F409452

General Info

Members Datasets Scaffolds Average Seq Length
328 236 656 290

Family's Representative Sequence

Representative Sequence 3300053096|Ga0500641_0008830|Ga0500641_0008830_376_1245
Length 289
Sequence MNSASNSEVPVVESGTFSLGQLTVRRLGYGAMQITGPGVWGPPADPAAAVRVLRRAVELGVNFVDTADSYGPYVSEELIREALHPYDDVMVATKAGLVRTGPAQWHPVGRPEYLRQECEMSLRRLGVEAIDLFQLHRVDPKVPASEQYGLLKELRDEGKVREVGLSEVTIEQIEAAQKIVPIVSVQNQYNLETRQSEEVLDYCEANGVGFIPWFPINSGALAREGGPVDAISKQTGATAAQVALAWLLARSEVMLPIPGTSSVKHVEENCAAALVKLSDVQIKELNNAV

Samples

Sample ID Description Type Environment
1 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
24 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
25 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
55 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
95 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
96 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
97 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
98 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
99 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
107 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
115 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
116 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
117 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
118 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
119 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
120 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
121 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
122 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
123 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
124 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
125 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
126 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
127 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
128 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
129 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
130 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
131 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
132 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
133 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
134 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
135 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
136 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
137 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
138 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
139 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
140 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
141 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
144 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
145 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
146 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
147 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
148 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
149 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
150 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
151 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
152 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
153 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
154 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
170 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
171 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
172 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
173 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
174 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
175 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
176 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
177 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
183 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
184 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
185 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
186 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
189 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
193 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
194 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
195 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
196 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
197 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
198 2508501039 Frankia saprophytica CN3 Isolate Nodule
199 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
200 2517572101 Frankia sp. DC12 Isolate Nodule
201 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
202 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
203 2619618881 Frankia sp. ACN1ag Isolate Unclassified
204 2619619003 Frankia sp. CpI1-P Isolate Nodule
205 2626541554 Frankia sp. AvcI.1 Isolate Nodule
206 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
207 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
208 2687453737 Frankia sp. BMG5.36 Isolate Nodule
209 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
210 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
211 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
212 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
213 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
214 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
215 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
216 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
217 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
218 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
219 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
220 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
221 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
222 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
223 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
224 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
225 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
226 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
227 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
228 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
229 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
230 8002775197 Frankia nepalensis CN7 Isolate Nodule
231 8002784119 Frankia sp. AgB1.9 Isolate Nodule
232 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
233 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
234 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
235 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
236 8054920844 Frankia tisae Agncl-8 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.11
Metatranscriptomes 0
Isolates 11.89

Biome Distribution

Category Percentage (%)
Aerial Root 0.61
Bulb 0
Endosphere 2.44
Nodule 3.66
Rhizoplane 11.89
Rhizosphere 71.34
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500641_0008830 3300053096 Unclassified 3608
2 Ga0070676_10012677 3300005328 Bacteria 4608
3 Ga0068868_100016259 3300005338 Bacteria 5520
4 Ga0068868_100507475 3300005338 Bacteria 1057
5 Ga0070660_100097187 3300005339 Bacteria 2329
6 Ga0070691_10041039 3300005341 Bacteria 2188
7 Ga0070687_100014382 3300005343 Bacteria 3555
8 Ga0070692_10111782 3300005345 Bacteria 1512
9 Ga0070669_100169468 3300005353 Bacteria 1701
10 Ga0070675_100052421 3300005354 Bacteria 3354
11 Ga0070674_100078787 3300005356 Bacteria 2349
12 Ga0070667_100044423 3300005367 Bacteria 3731
13 Ga0070667_100082302 3300005367 Bacteria 2756
14 Ga0070708_100013664 3300005445 Bacteria 6657
15 Ga0070663_100321178 3300005455 Bacteria 1245
16 Ga0070678_100206018 3300005456 Bacteria 1626
17 Ga0070685_10032582 3300005466 Bacteria 2920
18 Ga0068853_100142437 3300005539 Bacteria 2153
19 Ga0070686_100060575 3300005544 Bacteria 2443
20 Ga0070696_100102616 3300005546 Bacteria 2051
21 Ga0070665_100091542 3300005548 Bacteria 3046
22 Ga0070665_100100562 3300005548 Bacteria 2895
23 Ga0070704_100201031 3300005549 Bacteria 1608
24 Ga0068857_100050127 3300005577 Bacteria 3704
25 Ga0068859_100000572 3300005617 Bacteria 36730
26 Ga0068859_100005725 3300005617 Bacteria 12641
27 Ga0068866_10027200 3300005718 Bacteria 2709
28 Ga0068851_10086025 3300005834 Bacteria 1649
29 Ga0068870_10220811 3300005840 Bacteria 1160
30 Ga0068863_100001825 3300005841 Bacteria 21153
31 Ga0068863_100126683 3300005841 Bacteria 2437
32 Ga0068858_100174525 3300005842 Bacteria 2028
33 Ga0068860_100060748 3300005843 Bacteria 3591
34 Ga0068862_100000839 3300005844 Bacteria 30415
35 Ga0081538_10000099 3300005981 Bacteria 83947
36 Ga0081538_10000252 3300005981 Bacteria 60660
37 Ga0081538_10010668 3300005981 Bacteria 7520
38 Ga0070717_10002101 3300006028 Bacteria 13966
39 Ga0070717_10045155 3300006028 Bacteria 3601
40 Ga0075364_10000693 3300006051 Bacteria 17606
41 Ga0075364_10219435 3300006051 Bacteria 1290
42 Ga0070716_100093289 3300006173 Bacteria 1827
43 Ga0097621_100067188 3300006237 Bacteria 2954
44 Ga0097620_100000572 3300006931 Bacteria 36730
45 Ga0097620_100005725 3300006931 Bacteria 12641
46 Ga0075435_100113934 3300007076 Bacteria 2251
47 Ga0111539_10129810 3300009094 Bacteria 2952
48 Ga0111539_10223491 3300009094 Bacteria 2193
49 Ga0105245_10076353 3300009098 Bacteria 3052
50 Ga0105245_10084835 3300009098 Bacteria 2902
51 Ga0105245_10244952 3300009098 Bacteria 1739
52 Ga0105247_10000102 3300009101 Bacteria 90969
53 Ga0105247_10065648 3300009101 Bacteria 2258
54 Ga0105243_10009982 3300009148 Bacteria 7216
55 Ga0105243_10386425 3300009148 Bacteria 1296
56 Ga0105242_10155164 3300009176 Bacteria 1999
57 Ga0105248_10000166 3300009177 Bacteria 77193
58 Ga0105248_10000291 3300009177 Bacteria 59424
59 Ga0105248_10003580 3300009177 Bacteria 17219
60 Ga0105237_10087406 3300009545 Bacteria 3106
61 Ga0105249_10002302 3300009553 Bacteria 16593
62 Ga0105249_10021247 3300009553 Bacteria 5811
63 Ga0105246_10009429 3300011119 Bacteria 6015
64 Ga0157370_10033286 3300013104 Bacteria 5025
65 Ga0157369_10097884 3300013105 Bacteria 3129
66 Ga0157369_10206331 3300013105 Bacteria 2061
67 Ga0157378_10132258 3300013297 Bacteria 2310
68 Ga0163162_10045053 3300013306 Bacteria 4419
69 Ga0157372_10102427 3300013307 Bacteria 3271
70 Ga0163163_10015756 3300014325 Bacteria 7000
71 Ga0157380_10315641 3300014326 Bacteria 1447
72 Ga0157379_10009307 3300014968 Bacteria 8556
73 Ga0157379_10115110 3300014968 Bacteria 2418
74 Ga0157379_10275792 3300014968 Bacteria 1530
75 Ga0157379_10328148 3300014968 Bacteria 1398
76 Ga0213874_10008434 3300021377 Bacteria 2512
77 Ga0207656_10129323 3300025321 Bacteria 1182
78 Ga0207655_1003255 3300025728 Bacteria 12187
79 Ga0207682_10002181 3300025893 Bacteria 8846
80 Ga0207710_10000029 3300025900 Bacteria 289155
81 Ga0207710_10070814 3300025900 Bacteria 1599
82 Ga0207688_10028736 3300025901 Bacteria 3058
83 Ga0207684_10277405 3300025910 Bacteria 1446
84 Ga0207671_10119825 3300025914 Bacteria 2011
85 Ga0207693_10013072 3300025915 Bacteria 6698
86 Ga0207663_10039547 3300025916 Bacteria 2858
87 Ga0207662_10018967 3300025918 Bacteria 3908
88 Ga0207662_10344498 3300025918 Bacteria 999
89 Ga0207657_10114802 3300025919 Bacteria 2220
90 Ga0207652_10221105 3300025921 Bacteria 1706
91 Ga0207694_10079596 3300025924 Bacteria 2570
92 Ga0207650_10011387 3300025925 Bacteria 6122
93 Ga0207659_10042497 3300025926 Bacteria 3187
94 Ga0207687_10046382 3300025927 Bacteria 3008
95 Ga0207687_10304645 3300025927 Bacteria 1284
96 Ga0207644_10052090 3300025931 Bacteria 2941
97 Ga0207690_10031737 3300025932 Bacteria 3383
98 Ga0207706_10033577 3300025933 Bacteria 4566
99 Ga0207686_10222560 3300025934 Bacteria 1363
100 Ga0207669_10048262 3300025937 Bacteria 2528
101 Ga0207691_10003333 3300025940 Bacteria 15631
102 Ga0207711_10000141 3300025941 Bacteria 77173
103 Ga0207711_10001478 3300025941 Bacteria 21895
104 Ga0207711_10026991 3300025941 Bacteria 4821
105 Ga0207711_10305447 3300025941 Bacteria 1468
106 Ga0207661_10333088 3300025944 Bacteria 1367
107 Ga0207712_10017003 3300025961 Bacteria 4718
108 Ga0207658_10122780 3300025986 Bacteria 2074
109 Ga0207703_10080397 3300026035 Bacteria 2714
110 Ga0207639_10143950 3300026041 Bacteria 1989
111 Ga0207639_10553860 3300026041 Bacteria 1056
112 Ga0207678_10040015 3300026067 Bacteria 4066
113 Ga0207678_10343995 3300026067 Bacteria 1285
114 Ga0207702_10228628 3300026078 Bacteria 1737
115 Ga0207641_10006937 3300026088 Bacteria 9479
116 Ga0207648_10070233 3300026089 Bacteria 3053
117 Ga0207648_10392733 3300026089 Bacteria 1256
118 Ga0207676_10178667 3300026095 Bacteria 1856
119 Ga0207674_10239585 3300026116 Bacteria 1761
120 Ga0207674_10299851 3300026116 Bacteria 1556
121 Ga0207683_10005043 3300026121 Bacteria 11337
122 Ga0207683_10037081 3300026121 Bacteria 4245
123 Ga0268266_10098757 3300028379 Bacteria 2570
124 Ga0268265_10000253 3300028380 Bacteria 60788
125 Ga0307511_10021536 3300030521 Bacteria 6067
126 Ga0307408_100032388 3300031548 Bacteria 3644
127 Ga0307408_100119731 3300031548 Bacteria 2037
128 Ga0307408_100149958 3300031548 Bacteria 1839
129 Ga0307516_10020752 3300031730 Bacteria 6782
130 Ga0307405_10014548 3300031731 Bacteria 4234
131 Ga0307405_10154135 3300031731 Bacteria 1619
132 Ga0307413_10006069 3300031824 Bacteria 5475
133 Ga0307413_10012368 3300031824 Bacteria 4246
134 Ga0307413_10081611 3300031824 Bacteria 2074
135 Ga0307413_10369453 3300031824 Bacteria 1113
136 Ga0307410_10021018 3300031852 Bacteria 4006
137 Ga0307410_10063619 3300031852 Bacteria 2532
138 Ga0307410_10296841 3300031852 Bacteria 1273
139 Ga0307406_10162059 3300031901 Bacteria 1609
140 Ga0307407_10012314 3300031903 Bacteria 4107
141 Ga0307412_10001653 3300031911 Bacteria 12315
142 Ga0307412_10047019 3300031911 Bacteria 2831
143 Ga0307412_10053408 3300031911 Bacteria 2678
144 Ga0307412_10083724 3300031911 Bacteria 2212
145 Ga0307412_10125835 3300031911 Bacteria 1853
146 Ga0307409_100103983 3300031995 Bacteria 2364
147 Ga0307409_100147923 3300031995 Bacteria 2034
148 Ga0307409_100335570 3300031995 Bacteria 1420
149 Ga0307409_100522601 3300031995 Bacteria 1160
150 Ga0307416_100066297 3300032002 Bacteria 2972
151 Ga0307416_100200086 3300032002 Bacteria 1894
152 Ga0307416_100359040 3300032002 Bacteria 1478
153 Ga0307414_10025803 3300032004 Bacteria 3771
154 Ga0307414_10078705 3300032004 Bacteria 2404
155 Ga0307411_10364279 3300032005 Bacteria 1183
156 Ga0307415_100006832 3300032126 Bacteria 6192
157 Ga0373949_0007308 3300035090 Bacteria 2418
158 Ga0373939_0007115 3300035114 Bacteria 2712
159 Ga0373937_0039336 3300036401 Bacteria 4310
160 Ga0395900_0036657 3300037418 Bacteria 5056
161 Ga0395898_0081180 3300037466 Bacteria 3127
162 Ga0395898_0232664 3300037466 Bacteria 1757
163 Ga0436364_0864789 3300037853 Bacteria 6547
164 Ga0436364_0926921 3300037853 Plasmid 2513
165 Ga0395901_0084010 3300038443 Bacteria 3328
166 Ga0395901_0262195 3300038443 Bacteria 1798
167 Ga0395901_0807755 3300038443 Bacteria 926
168 Ga0436365_0275704 3300039437 Bacteria 3702
169 Ga0436363_1524120 3300039450 Bacteria 3224
170 Ga0436362_1030948 3300039453 Bacteria 1923
171 Ga0451853_2428981 3300041512 Bacteria 8658
172 Ga0439444_0029696 3300042437 Bacteria 1020
173 Ga0439440_0040054 3300042993 Bacteria 1139
174 Ga0466969_0114601 3300044656 Bacteria 1259
175 Ga0453683_0013051 3300044673 Bacteria 5433
176 Ga0466961_0045116 3300044693 Bacteria 2821
177 Ga0466961_0109705 3300044693 Bacteria 1737
178 Ga0466963_0037017 3300044694 Bacteria 3185
179 Ga0453684_0260266 3300044712 Bacteria 1988
180 Ga0466957_0011884 3300044842 Bacteria 5032
181 Ga0466959_0017949 3300045049 Bacteria 5191
182 Ga0466959_0366749 3300045049 Bacteria 981
183 Ga0466958_0007901 3300045836 Bacteria 5880
184 Ga0466958_0181189 3300045836 Bacteria 1337
185 Ga0495629_0231300 3300046459 Bacteria 1274
186 Ga0495641_0082595 3300046461 Bacteria 1439
187 Ga0495582_0017881 3300046473 Bacteria 3875
188 Ga0495582_0116298 3300046473 Bacteria 1504
189 Ga0495639_0005639 3300046475 Bacteria 5385
190 Ga0495662_0028723 3300046476 Bacteria 2685
191 Ga0495585_0015675 3300046492 Bacteria 4402
192 Ga0495594_0017101 3300046499 Bacteria 3828
193 Ga0495620_0000737 3300046515 Bacteria 20139
194 Ga0495630_0512576 3300046517 Bacteria 920
195 Ga0495637_0003907 3300046520 Bacteria 7818
196 Ga0495648_0015427 3300046524 Bacteria 5549
197 Ga0495642_0012081 3300046528 Bacteria 3327
198 Ga0495665_0001901 3300046531 Bacteria 11270
199 Ga0495665_0009631 3300046531 Bacteria 5234
200 Ga0495586_0004272 3300046535 Bacteria 7640
201 Ga0495586_0006650 3300046535 Bacteria 6172
202 Ga0495587_0003423 3300046536 Bacteria 10583
203 Ga0495645_0000854 3300046543 Bacteria 20754
204 Ga0495667_0019127 3300046559 Bacteria 4622
205 Ga0495635_0043040 3300046663 Bacteria 3117
206 Ga0495588_0054406 3300046674 Bacteria 2064
207 Ga0495588_0064364 3300046674 Bacteria 1902
208 Ga0495623_0031140 3300046679 Bacteria 3431
209 Ga0495600_0003214 3300046809 Bacteria 9561
210 Ga0495581_0014752 3300047315 Bacteria 4532
211 Ga0495581_0066240 3300047315 Bacteria 2088
212 Ga0495675_0001270 3300047444 Bacteria 15282
213 Ga0495673_0000227 3300047469 Bacteria 83114
214 Ga0495684_0029456 3300047471 Bacteria 4214
215 Ga0495593_0031487 3300047673 Bacteria 2897
216 Ga0496100_0003552 3300048903 Bacteria 8144
217 Ga0496100_0041368 3300048903 Bacteria 2938
218 Ga0496100_0052177 3300048903 Bacteria 2657
219 Ga0496101_0002043 3300048904 Bacteria 12285
220 Ga0496101_0170537 3300048904 Bacteria 1672
221 Ga0496102_0053419 3300048905 Bacteria 3683
222 Ga0496102_0101200 3300048905 Bacteria 2677
223 Ga0496102_0157738 3300048905 Bacteria 2134
224 Ga0496102_0166925 3300048905 Bacteria 2071
225 Ga0496102_0719335 3300048905 Bacteria 921
226 Ga0496103_0117525 3300048906 Bacteria 1693
227 Ga0496104_0000054 3300048907 Bacteria 132314
228 Ga0496104_0010256 3300048907 Bacteria 8368
229 Ga0496104_0030953 3300048907 Bacteria 4974
230 Ga0496104_0128838 3300048907 Bacteria 2430
231 Ga0496105_0029355 3300048908 Bacteria 4501
232 Ga0496105_0239351 3300048908 Bacteria 1473
233 Ga0496106_0018961 3300048909 Bacteria 5097
234 Ga0496106_0025711 3300048909 Bacteria 4382
235 Ga0496107_0008836 3300048910 Bacteria 6980
236 Ga0496107_0140690 3300048910 Bacteria 1783
237 Ga0496108_0023168 3300048911 Bacteria 5107
238 Ga0496108_0410465 3300048911 Bacteria 1183
239 Ga0496109_0035844 3300048912 Bacteria 4478
240 Ga0496109_0221041 3300048912 Bacteria 1781
241 Ga0496110_0032346 3300048913 Bacteria 4516
242 Ga0496110_0052527 3300048913 Bacteria 3581
243 Ga0496111_0081474 3300048914 Bacteria 2362
244 Ga0496111_0183733 3300048914 Bacteria 1554
245 Ga0496112_0046666 3300048915 Bacteria 4250
246 Ga0496112_0131240 3300048915 Bacteria 2476
247 Ga0496113_0186346 3300048916 Bacteria 1646
248 Ga0496114_0009368 3300048917 Bacteria 7773
249 Ga0496114_0048718 3300048917 Bacteria 3524
250 Ga0496114_0724803 3300048917 Bacteria 871
251 Ga0496115_0004419 3300048918 Bacteria 10187
252 Ga0496115_0037615 3300048918 Bacteria 3836
253 Ga0496115_0075713 3300048918 Bacteria 2734
254 Ga0496116_0000190 3300048919 Bacteria 122544
255 Ga0496117_0010955 3300048920 Bacteria 8172
256 Ga0496117_0011659 3300048920 Bacteria 7849
257 Ga0496118_0002278 3300048921 Bacteria 26188
258 Ga0496118_0008521 3300048921 Bacteria 10584
259 Ga0496119_0000784 3300048922 Bacteria 42478
260 Ga0496119_0010794 3300048922 Bacteria 7646
261 Ga0496120_0000765 3300048923 Bacteria 46402
262 Ga0496121_0041628 3300048924 Bacteria 4012
263 Ga0496121_0206091 3300048924 Bacteria 1397
264 Ga0496124_0057859 3300048927 Bacteria 3264
265 Ga0496126_0237922 3300048929 Bacteria 1523
266 Ga0501037_0005151 3300049573 Bacteria 9511
267 Ga0501037_0031413 3300049573 Bacteria 3921
268 Ga0501038_0064066 3300049574 Bacteria 3135
269 Ga0501039_0021915 3300049575 Bacteria 4902
270 Ga0501039_0026472 3300049575 Bacteria 4456
271 Ga0501043_0300099 3300049579 Bacteria 1227
272 Ga0501048_0019188 3300049582 Bacteria 5020
273 Ga0501071_0158162 3300049587 Bacteria 1692
274 Ga0501072_0047923 3300049588 Bacteria 3365
275 Ga0501075_0139308 3300049591 Bacteria 1848
276 Ga0501076_0005425 3300049592 Bacteria 9168
277 Ga0501081_0005938 3300049743 Bacteria 7904
278 Ga0501044_0389407 3300049823 Bacteria 1308
279 Ga0501045_0024343 3300049824 Bacteria 4347
280 nmdc:mga00v17_204966_c1 3300050491 Bacteria 1275
281 nmdc:mga00v17_9982_c1 3300050491 Bacteria 5164
282 nmdc:mga08y16_369997_c1 3300050511 Bacteria 1470
283 nmdc:mga0rr50_104041_c1 3300050513 Bacteria 2236
284 Ga0495601_0000481 3300053077 Bacteria 20953
285 Ga0495619_0410506 3300053085 Bacteria 935
286 Ga0500572_043664 3300053111 Bacteria 1311
287 Ga0500595_018946 3300053119 Bacteria 2506
288 Ga0500600_0066212 3300053149 Bacteria 1996
289 Ga0501084_0058342 3300054114 Bacteria 3230
290 2508676288 2508501039 Bacteria 9978592
291 2515855544 2515154155 Bacteria 7985436
292 2517763361 2517572101 Bacteria 6884336
293 2579852106 2579778521 Bacteria 7624758
294 2600203684 2599185354 Bacteria 4398675
295 2619854756 2619618881 Bacteria 7521104
296 2620351139 2619619003 Bacteria 7619552
297 2626637795 2626541554 Bacteria 7741902
298 2676198586 2675902999 Bacteria 9438463
299 2686534164 2684623035 Bacteria 8032739
300 2689961451 2687453737 Bacteria 11203906
301 2689992897 2687453743 Bacteria 8361025
302 2691515773 2690315906 Bacteria 4517044
303 2774843164 2773857921 Bacteria 9435764
304 2775657345 2775506735 Bacteria 4556596
305 2808828911 2808606357 Bacteria 4466944
306 2808850142 2808606360 Bacteria 4404006
307 2808877308 2808606366 Bacteria 4415912
308 2808893149 2808606370 Bacteria 4942454
309 2808898783 2808606371 Bacteria 4251511
310 2812319388 2811994871 Bacteria 4497550
311 2895888574 2895880812 Bacteria 11255272
312 2939602172 2939598168 Bacteria 4687164
313 2945917141 2945916053 Bacteria 4555517
314 2945922608 2945920336 Bacteria 4501603
315 2946037102 2946037020 Bacteria 4900426
316 2946060941 2946059875 Bacteria 4386623
317 2953998354 2953998280 Bacteria 4812144
318 2974305083 2974302888 Bacteria 4369871
319 2984577201 2984576629 Bacteria 4248407
320 2990050285 2990044586 Bacteria 6603797
321 2990260876 2990256926 Bacteria 4252839
322 8002776689 8002775197 Bacteria 10728764
323 8002792132 8002784119 Bacteria 9788632
324 8004022349 8004021418 Bacteria 4313954
325 8004026648 8004025490 Bacteria 4327753
326 8053951268 8053945823 Bacteria 8962862
327 8054914049 8054913762 Bacteria 7713009
328 8054920932 8054920844 Bacteria 7068637
329 Ga0500641_0008830
330 Ga0070676_10012677
331 Ga0068868_100016259
332 Ga0068868_100507475
333 Ga0070660_100097187
334 Ga0070691_10041039
335 Ga0070687_100014382
336 Ga0070692_10111782
337 Ga0070669_100169468
338 Ga0070675_100052421
339 Ga0070674_100078787
340 Ga0070667_100044423
341 Ga0070667_100082302
342 Ga0070708_100013664
343 Ga0070663_100321178
344 Ga0070678_100206018
345 Ga0070685_10032582
346 Ga0068853_100142437
347 Ga0070686_100060575
348 Ga0070696_100102616
349 Ga0070665_100091542
350 Ga0070665_100100562
351 Ga0070704_100201031
352 Ga0068857_100050127
353 Ga0068859_100000572
354 Ga0068859_100005725
355 Ga0068866_10027200
356 Ga0068851_10086025
357 Ga0068870_10220811
358 Ga0068863_100001825
359 Ga0068863_100126683
360 Ga0068858_100174525
361 Ga0068860_100060748
362 Ga0068862_100000839
363 Ga0081538_10000099
364 Ga0081538_10000252
365 Ga0081538_10010668
366 Ga0070717_10002101
367 Ga0070717_10045155
368 Ga0075364_10000693
369 Ga0075364_10219435
370 Ga0070716_100093289
371 Ga0097621_100067188
372 Ga0097620_100000572
373 Ga0097620_100005725
374 Ga0075435_100113934
375 Ga0111539_10129810
376 Ga0111539_10223491
377 Ga0105245_10076353
378 Ga0105245_10084835
379 Ga0105245_10244952
380 Ga0105247_10000102
381 Ga0105247_10065648
382 Ga0105243_10009982
383 Ga0105243_10386425
384 Ga0105242_10155164
385 Ga0105248_10000166
386 Ga0105248_10000291
387 Ga0105248_10003580
388 Ga0105237_10087406
389 Ga0105249_10002302
390 Ga0105249_10021247
391 Ga0105246_10009429
392 Ga0157370_10033286
393 Ga0157369_10097884
394 Ga0157369_10206331
395 Ga0157378_10132258
396 Ga0163162_10045053
397 Ga0157372_10102427
398 Ga0163163_10015756
399 Ga0157380_10315641
400 Ga0157379_10009307
401 Ga0157379_10115110
402 Ga0157379_10275792
403 Ga0157379_10328148
404 Ga0213874_10008434
405 Ga0207656_10129323
406 Ga0207655_1003255
407 Ga0207682_10002181
408 Ga0207710_10000029
409 Ga0207710_10070814
410 Ga0207688_10028736
411 Ga0207684_10277405
412 Ga0207671_10119825
413 Ga0207693_10013072
414 Ga0207663_10039547
415 Ga0207662_10018967
416 Ga0207662_10344498
417 Ga0207657_10114802
418 Ga0207652_10221105
419 Ga0207694_10079596
420 Ga0207650_10011387
421 Ga0207659_10042497
422 Ga0207687_10046382
423 Ga0207687_10304645
424 Ga0207644_10052090
425 Ga0207690_10031737
426 Ga0207706_10033577
427 Ga0207686_10222560
428 Ga0207669_10048262
429 Ga0207691_10003333
430 Ga0207711_10000141
431 Ga0207711_10001478
432 Ga0207711_10026991
433 Ga0207711_10305447
434 Ga0207661_10333088
435 Ga0207712_10017003
436 Ga0207658_10122780
437 Ga0207703_10080397
438 Ga0207639_10143950
439 Ga0207639_10553860
440 Ga0207678_10040015
441 Ga0207678_10343995
442 Ga0207702_10228628
443 Ga0207641_10006937
444 Ga0207648_10070233
445 Ga0207648_10392733
446 Ga0207676_10178667
447 Ga0207674_10239585
448 Ga0207674_10299851
449 Ga0207683_10005043
450 Ga0207683_10037081
451 Ga0268266_10098757
452 Ga0268265_10000253
453 Ga0307511_10021536
454 Ga0307408_100032388
455 Ga0307408_100119731
456 Ga0307408_100149958
457 Ga0307516_10020752
458 Ga0307405_10014548
459 Ga0307405_10154135
460 Ga0307413_10006069
461 Ga0307413_10012368
462 Ga0307413_10081611
463 Ga0307413_10369453
464 Ga0307410_10021018
465 Ga0307410_10063619
466 Ga0307410_10296841
467 Ga0307406_10162059
468 Ga0307407_10012314
469 Ga0307412_10001653
470 Ga0307412_10047019
471 Ga0307412_10053408
472 Ga0307412_10083724
473 Ga0307412_10125835
474 Ga0307409_100103983
475 Ga0307409_100147923
476 Ga0307409_100335570
477 Ga0307409_100522601
478 Ga0307416_100066297
479 Ga0307416_100200086
480 Ga0307416_100359040
481 Ga0307414_10025803
482 Ga0307414_10078705
483 Ga0307411_10364279
484 Ga0307415_100006832
485 Ga0373949_0007308
486 Ga0373939_0007115
487 Ga0373937_0039336
488 Ga0395900_0036657
489 Ga0395898_0081180
490 Ga0395898_0232664
491 Ga0436364_0864789
492 Ga0436364_0926921
493 Ga0395901_0084010
494 Ga0395901_0262195
495 Ga0395901_0807755
496 Ga0436365_0275704
497 Ga0436363_1524120
498 Ga0436362_1030948
499 Ga0451853_2428981
500 Ga0439444_0029696
501 Ga0439440_0040054
502 Ga0466969_0114601
503 Ga0453683_0013051
504 Ga0466961_0045116
505 Ga0466961_0109705
506 Ga0466963_0037017
507 Ga0453684_0260266
508 Ga0466957_0011884
509 Ga0466959_0017949
510 Ga0466959_0366749
511 Ga0466958_0007901
512 Ga0466958_0181189
513 Ga0495629_0231300
514 Ga0495641_0082595
515 Ga0495582_0017881
516 Ga0495582_0116298
517 Ga0495639_0005639
518 Ga0495662_0028723
519 Ga0495585_0015675
520 Ga0495594_0017101
521 Ga0495620_0000737
522 Ga0495630_0512576
523 Ga0495637_0003907
524 Ga0495648_0015427
525 Ga0495642_0012081
526 Ga0495665_0001901
527 Ga0495665_0009631
528 Ga0495586_0004272
529 Ga0495586_0006650
530 Ga0495587_0003423
531 Ga0495645_0000854
532 Ga0495667_0019127
533 Ga0495635_0043040
534 Ga0495588_0054406
535 Ga0495588_0064364
536 Ga0495623_0031140
537 Ga0495600_0003214
538 Ga0495581_0014752
539 Ga0495581_0066240
540 Ga0495675_0001270
541 Ga0495673_0000227
542 Ga0495684_0029456
543 Ga0495593_0031487
544 Ga0496100_0003552
545 Ga0496100_0041368
546 Ga0496100_0052177
547 Ga0496101_0002043
548 Ga0496101_0170537
549 Ga0496102_0053419
550 Ga0496102_0101200
551 Ga0496102_0157738
552 Ga0496102_0166925
553 Ga0496102_0719335
554 Ga0496103_0117525
555 Ga0496104_0000054
556 Ga0496104_0010256
557 Ga0496104_0030953
558 Ga0496104_0128838
559 Ga0496105_0029355
560 Ga0496105_0239351
561 Ga0496106_0018961
562 Ga0496106_0025711
563 Ga0496107_0008836
564 Ga0496107_0140690
565 Ga0496108_0023168
566 Ga0496108_0410465
567 Ga0496109_0035844
568 Ga0496109_0221041
569 Ga0496110_0032346
570 Ga0496110_0052527
571 Ga0496111_0081474
572 Ga0496111_0183733
573 Ga0496112_0046666
574 Ga0496112_0131240
575 Ga0496113_0186346
576 Ga0496114_0009368
577 Ga0496114_0048718
578 Ga0496114_0724803
579 Ga0496115_0004419
580 Ga0496115_0037615
581 Ga0496115_0075713
582 Ga0496116_0000190
583 Ga0496117_0010955
584 Ga0496117_0011659
585 Ga0496118_0002278
586 Ga0496118_0008521
587 Ga0496119_0000784
588 Ga0496119_0010794
589 Ga0496120_0000765
590 Ga0496121_0041628
591 Ga0496121_0206091
592 Ga0496124_0057859
593 Ga0496126_0237922
594 Ga0501037_0005151
595 Ga0501037_0031413
596 Ga0501038_0064066
597 Ga0501039_0021915
598 Ga0501039_0026472
599 Ga0501043_0300099
600 Ga0501048_0019188
601 Ga0501071_0158162
602 Ga0501072_0047923
603 Ga0501075_0139308
604 Ga0501076_0005425
605 Ga0501081_0005938
606 Ga0501044_0389407
607 Ga0501045_0024343
608 nmdc:mga00v17_204966_c1
609 nmdc:mga00v17_9982_c1
610 nmdc:mga08y16_369997_c1
611 nmdc:mga0rr50_104041_c1
612 Ga0495601_0000481
613 Ga0495619_0410506
614 Ga0500572_043664
615 Ga0500595_018946
616 Ga0500600_0066212
617 Ga0501084_0058342
618 2508676288
619 2515855544
620 2517763361
621 2579852106
622 2600203684
623 2619854756
624 2620351139
625 2626637795
626 2676198586
627 2686534164
628 2689961451
629 2689992897
630 2691515773
631 2774843164
632 2775657345
633 2808828911
634 2808850142
635 2808877308
636 2808893149
637 2808898783
638 2812319388
639 2895888574
640 2939602172
641 2945917141
642 2945922608
643 2946037102
644 2946060941
645 2953998354
646 2974305083
647 2984577201
648 2990050285
649 2990260876
650 8002776689
651 8002792132
652 8004022349
653 8004026648
654 8053951268
655 8054914049
656 8054920932

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

26

289

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hnq-assembly1.cif.gz_A the structure of a alcohol dehydrogenase akr13b2 with nadp 0.9671 2 286
8hnq-assembly1.cif.gz_A the structure of a alcohol dehydrogenase akr13b2 with nadp 0.9539 2 286
3v0u-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9033 12 289
3v0t-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.899 13 288
3uyi-assembly1.cif.gz_A-2 crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.8932 12 289
ID Description Score Start End Superfamily
af_O94315_19_306_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9911 23 288 3.20.20.100
af_P25906_7_286_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9216 23 287 3.20.20.100
af_A0A0R0ETH2_7_234_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9171 13 216 3.20.20.100
af_O94315_19_306_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9093 23 288 3.20.20.100
af_F4HPY8_8_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9047 13 287 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A5C4MDS9-F1-model_v4 Aldo/keto reductase 0.9944 12 289 GO:0004033
GO:0005737
AF-A0A1A2DX74-F1-model_v4 Oxidoreductase 0.9908 9 287 GO:0004033
GO:0005737
AF-A0A840IIJ8-F1-model_v4 Aryl-alcohol dehydrogenase-like predicted oxidoreductase 0.9907 8 287 GO:0004033
GO:0005737
AF-A0A375Z3A9-F1-model_v4 Oxidoreductase [Mycobacterium leprae TN] 0.9904 8 287 GO:0004033
GO:0005737
AF-A0A7W6VF61-F1-model_v4 Aryl-alcohol dehydrogenase-like predicted oxidoreductase 0.99 8 288 GO:0004033
GO:0005737

Map