 3300044673 Ga0453683_0017287 Ga0453683_0017287_3964_4584 206
77 3300044712 Ga0453684_0043720 Ga0453684_0043720_1306_1926 206
78 3300044712 Ga0453684_0069239 Ga0453684_0069239_3383_4006 206
79 3300044712 Ga0453684_0346124 Ga0453684_0346124_498_1121 206
80 3300045051 Ga0451576_0060401 Ga0451576_0060401_165_788 206
81 3300045051 Ga0451576_0194590 Ga0451576_0194590_1341_1964 206
82 3300045051 Ga0451576_0446395 Ga0451576_0446395_478_1101 206
83 3300031665 Ga0316575_10007914 Ga0316575_100079142 207
84 3300031691 Ga0316579_10018105 Ga0316579_100181052 207
85 3300031691 Ga0316579_10051594 Ga0316579_100515941 207
86 3300031727 Ga0316576_10012034 Ga0316576_100120343 207
87 3300031727 Ga0316576_10023555 Ga0316576_100235553 207
88 3300031727 Ga0316576_10027719 Ga0316576_100277193 207
89 3300031727 Ga0316576_10100452 Ga0316576_101004522 207
90 3300031727 Ga0316576_10104409 Ga0316576_101044093 207
91 3300031727 Ga0316576_10164742 Ga0316576_101647422 207
92 3300031727 Ga0316576_10194986 Ga0316576_101949862 207
93 3300031727 Ga0316576_10205672 Ga0316576_102056721 207
94 3300031727 Ga0316576_10274139 Ga0316576_102741392 207
95 3300031728 Ga0316578_10007595 Ga0316578_100075952 207
96 3300031728 Ga0316578_10024840 Ga0316578_100248402 207
97 3300031728 Ga0316578_10028963 Ga0316578_100289634 207
98 3300031728 Ga0316578_10035683 Ga0316578_100356833 207
99 3300031728 Ga0316578_10190566 Ga0316578_101905662 207
100 3300031733 Ga0316577_10002453 Ga0316577_100024536 207
101 3300031733 Ga0316577_10008639 Ga0316577_100086393 207
102 3300031733 Ga0316577_10080078 Ga0316577_100800782 207
103 3300031733 Ga0316577_10086073 Ga0316577_100860732 207
104 3300031733 Ga0316577_10294977 Ga0316577_102949772 207
105 3300032133 Ga0316583_10005389 Ga0316583_100053894 207
106 3300032133 Ga0316583_10051616 Ga0316583_100516162 207
107 3300032137 Ga0316585_10032554 Ga0316585_100325541 207
108 3300032139 Ga0316580_10003876 Ga0316580_100038764 207
109 3300032139 Ga0316580_10048972 Ga0316580_100489722 207
110 3300032139 Ga0316580_10081688 Ga0316580_100816882 207
111 3300032168 Ga0316593_10001247 Ga0316593_100012472 207
112 3300032168 Ga0316593_10002953 Ga0316593_100029535 207
113 3300032168 Ga0316593_10003086 Ga0316593_100030862 207
114 3300032168 Ga0316593_10003254 Ga0316593_100032544 207
115 3300032168 Ga0316593_10007358 Ga0316593_100073583 207
116 3300032168 Ga0316593_10011874 Ga0316593_100118742 207
117 3300032168 Ga0316593_10017170 Ga0316593_100171702 207
118 3300032168 Ga0316593_10020964 Ga0316593_100209642 207
119 3300032168 Ga0316593_10023334 Ga0316593_100233342 207
120 3300033524 Ga0316592_1003377 Ga0316592_10033773 207
121 3300033524 Ga0316592_1005906 Ga0316592_10059063 207
122 3300033524 Ga0316592_1012742 Ga0316592_10127422 207
123 3300033524 Ga0316592_1014257 Ga0316592_10142571 207
124 3300033528 Ga0316588_1000466 Ga0316588_10004663 207
125 3300033528 Ga0316588_1001272 Ga0316588_10012724 207
126 3300033528 Ga0316588_1001422 Ga0316588_10014222 207
127 3300033528 Ga0316588_1005699 Ga0316588_10056993 207
128 3300033528 Ga0316588_1006549 Ga0316588_10065492 207
129 3300033529 Ga0316587_1004818 Ga0316587_10048182 207
130 3300033541 Ga0316596_1000872 Ga0316596_10008725 207
131 3300033541 Ga0316596_1005090 Ga0316596_10050902 207
132 3300033541 Ga0316596_1012959 Ga0316596_10129592 207
133 3300033541 Ga0316596_1018347 Ga0316596_10183472 207
134 3300035398 Ga0316574_0004118 Ga0316574_0004118_6401_7024 207
135 3300035398 Ga0316574_0024890 Ga0316574_0024890_2021_2644 207
136 3300035398 Ga0316574_0032847 Ga0316574_0032847_1594_2217 207
137 3300036647 Ga0316582_0002409 Ga0316582_0002409_4786_5409 207
138 3300036647 Ga0316582_0003473 Ga0316582_0003473_4052_4675 207
139 3300036647 Ga0316582_0013068 Ga0316582_0013068_3568_4191 207
140 3300036647 Ga0316582_0032731 Ga0316582_0032731_878_1501 207
141 3300036647 Ga0316582_0113710 Ga0316582_0113710_239_862 207
142 3300036647 Ga0316582_0182465 Ga0316582_0182465_641_1264 207
143 3300036647 Ga0316582_0187858 Ga0316582_0187858_579_1202 207
144 3300036647 Ga0316582_0461799 Ga0316582_0461799_61_684 207
145 3300036712 Ga0316584_0004769 Ga0316584_0004769_2680_3303 207
146 3300036712 Ga0316584_0009244 Ga0316584_0009244_852_1475 207
147 3300036712 Ga0316584_0012325 Ga0316584_0012325_3931_4554 207
148 3300036712 Ga0316584_0019502 Ga0316584_0019502_1471_2094 207
149 3300036712 Ga0316584_0020149 Ga0316584_0020149_3190_3813 207
150 3300036712 Ga0316584_0029483 Ga0316584_0029483_2424_3047 207
151 3300036712 Ga0316584_0035145 Ga0316584_0035145_944_1567 207
152 3300036712 Ga0316584_0113622 Ga0316584_0113622_750_1373 207
153 3300037588 Ga0316581_0021062 Ga0316581_0021062_46_669 207
154 3300037588 Ga0316581_0031117 Ga0316581_0031117_615_1238 207
155 3300038725 Ga0400484_11910 Ga0400484_11910_1419_2042 207
156 3300038725 Ga0400484_15183 Ga0400484_15183_5128_5751 207
157 3300038725 Ga0400484_29508 Ga0400484_29508_10703_11326 207
158 3300038726 Ga0400490_00731 Ga0400490_00731_9117_9740 207
159 3300038726 Ga0400490_23755 Ga0400490_23755_1190_1813 207
160 3300038726 Ga0400490_31014 Ga0400490_31014_23558_24181 207
161 3300038726 Ga0400490_44681 Ga0400490_44681_13166_13789 207
162 3300038726 Ga0400490_57276 Ga0400490_57276_10964_11587 207
163 3300038726 Ga0400490_60783 Ga0400490_60783_447_1070 207
164 3300038727 Ga0400491_00612 Ga0400491_00612_885_1508 207
165 3300038727 Ga0400491_11079 Ga0400491_11079_3586_4209 207
166 3300038735 Ga0400485_07884 Ga0400485_07884_54713_55336 207
167 3300038735 Ga0400485_12800 Ga0400485_12800_124_747 207
168 3300038735 Ga0400485_13100 Ga0400485_13100_7824_8447 207
169 3300038741 Ga0400488_01208 Ga0400488_01208_271_894 207
170 3300038741 Ga0400488_14489 Ga0400488_14489_1156_1779 207
171 3300038741 Ga0400488_53669 Ga0400488_53669_1408_2031 207
172 3300038741 Ga0400488_63303 Ga0400488_63303_988_1611 207
173 3300038742 Ga0400486_02836 Ga0400486_02836_15_638 207
174 3300038742 Ga0400486_07973 Ga0400486_07973_3512_4135 207
175 3300038742 Ga0400486_22452 Ga0400486_22452_4393_5016 207
176 3300038742 Ga0400486_28685 Ga0400486_28685_67757_68380 207
177 3300039062 Ga0400483_002296 Ga0400483_002296_446_1069 207
178 3300039062 Ga0400483_009792 Ga0400483_009792_7640_8263 207
179 3300039062 Ga0400483_015651 Ga0400483_015651_24_647 207
180 3300039062 Ga0400483_078872 Ga0400483_078872_4534_5157 207
181 3300039062 Ga0400483_118920 Ga0400483_118920_27_650 207
182 3300039062 Ga0400483_123146 Ga0400483_123146_6152_6775 207
183 3300039062 Ga0400483_155685 Ga0400483_155685_15080_15703 207
184 3300039062 Ga0400483_209406 Ga0400483_209406_264_887 207
185 3300039062 Ga0400483_212376 Ga0400483_212376_234_857 207
186 3300039062 Ga0400483_254178 Ga0400483_254178_1733_2356 207
187 3300039093 Ga0400489_75723 Ga0400489_75723_1479_2102 207
188 3300039110 Ga0400487_12631 Ga0400487_12631_125_748 207
189 3300039110 Ga0400487_32397 Ga0400487_32397_1308_1931 207
190 3300039110 Ga0400487_43934 Ga0400487_43934_12957_13580 207
191 3300039110 Ga0400487_63494 Ga0400487_63494_8390_9013 207
192 3300049573 Ga0501037_0004006 Ga0501037_0004006_2768_3391 207
193 3300049576 Ga0501040_0001964 Ga0501040_0001964_6664_7287 207
194 3300049576 Ga0501040_0573860 Ga0501040_0573860_37_660 207
195 3300049578 Ga0501042_0003594 Ga0501042_0003594_370_993 207
196 3300049578 Ga0501042_0376543 Ga0501042_0376543_281_904 207
197 3300049586 Ga0501070_0115379 Ga0501070_0115379_767_1390 207
198 3300049742 Ga0501080_0010993 Ga0501080_0010993_2205_2828 207
199 3300003320 rootH2_10316524 rootH2_103165242 208
200 3300003323 rootH1_10012258 rootH1_1001225897 208
201 3300031548 Ga0307408_100011413 Ga0307408_1000114136 208
202 3300031691 Ga0316579_10006847 Ga0316579_100068474 208
203 3300031733 Ga0316577_10030004 Ga0316577_100300042 208
204 3300031824 Ga0307413_10024052 Ga0307413_100240524 208
205 3300032168 Ga0316593_10015049 Ga0316593_100150492 208
206 3300036647 Ga0316582_0063698 Ga0316582_0063698_255_881 208
207 3300036647 Ga0316582_0077910 Ga0316582_0077910_840_1466 208
208 3300042129 Ga0450891_001953 Ga0450891_001953_150_776 208
209 3300038726 Ga0400490_12869 Ga0400490_12869_470_1099 209
210 3300038726 Ga0400490_30897 Ga0400490_30897_38539_39168 209
211 3300038726 Ga0400490_59722 Ga0400490_59722_1368_1997 209
212 3300038727 Ga0400491_07747 Ga0400491_07747_1075_1704 209
213 3300038735 Ga0400485_17575 Ga0400485_17575_248_877 209
214 3300038741 Ga0400488_02727 Ga0400488_02727_5282_5911 209
215 3300039110 Ga0400487_25127 Ga0400487_25127_1427_2056 209
216 3300049569 Ga0501032_0091325 Ga0501032_0091325_605_1234 209
217 3300049573 Ga0501037_0007619 Ga0501037_0007619_3255_3884 209
218 3300049574 Ga0501038_0000746 Ga0501038_0000746_20189_20827 209
219 3300049583 Ga0501067_0127979 Ga0501067_0127979_54_683 209
220 3300049585 Ga0501069_0028355 Ga0501069_0028355_2136_2765 209
221 3300049591 Ga0501075_0150616 Ga0501075_0150616_271_900 209
222 iso_pu_bacteria 2511231024 2511374001 217
223 iso_pu_bacteria 2554235231 2555248634 217
224 iso_pu_bacteria 2765235841 2765582657 217
225 iso_pu_bacteria 3007803356 3007804464 217
226 iso_pu_bacteria 3007872151 3007872473 217
227 iso_pu_bacteria 8052494512 8052498574 217
228 iso_pu_bacteria 8054929484 8054933813 217
229 iso_pu_bacteria 8055878733 8055879448 217
230 iso_pu_bacteria 8056120720 8056122257 217
231 iso_pu_bacteria 8056137416 8056141511 217
232 3300031691 Ga0316579_10000143 Ga0316579_1000014321 219
233 3300032133 Ga0316583_10006140 Ga0316583_100061403 219
234 3300046455 Ga0495603_0016586 Ga0495603_0016586_119_781 219
235 3300046520 Ga0495637_0119537 Ga0495637_0119537_325_987 219
236 3300046520 Ga0495637_0137699 Ga0495637_0137699_171_833 219
237 3300046694 Ga0495649_0000343 Ga0495649_0000343_14713_15375 219
238 3300047321 Ga0495676_0066193 Ga0495676_0066193_292_954 219
239 3300047323 Ga0495683_0000216 Ga0495683_0000216_44488_45150 219
240 3300049459 Ga0495678_079035 Ga0495678_079035_178_840 219
241 3300053125 Ga0500618_007232 Ga0500618_007232_2201_2863 219
242 3300013100 Ga0157373_10010864 Ga0157373_100108647 220
243 3300025728 Ga0207655_1002712 Ga0207655_100271213 220
244 3300025735 Ga0207713_1000102 Ga0207713_100010286 220
245 3300046453 Ga0495627_028198 Ga0495627_028198_907_1575 220
246 3300046458 Ga0495591_012881 Ga0495591_012881_2327_2995 220
247 3300046557 Ga0495622_0014006 Ga0495622_0014006_1943_2611 220
248 3300048904 Ga0496101_0298228 Ga0496101_0298228_252_920 220
249 3300048921 Ga0496118_0084662 Ga0496118_0084662_76_744 220
250 3300048924 Ga0496121_0037496 Ga0496121_0037496_2593_3261 220
251 3300048925 Ga0496122_0000703 Ga0496122_0000703_30700_31368 220
252 3300048926 Ga0496123_0000175 Ga0496123_0000175_30723_31391 220
253 2162886007 SwRhRL2b_contig_1943499 SwRhRL2b_0982.00004200 221
254 3300009011 Ga0105251_10014011 Ga0105251_100140115 221
255 3300009011 Ga0105251_10053810 Ga0105251_100538102 221
256 3300009011 Ga0105251_10200213 Ga0105251_102002131 221
257 3300009036 Ga0105244_10009660 Ga0105244_100096604 221
258 3300009036 Ga0105244_10060149 Ga0105244_100601492 221
259 3300009036 Ga0105244_10208972 Ga0105244_102089722 221
260 3300009092 Ga0105250_10025335 Ga0105250_100253352 221
261 3300009148 Ga0105243_10029070 Ga0105243_100290703 221
262 3300013104 Ga0157370_10043679 Ga0157370_100436794 221
263 3300013307 Ga0157372_10009752 Ga0157372_1000975214 221
264 3300013307 Ga0157372_10035325 Ga0157372_100353254 221
265 3300025292 Ga0209676_1001049 Ga0209676_100104914 221
266 3300025711 Ga0207696_1000010 Ga0207696_1000010230 221
267 3300025711 Ga0207696_1002950 Ga0207696_10029507 221
268 3300025711 Ga0207696_1011416 Ga0207696_10114164 221
269 3300025728 Ga0207655_1000175 Ga0207655_100017579 221
270 3300025728 Ga0207655_1000558 Ga0207655_10005585 221
271 3300025728 Ga0207655_1001489 Ga0207655_100148917 221
272 3300025728 Ga0207655_1015181 Ga0207655_10151815 221
273 3300025735 Ga0207713_1000937 Ga0207713_10009378 221
274 3300025735 Ga0207713_1007706 Ga0207713_10077062 221
275 3300025735 Ga0207713_1009363 Ga0207713_10093632 221
276 3300025935 Ga0207709_10023856 Ga0207709_100238564 221
277 3300027296 Ga0209389_1000063 Ga0209389_100006380 221
278 3300027312 Ga0209371_1000237 Ga0209371_100023743 221
279 3300030500 Ga0268256_1001693 Ga0268256_100169311 221
280 3300042006 Ga0439432_012606 Ga0439432_012606_1275_1940 221
281 3300042013 Ga0439456_000027 Ga0439456_000027_16668_17336 221
282 3300042136 Ga0450900_014454 Ga0450900_014454_90_755 221
283 3300042137 Ga0450902_002139 Ga0450902_002139_1745_2410 221
284 3300042142 Ga0450905_002043 Ga0450905_002043_584_1249 221
285 3300042142 Ga0450905_002139 Ga0450905_002139_1597_2262 221
286 3300042439 Ga0439464_0019999 Ga0439464_0019999_1131_1796 221
287 3300042533 Ga0450901_000887 Ga0450901_000887_1707_2372 221
288 3300046458 Ga0495591_000023 Ga0495591_000023_18965_19633 221
289 3300046474 Ga0495605_0000291 Ga0495605_0000291_47960_48628 221
290 3300046501 Ga0495607_0001998 Ga0495607_0001998_13170_13838 221
291 3300046520 Ga0495637_0012328 Ga0495637_0012328_35_703 221
292 3300046522 Ga0495643_0008064 Ga0495643_0008064_1008_1673 221
293 3300046542 Ga0495597_0000016 Ga0495597_0000016_13032_13700 221
294 3300046542 Ga0495597_0008329 Ga0495597_0008329_4312_4980 221
295 3300046694 Ga0495649_0264637 Ga0495649_0264637_35_703 221
296 3300046810 Ga0495660_0001406 Ga0495660_0001406_5285_5953 221
297 3300047320 Ga0495672_0086316 Ga0495672_0086316_970_1638 221
298 3300047469 Ga0495673_0000834 Ga0495673_0000834_14127_14795 221
299 3300048913 Ga0496110_0639481 Ga0496110_0639481_28_693 221
300 3300048917 Ga0496114_0074108 Ga0496114_0074108_2064_2729 221
301 3300048917 Ga0496114_0164425 Ga0496114_0164425_1208_1873 221
302 3300048920 Ga0496117_0021938 Ga0496117_0021938_1686_2351 221
303 3300048920 Ga0496117_0062495 Ga0496117_0062495_1674_2339 221
304 3300048921 Ga0496118_0006597 Ga0496118_0006597_2772_3437 221
305 3300048921 Ga0496118_0043677 Ga0496118_0043677_1696_2361 221
306 3300048922 Ga0496119_0000383 Ga0496119_0000383_51970_52635 221
307 3300048922 Ga0496119_0050855 Ga0496119_0050855_442_1107 221
308 3300048923 Ga0496120_0000824 Ga0496120_0000824_25732_26397 221
309 3300048924 Ga0496121_0249175 Ga0496121_0249175_112_777 221
310 3300048925 Ga0496122_0007476 Ga0496122_0007476_1479_2144 221
311 3300048925 Ga0496122_0060619 Ga0496122_0060619_2045_2710 221
312 3300048925 Ga0496122_0216259 Ga0496122_0216259_126_791 221
313 3300048926 Ga0496123_0001665 Ga0496123_0001665_14236_14901 221
314 3300048926 Ga0496123_0079780 Ga0496123_0079780_1170_1835 221
315 3300048926 Ga0496123_0113249 Ga0496123_0113249_648_1313 221
316 3300048927 Ga0496124_0007618 Ga0496124_0007618_5191_5856 221
317 3300048927 Ga0496124_0010658 Ga0496124_0010658_2796_3461 221
318 3300048927 Ga0496124_0017428 Ga0496124_0017428_940_1605 221
319 3300048927 Ga0496124_0360498 Ga0496124_0360498_295_960 221
320 3300048928 Ga0496125_0001171 Ga0496125_0001171_37351_38016 221
321 3300048928 Ga0496125_0016212 Ga0496125_0016212_5559_6224 221
322 3300048928 Ga0496125_0056209 Ga0496125_0056209_896_1561 221
323 3300048928 Ga0496125_0249837 Ga0496125_0249837_99_764 221
324 3300048928 Ga0496125_0319700 Ga0496125_0319700_80_748 221
325 3300048929 Ga0496126_0033435 Ga0496126_0033435_3071_3736 221
326 3300049569 Ga0501032_0112470 Ga0501032_0112470_900_1571 221
327 3300049571 Ga0501034_0000041 Ga0501034_0000041_98956_99621 221
328 3300049581 Ga0501047_0457475 Ga0501047_0457475_290_979 221
329 3300053135 Ga0500659_0001773 Ga0500659_0001773_1622_2287 221

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01300

Sua5_yciO_yrdC

Telomere recombination

22

199

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kk9-assembly1.cif.gz_A crystal structure of e. coli ycio 0.9811 14 218
1kk9-assembly1.cif.gz_A crystal structure of e. coli ycio 0.9717 14 218
2eqa-assembly1.cif.gz_A crystal structure of the hypothetical sua5 protein from sulfolobus tokodaii 0.9134 14 208
3aje-assembly1.cif.gz_A crystal structure of s. tokodaii sua5 complexed with l-threonine and amppnp 0.9093 14 208
6f89-assembly2.cif.gz_B structure of h234a/y235a p.abyssi sua5 0.9067 15 210
ID Description Score Start End Superfamily
1kk9A00 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.9788 14 218 3.90.870.10
1kk9A00 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.9739 14 218 3.90.870.10
af_Q6YZF2_76_294_3.90.870.10 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.9355 16 213 3.90.870.10
4e1bA01 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.9138 14 211 3.90.870.10
af_P9WGC9_2_211_3.90.870.10 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.9085 26 211 3.90.870.10
ID Description Score Start End GO Terms
AF-A0A7C1TGX9-F1-model_v4 Threonylcarbamoyl-AMP synthase 0.9957 14 155 GO:0003725
AF-A0A254TJJ7-F1-model_v4 Threonylcarbamoyl-AMP synthase 0.9946 14 173 GO:0003725
AF-F3LIJ6-F1-model_v4 YrdC-like domain-containing protein 0.9929 14 213 GO:0003725
AF-A0A556W6W3-F1-model_v4 Threonylcarbamoyl-AMP synthase 0.991 14 219 GO:0003725
AF-A0A455VJG5-F1-model_v4 deleted 0.9891 39 217

Feature Viewer

pLDDT pTM Quality
92.86 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map