F409442

General Info

Members Datasets Scaffolds Average Seq Length
328 228 656 251

Family's Representative Sequence

Representative Sequence 3300050491|nmdc:mga00v17_122112_c1|nmdc:mga00v17_122112_c1_160_912
Length 250
Sequence VTAFTEQPRLTLLPAIDIVDGAAVRLVQGEAGSETDYGSPLDAALQWIDQGAEWIHLVDLDAAFGRGSNAGVIRKVLAHAKHVRIELSGGIRDDASLEAALEHGAARVNLGTAALEDPEWTAAVIARYGEQIAVGLDVRGDTLAARGWTEDSGNLWEVLDRLEDASCPRYVVTDVTRDGMMQGPNIDLLRRVSQRTERPVVASGGISSLDDLAALRDLVPLGVEGAIVGKALYSGAFTLGAALDVAGRAE

Samples

Sample ID Description Type Environment
1 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
2 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
71 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
124 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
125 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
140 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
141 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
142 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
143 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
144 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
145 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
146 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
147 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
148 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
149 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
150 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
151 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
152 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
153 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
154 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
155 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
156 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
157 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
158 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
159 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
160 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
164 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
167 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
168 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
169 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
170 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
171 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
172 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
186 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
187 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
193 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
194 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
195 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
196 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
197 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
200 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
203 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
204 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
205 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
206 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
207 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
208 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
209 2643221548 Streptomyces sp. Root55 Isolate Unclassified
210 2643221561 Nocardioides sp. Root151 Isolate Unclassified
211 2643221578 Streptomyces sp. Root63 Isolate Unclassified
212 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
213 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
214 2643221696 Nocardioides sp. Root140 Isolate Unclassified
215 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
216 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
217 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
218 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
219 2867475112 Streptomyces sp. TM32 Isolate Unclassified
220 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
221 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
222 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
223 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
224 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
225 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
226 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
227 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
228 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.99
Metatranscriptomes 0.3
Isolates 6.71

Biome Distribution

Category Percentage (%)
Aerial Root 0.61
Bulb 0
Endosphere 1.22
Nodule 0
Rhizoplane 10.67
Rhizosphere 83.23
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga00v17_122112_c1 3300050491 Bacteria 1659
2 JGI25160J50197_1008354 3300003354 Bacteria 3951
3 Ga0070658_10056506 3300005327 Bacteria 3190
4 Ga0070658_10157566 3300005327 Bacteria 1904
5 Ga0068869_100007230 3300005334 Bacteria 7077
6 Ga0068869_100048888 3300005334 Bacteria 3060
7 Ga0070680_100076468 3300005336 Bacteria 2756
8 Ga0070680_100388298 3300005336 Bacteria 1189
9 Ga0070682_100323656 3300005337 Bacteria 1140
10 Ga0070682_100516288 3300005337 Bacteria 928
11 Ga0068868_100044101 3300005338 Bacteria 3486
12 Ga0068868_100148642 3300005338 Bacteria 1928
13 Ga0070660_100271753 3300005339 Bacteria 1385
14 Ga0070691_10242380 3300005341 Bacteria 963
15 Ga0070687_100085421 3300005343 Bacteria 1732
16 Ga0070661_100063581 3300005344 Bacteria 2711
17 Ga0070692_10012398 3300005345 Bacteria 3945
18 Ga0070692_10091343 3300005345 Bacteria 1655
19 Ga0070669_100112196 3300005353 Bacteria 2070
20 Ga0070675_100063284 3300005354 Bacteria 3058
21 Ga0070671_100003386 3300005355 Bacteria 12436
22 Ga0070671_100270551 3300005355 Bacteria 1444
23 Ga0070688_100145406 3300005365 Bacteria 1615
24 Ga0070659_100018870 3300005366 Bacteria 5210
25 Ga0070709_10018247 3300005434 Bacteria 4037
26 Ga0070714_100173776 3300005435 Bacteria 1957
27 Ga0070714_100365921 3300005435 Bacteria 1357
28 Ga0070713_100047355 3300005436 Bacteria 3533
29 Ga0070711_100017937 3300005439 Bacteria 4512
30 Ga0070711_100028693 3300005439 Bacteria 3664
31 Ga0070700_100172993 3300005441 Bacteria 1497
32 Ga0070663_100015401 3300005455 Bacteria 4935
33 Ga0070678_100002907 3300005456 Bacteria 9487
34 Ga0070662_100073919 3300005457 Bacteria 2520
35 Ga0070681_10071121 3300005458 Bacteria 3444
36 Ga0068867_100224300 3300005459 Bacteria 1516
37 Ga0070706_100006076 3300005467 Bacteria 11412
38 Ga0070706_100353873 3300005467 Bacteria 1369
39 Ga0070698_100016157 3300005471 Bacteria 7881
40 Ga0070684_100014190 3300005535 Bacteria 6445
41 Ga0070684_100317625 3300005535 Bacteria 1431
42 Ga0070672_100057900 3300005543 Bacteria 3044
43 Ga0070693_100007302 3300005547 Bacteria 5397
44 Ga0070665_100708579 3300005548 Bacteria 1020
45 Ga0068855_100037676 3300005563 Bacteria 5748
46 Ga0070664_100006628 3300005564 Bacteria 9336
47 Ga0070664_100196446 3300005564 Bacteria 1798
48 Ga0070664_100285349 3300005564 Bacteria 1489
49 Ga0068854_100415208 3300005578 Bacteria 1117
50 Ga0070702_100001182 3300005615 Bacteria 10518
51 Ga0068859_100159755 3300005617 Bacteria 2333
52 Ga0068864_100432012 3300005618 Bacteria 1256
53 Ga0068864_100520097 3300005618 Bacteria 1147
54 Ga0068870_10018076 3300005840 Bacteria 3398
55 Ga0068863_100008042 3300005841 Bacteria 10298
56 Ga0068858_100018248 3300005842 Bacteria 6570
57 Ga0068860_100095938 3300005843 Bacteria 2827
58 Ga0068860_100346203 3300005843 Bacteria 1462
59 Ga0070717_10018827 3300006028 Bacteria 5401
60 Ga0070715_10014221 3300006163 Bacteria 2942
61 Ga0068871_100019439 3300006358 Bacteria 5186
62 Ga0075428_100360048 3300006844 Bacteria 1561
63 Ga0075430_100210266 3300006846 Bacteria 1614
64 Ga0075429_100720168 3300006880 Bacteria 874
65 Ga0097620_100159747 3300006931 Bacteria 2333
66 Ga0075435_100096723 3300007076 Bacteria 2442
67 Ga0105251_10096421 3300009011 Bacteria 1355
68 Ga0105240_10126542 3300009093 Bacteria 3070
69 Ga0105240_10690952 3300009093 Bacteria 1115
70 Ga0111539_10003023 3300009094 Bacteria 22296
71 Ga0111539_10385092 3300009094 Bacteria 1633
72 Ga0105245_10040561 3300009098 Bacteria 4148
73 Ga0105245_10043263 3300009098 Bacteria 4018
74 Ga0105247_10020074 3300009101 Bacteria 4017
75 Ga0114129_10758228 3300009147 Bacteria 1242
76 Ga0105241_10312270 3300009174 Bacteria 1353
77 Ga0105248_10018376 3300009177 Bacteria 7723
78 Ga0105237_10101314 3300009545 Bacteria 2872
79 Ga0105239_10082433 3300010375 Bacteria 3542
80 Ga0105246_10121460 3300011119 Bacteria 1936
81 Ga0105246_10350550 3300011119 Bacteria 1209
82 Ga0157370_10054703 3300013104 Bacteria 3804
83 Ga0157374_10501492 3300013296 Bacteria 1218
84 Ga0163162_10568659 3300013306 Bacteria 1261
85 Ga0157372_10347708 3300013307 Bacteria 1727
86 Ga0157372_10562053 3300013307 Bacteria 1330
87 Ga0157377_10207107 3300014745 Bacteria 1249
88 Ga0157379_10176885 3300014968 Bacteria 1927
89 Ga0157376_10836118 3300014969 Bacteria 935
90 Ga0207426_1008554 3300025302 Bacteria 4117
91 Ga0207426_1014843 3300025302 Bacteria 2845
92 Ga0207713_1047816 3300025735 Bacteria 1728
93 Ga0207692_10023441 3300025898 Bacteria 2854
94 Ga0207680_10206325 3300025903 Bacteria 1342
95 Ga0207685_10002152 3300025905 Bacteria 4433
96 Ga0207699_10004496 3300025906 Bacteria 6661
97 Ga0207699_10037304 3300025906 Bacteria 2777
98 Ga0207645_10132922 3300025907 Bacteria 1620
99 Ga0207643_10000094 3300025908 Bacteria 60399
100 Ga0207705_10217914 3300025909 Bacteria 1449
101 Ga0207684_10142148 3300025910 Bacteria 2063
102 Ga0207707_10274372 3300025912 Bacteria 1461
103 Ga0207695_10676359 3300025913 Bacteria 913
104 Ga0207693_10074688 3300025915 Bacteria 2655
105 Ga0207693_10136345 3300025915 Bacteria 1929
106 Ga0207663_10061948 3300025916 Bacteria 2376
107 Ga0207663_10395909 3300025916 Bacteria 1055
108 Ga0207660_10230255 3300025917 Bacteria 1457
109 Ga0207657_10010275 3300025919 Bacteria 9344
110 Ga0207649_10032211 3300025920 Bacteria 3123
111 Ga0207649_10256299 3300025920 Bacteria 1262
112 Ga0207652_10036925 3300025921 Bacteria 4133
113 Ga0207681_10030821 3300025923 Bacteria 3499
114 Ga0207650_10053288 3300025925 Bacteria 2998
115 Ga0207659_10015654 3300025926 Bacteria 4921
116 Ga0207700_10053285 3300025928 Bacteria 3030
117 Ga0207700_10068783 3300025928 Bacteria 2715
118 Ga0207700_10423446 3300025928 Bacteria 1170
119 Ga0207664_10028954 3300025929 Bacteria 4215
120 Ga0207664_10418559 3300025929 Bacteria 1193
121 Ga0207644_10391790 3300025931 Bacteria 1134
122 Ga0207644_10438073 3300025931 Bacteria 1072
123 Ga0207690_10064938 3300025932 Bacteria 2494
124 Ga0207706_10007287 3300025933 Bacteria 10227
125 Ga0207706_10534753 3300025933 Bacteria 1010
126 Ga0207686_10408347 3300025934 Bacteria 1036
127 Ga0207670_10134841 3300025936 Bacteria 1814
128 Ga0207704_10368384 3300025938 Bacteria 1124
129 Ga0207665_10001973 3300025939 Bacteria 13823
130 Ga0207691_10171434 3300025940 Bacteria 1900
131 Ga0207711_10216467 3300025941 Bacteria 1751
132 Ga0207689_10001041 3300025942 Bacteria 26632
133 Ga0207689_10006876 3300025942 Bacteria 10003
134 Ga0207661_10041465 3300025944 Bacteria 3624
135 Ga0207661_10098725 3300025944 Bacteria 2447
136 Ga0207679_10119075 3300025945 Bacteria 2099
137 Ga0207679_10295889 3300025945 Bacteria 1393
138 Ga0207667_10034211 3300025949 Bacteria 5459
139 Ga0207667_10194763 3300025949 Bacteria 2079
140 Ga0207712_10163938 3300025961 Bacteria 1730
141 Ga0207668_10458756 3300025972 Bacteria 1089
142 Ga0207677_10061418 3300026023 Bacteria 2602
143 Ga0207677_10108913 3300026023 Bacteria 2058
144 Ga0207703_10210130 3300026035 Bacteria 1734
145 Ga0207708_10002714 3300026075 Bacteria 13005
146 Ga0207708_10030083 3300026075 Bacteria 4118
147 Ga0207702_10002824 3300026078 Bacteria 16246
148 Ga0207702_10457050 3300026078 Bacteria 1240
149 Ga0207641_10010889 3300026088 Bacteria 7451
150 Ga0207641_10593221 3300026088 Bacteria 1084
151 Ga0207676_10004885 3300026095 Bacteria 9492
152 Ga0207676_10342038 3300026095 Bacteria 1381
153 Ga0207676_10604338 3300026095 Bacteria 1054
154 Ga0207674_10030672 3300026116 Bacteria 5652
155 Ga0207674_10066421 3300026116 Bacteria 3633
156 Ga0207674_10590440 3300026116 Bacteria 1073
157 Ga0207675_100224851 3300026118 Bacteria 1809
158 Ga0207683_10004355 3300026121 Bacteria 12232
159 Ga0207698_10172092 3300026142 Bacteria 1908
160 Ga0207428_10027895 3300027907 Bacteria 4697
161 Ga0207428_10092499 3300027907 Bacteria 2347
162 Ga0268266_10240056 3300028379 Bacteria 1672
163 Ga0268264_10513508 3300028381 Bacteria 1170
164 Ga0265340_10015392 3300031247 Bacteria 3975
165 Ga0307408_100114609 3300031548 Bacteria 2077
166 Ga0265342_10071786 3300031712 Bacteria 2016
167 Ga0316576_10004792 3300031727 Bacteria 8173
168 Ga0316578_10007148 3300031728 Bacteria 5573
169 Ga0307405_10201409 3300031731 Bacteria 1446
170 Ga0307413_10021242 3300031824 Bacteria 3471
171 Ga0307413_10044388 3300031824 Bacteria 2627
172 Ga0307410_10134105 3300031852 Bacteria 1823
173 Ga0307410_10305687 3300031852 Bacteria 1256
174 Ga0307406_10106489 3300031901 Bacteria 1921
175 Ga0307406_10200015 3300031901 Bacteria 1470
176 Ga0307407_10065863 3300031903 Bacteria 2135
177 Ga0307407_10101293 3300031903 Bacteria 1788
178 Ga0307412_10198052 3300031911 Bacteria 1523
179 Ga0307409_100006897 3300031995 Bacteria 6734
180 Ga0307409_100026791 3300031995 Bacteria 4073
181 Ga0307409_100034990 3300031995 Bacteria 3676
182 Ga0307409_100168806 3300031995 Bacteria 1923
183 Ga0307409_100272845 3300031995 Bacteria 1558
184 Ga0307409_100330863 3300031995 Bacteria 1429
185 Ga0307409_100356924 3300031995 Bacteria 1381
186 Ga0307416_100107729 3300032002 Bacteria 2446
187 Ga0307414_10100577 3300032004 Bacteria 2175
188 Ga0307415_100090730 3300032126 Bacteria 2211
189 Ga0307415_100175085 3300032126 Bacteria 1677
190 Ga0373937_0308713 3300036401 Bacteria 1496
191 Ga0316584_0001763 3300036712 Bacteria 13306
192 Ga0395900_0662116 3300037418 Bacteria 980
193 Ga0436363_1575441 3300039450 Bacteria 941
194 Ga0439436_0001158 3300041404 Bacteria 7485
195 Ga0439439_0009411 3300041406 Bacteria 2323
196 Ga0439466_0087607 3300041411 Bacteria 978
197 Ga0451793_0322922 3300041452 Bacteria 2276
198 Ga0451800_0268066 3300041459 Bacteria 1382
199 Ga0451837_0378338 3300041494 Bacteria 2490
200 Ga0439433_0009447 3300041999 Bacteria 2124
201 Ga0439448_0005040 3300042005 Bacteria 3752
202 Ga0439457_000022 3300042014 Bacteria 30879
203 Ga0439462_0005421 3300042015 Bacteria 3144
204 Ga0439463_008572 3300042016 Bacteria 2519
205 Ga0450914_002868 3300042118 Bacteria 1274
206 Ga0466969_0191549 3300044656 Bacteria 934
207 Ga0466965_0099774 3300044683 Bacteria 1484
208 Ga0466965_0129513 3300044683 Bacteria 1308
209 Ga0466965_0249309 3300044683 Bacteria 952
210 Ga0466966_0032259 3300044684 Bacteria 3396
211 Ga0466961_0045728 3300044693 Bacteria 2800
212 Ga0466961_0054238 3300044693 Bacteria 2557
213 Ga0466961_0126024 3300044693 Bacteria 1607
214 Ga0466963_0014068 3300044694 Bacteria 4930
215 Ga0466963_0118133 3300044694 Bacteria 1823
216 Ga0466963_0299185 3300044694 Bacteria 1131
217 Ga0466971_0040169 3300044719 Bacteria 2101
218 Ga0466970_0020590 3300044765 Bacteria 3429
219 Ga0466970_0103854 3300044765 Bacteria 1549
220 Ga0466970_0166313 3300044765 Bacteria 1221
221 Ga0466960_0008862 3300044901 Bacteria 4132
222 Ga0466960_0022332 3300044901 Bacteria 2828
223 Ga0466960_0030437 3300044901 Bacteria 2484
224 Ga0466960_0127646 3300044901 Bacteria 1339
225 Ga0466959_0084709 3300045049 Bacteria 2282
226 Ga0466959_0204990 3300045049 Bacteria 1372
227 Ga0466959_0279431 3300045049 Bacteria 1146
228 Ga0466958_0038874 3300045836 Bacteria 2856
229 Ga0466958_0089973 3300045836 Bacteria 1898
230 Ga0466958_0098884 3300045836 Bacteria 1812
231 Ga0466958_0165690 3300045836 Bacteria 1398
232 Ga0466967_0040513 3300045976 Bacteria 4011
233 Ga0466967_0085358 3300045976 Bacteria 2858
234 Ga0466967_0218664 3300045976 Bacteria 1809
235 Ga0466967_0233892 3300045976 Bacteria 1750
236 Ga0466967_0806546 3300045976 Bacteria 932
237 Ga0495617_035542 3300046452 Bacteria 1673
238 Ga0495594_0076513 3300046499 Bacteria 1866
239 Ga0495630_0260548 3300046517 Bacteria 1325
240 Ga0495611_0041981 3300046648 Bacteria 2041
241 Ga0495625_0108304 3300046660 Bacteria 1901
242 Ga0495581_0176673 3300047315 Bacteria 1248
243 Ga0495636_0014494 3300047318 Bacteria 3135
244 Ga0495685_007664 3300047447 Bacteria 3570
245 Ga0496100_0085835 3300048903 Bacteria 2137
246 Ga0496100_0313746 3300048903 Bacteria 1176
247 Ga0496101_0041564 3300048904 Bacteria 3279
248 Ga0496102_0012183 3300048905 Bacteria 7434
249 Ga0496102_0050310 3300048905 Bacteria 3794
250 Ga0496102_0105644 3300048905 Bacteria 2620
251 Ga0496102_0641530 3300048905 Bacteria 985
252 Ga0496104_0000511 3300048907 Bacteria 33274
253 Ga0496104_0407297 3300048907 Bacteria 1272
254 Ga0496104_0461120 3300048907 Bacteria 1182
255 Ga0496105_0003246 3300048908 Bacteria 11988
256 Ga0496105_0143789 3300048908 Bacteria 1962
257 Ga0496105_0330956 3300048908 Bacteria 1219
258 Ga0496106_0548262 3300048909 Bacteria 928
259 Ga0496107_0168123 3300048910 Bacteria 1626
260 Ga0496108_0051442 3300048911 Bacteria 3451
261 Ga0496108_0068172 3300048911 Bacteria 3001
262 Ga0496108_0239720 3300048911 Bacteria 1577
263 Ga0496108_0535124 3300048911 Bacteria 1022
264 Ga0496109_0013452 3300048912 Bacteria 7098
265 Ga0496109_0101093 3300048912 Bacteria 2676
266 Ga0496110_0162989 3300048913 Bacteria 2021
267 Ga0496110_0168219 3300048913 Bacteria 1988
268 Ga0496111_0002429 3300048914 Bacteria 11240
269 Ga0496111_0489937 3300048914 Bacteria 905
270 Ga0496111_0609253 3300048914 Bacteria 799
271 Ga0496112_0000637 3300048915 Bacteria 24324
272 Ga0496112_0069559 3300048915 Bacteria 3477
273 Ga0496112_0449939 3300048915 Bacteria 1226
274 Ga0496113_0020485 3300048916 Bacteria 4650
275 Ga0496113_0033703 3300048916 Bacteria 3731
276 Ga0496113_0087536 3300048916 Bacteria 2395
277 Ga0496115_0024076 3300048918 Bacteria 4730
278 Ga0496119_0032543 3300048922 Bacteria 3473
279 Ga0496126_0032512 3300048929 Bacteria 4914
280 Ga0501323_007454 3300049539 Bacteria 1249
281 Ga0501040_0272738 3300049576 Bacteria 1208
282 Ga0501040_0685338 3300049576 Bacteria 741
283 Ga0501041_0188330 3300049577 Bacteria 1292
284 Ga0501042_0074594 3300049578 Bacteria 2428
285 Ga0501042_0396051 3300049578 Bacteria 1000
286 Ga0501046_0374561 3300049580 Bacteria 1031
287 Ga0501067_0013629 3300049583 Bacteria 4501
288 Ga0501067_0189439 3300049583 Bacteria 1146
289 Ga0501068_0018869 3300049584 Bacteria 3997
290 Ga0501069_0107819 3300049585 Bacteria 1584
291 Ga0501070_0041882 3300049586 Bacteria 3813
292 Ga0501072_0317960 3300049588 Bacteria 1237
293 Ga0501035_0027987 3300049822 Bacteria 5149
294 Ga0501045_0180349 3300049824 Bacteria 1574
295 nmdc:mga09592_617172_c1 3300050508 Bacteria 928
296 nmdc:mga0qj67_416571_c1 3300050509 Bacteria 1083
297 nmdc:mga08y16_63974_c1 3300050511 Bacteria 3842
298 nmdc:mga08y16_9086_c1 3300050511 Bacteria 10434
299 nmdc:mga0n895_330047_c1 3300050512 Bacteria 1546
300 nmdc:mga0rr50_152305_c1 3300050513 Bacteria 1870
301 Ga0495655_0037803 3300053083 Bacteria 1215
302 Ga0466962_0030800 3300061719 Bacteria 2569
303 Ga0466962_0146945 3300061719 Bacteria 1143
304 Ga0466962_0172716 3300061719 Bacteria 1053
305 Ga0530510_0108004 3300061734 Bacteria 2037
306 Ga0530510_0108638 3300061734 Bacteria 2031
307 2515850852 2515154155 Bacteria 7985436
308 2616899363 2616644941 Bacteria 8510691
309 2643759243 2643221548 Bacteria 8053412
310 2643825608 2643221561 Bacteria 4984412
311 2643897312 2643221578 Bacteria 9213798
312 2644408457 2643221673 Bacteria 9196637
313 2644463339 2643221682 Bacteria 6743283
314 2644531605 2643221696 Bacteria 5431823
315 2812359658 2811994879 Bacteria 9313447
316 2819694183 2818991463 Bacteria 7948711
317 2852638360 2852635781 Bacteria 8251373
318 2857711737 2857710386 Bacteria 3186771
319 2867478247 2867475112 Bacteria 6909112
320 2875393252 2875391855 Bacteria 7600475
321 2946051437 2946045630 Bacteria 8527308
322 2946066251 2946064051 Bacteria 8957905
323 2966603810 2966598605 Bacteria 7676064
324 2984580594 2984576629 Bacteria 4248407
325 2990258286 2990256926 Bacteria 4252839
326 2997458614 2997451912 Bacteria 8492419
327 3001891675 3001889506 Bacteria 2975194
328 8054163597 8054160619 Bacteria 7783213
329 nmdc:mga00v17_122112_c1
330 JGI25160J50197_1008354
331 Ga0070658_10056506
332 Ga0070658_10157566
333 Ga0068869_100007230
334 Ga0068869_100048888
335 Ga0070680_100076468
336 Ga0070680_100388298
337 Ga0070682_100323656
338 Ga0070682_100516288
339 Ga0068868_100044101
340 Ga0068868_100148642
341 Ga0070660_100271753
342 Ga0070691_10242380
343 Ga0070687_100085421
344 Ga0070661_100063581
345 Ga0070692_10012398
346 Ga0070692_10091343
347 Ga0070669_100112196
348 Ga0070675_100063284
349 Ga0070671_100003386
350 Ga0070671_100270551
351 Ga0070688_100145406
352 Ga0070659_100018870
353 Ga0070709_10018247
354 Ga0070714_100173776
355 Ga0070714_100365921
356 Ga0070713_100047355
357 Ga0070711_100017937
358 Ga0070711_100028693
359 Ga0070700_100172993
360 Ga0070663_100015401
361 Ga0070678_100002907
362 Ga0070662_100073919
363 Ga0070681_10071121
364 Ga0068867_100224300
365 Ga0070706_100006076
366 Ga0070706_100353873
367 Ga0070698_100016157
368 Ga0070684_100014190
369 Ga0070684_100317625
370 Ga0070672_100057900
371 Ga0070693_100007302
372 Ga0070665_100708579
373 Ga0068855_100037676
374 Ga0070664_100006628
375 Ga0070664_100196446
376 Ga0070664_100285349
377 Ga0068854_100415208
378 Ga0070702_100001182
379 Ga0068859_100159755
380 Ga0068864_100432012
381 Ga0068864_100520097
382 Ga0068870_10018076
383 Ga0068863_100008042
384 Ga0068858_100018248
385 Ga0068860_100095938
386 Ga0068860_100346203
387 Ga0070717_10018827
388 Ga0070715_10014221
389 Ga0068871_100019439
390 Ga0075428_100360048
391 Ga0075430_100210266
392 Ga0075429_100720168
393 Ga0097620_100159747
394 Ga0075435_100096723
395 Ga0105251_10096421
396 Ga0105240_10126542
397 Ga0105240_10690952
398 Ga0111539_10003023
399 Ga0111539_10385092
400 Ga0105245_10040561
401 Ga0105245_10043263
402 Ga0105247_10020074
403 Ga0114129_10758228
404 Ga0105241_10312270
405 Ga0105248_10018376
406 Ga0105237_10101314
407 Ga0105239_10082433
408 Ga0105246_10121460
409 Ga0105246_10350550
410 Ga0157370_10054703
411 Ga0157374_10501492
412 Ga0163162_10568659
413 Ga0157372_10347708
414 Ga0157372_10562053
415 Ga0157377_10207107
416 Ga0157379_10176885
417 Ga0157376_10836118
418 Ga0207426_1008554
419 Ga0207426_1014843
420 Ga0207713_1047816
421 Ga0207692_10023441
422 Ga0207680_10206325
423 Ga0207685_10002152
424 Ga0207699_10004496
425 Ga0207699_10037304
426 Ga0207645_10132922
427 Ga0207643_10000094
428 Ga0207705_10217914
429 Ga0207684_10142148
430 Ga0207707_10274372
431 Ga0207695_10676359
432 Ga0207693_10074688
433 Ga0207693_10136345
434 Ga0207663_10061948
435 Ga0207663_10395909
436 Ga0207660_10230255
437 Ga0207657_10010275
438 Ga0207649_10032211
439 Ga0207649_10256299
440 Ga0207652_10036925
441 Ga0207681_10030821
442 Ga0207650_10053288
443 Ga0207659_10015654
444 Ga0207700_10053285
445 Ga0207700_10068783
446 Ga0207700_10423446
447 Ga0207664_10028954
448 Ga0207664_10418559
449 Ga0207644_10391790
450 Ga0207644_10438073
451 Ga0207690_10064938
452 Ga0207706_10007287
453 Ga0207706_10534753
454 Ga0207686_10408347
455 Ga0207670_10134841
456 Ga0207704_10368384
457 Ga0207665_10001973
458 Ga0207691_10171434
459 Ga0207711_10216467
460 Ga0207689_10001041
461 Ga0207689_10006876
462 Ga0207661_10041465
463 Ga0207661_10098725
464 Ga0207679_10119075
465 Ga0207679_10295889
466 Ga0207667_10034211
467 Ga0207667_10194763
468 Ga0207712_10163938
469 Ga0207668_10458756
470 Ga0207677_10061418
471 Ga0207677_10108913
472 Ga0207703_10210130
473 Ga0207708_10002714
474 Ga0207708_10030083
475 Ga0207702_10002824
476 Ga0207702_10457050
477 Ga0207641_10010889
478 Ga0207641_10593221
479 Ga0207676_10004885
480 Ga0207676_10342038
481 Ga0207676_10604338
482 Ga0207674_10030672
483 Ga0207674_10066421
484 Ga0207674_10590440
485 Ga0207675_100224851
486 Ga0207683_10004355
487 Ga0207698_10172092
488 Ga0207428_10027895
489 Ga0207428_10092499
490 Ga0268266_10240056
491 Ga0268264_10513508
492 Ga0265340_10015392
493 Ga0307408_100114609
494 Ga0265342_10071786
495 Ga0316576_10004792
496 Ga0316578_10007148
497 Ga0307405_10201409
498 Ga0307413_10021242
499 Ga0307413_10044388
500 Ga0307410_10134105
501 Ga0307410_10305687
502 Ga0307406_10106489
503 Ga0307406_10200015
504 Ga0307407_10065863
505 Ga0307407_10101293
506 Ga0307412_10198052
507 Ga0307409_100006897
508 Ga0307409_100026791
509 Ga0307409_100034990
510 Ga0307409_100168806
511 Ga0307409_100272845
512 Ga0307409_100330863
513 Ga0307409_100356924
514 Ga0307416_100107729
515 Ga0307414_10100577
516 Ga0307415_100090730
517 Ga0307415_100175085
518 Ga0373937_0308713
519 Ga0316584_0001763
520 Ga0395900_0662116
521 Ga0436363_1575441
522 Ga0439436_0001158
523 Ga0439439_0009411
524 Ga0439466_0087607
525 Ga0451793_0322922
526 Ga0451800_0268066
527 Ga0451837_0378338
528 Ga0439433_0009447
529 Ga0439448_0005040
530 Ga0439457_000022
531 Ga0439462_0005421
532 Ga0439463_008572
533 Ga0450914_002868
534 Ga0466969_0191549
535 Ga0466965_0099774
536 Ga0466965_0129513
537 Ga0466965_0249309
538 Ga0466966_0032259
539 Ga0466961_0045728
540 Ga0466961_0054238
541 Ga0466961_0126024
542 Ga0466963_0014068
543 Ga0466963_0118133
544 Ga0466963_0299185
545 Ga0466971_0040169
546 Ga0466970_0020590
547 Ga0466970_0103854
548 Ga0466970_0166313
549 Ga0466960_0008862
550 Ga0466960_0022332
551 Ga0466960_0030437
552 Ga0466960_0127646
553 Ga0466959_0084709
554 Ga0466959_0204990
555 Ga0466959_0279431
556 Ga0466958_0038874
557 Ga0466958_0089973
558 Ga0466958_0098884
559 Ga0466958_0165690
560 Ga0466967_0040513
561 Ga0466967_0085358
562 Ga0466967_0218664
563 Ga0466967_0233892
564 Ga0466967_0806546
565 Ga0495617_035542
566 Ga0495594_0076513
567 Ga0495630_0260548
568 Ga0495611_0041981
569 Ga0495625_0108304
570 Ga0495581_0176673
571 Ga0495636_0014494
572 Ga0495685_007664
573 Ga0496100_0085835
574 Ga0496100_0313746
575 Ga0496101_0041564
576 Ga0496102_0012183
577 Ga0496102_0050310
578 Ga0496102_0105644
579 Ga0496102_0641530
580 Ga0496104_0000511
581 Ga0496104_0407297
582 Ga0496104_0461120
583 Ga0496105_0003246
584 Ga0496105_0143789
585 Ga0496105_0330956
586 Ga0496106_0548262
587 Ga0496107_0168123
588 Ga0496108_0051442
589 Ga0496108_0068172
590 Ga0496108_0239720
591 Ga0496108_0535124
592 Ga0496109_0013452
593 Ga0496109_0101093
594 Ga0496110_0162989
595 Ga0496110_0168219
596 Ga0496111_0002429
597 Ga0496111_0489937
598 Ga0496111_0609253
599 Ga0496112_0000637
600 Ga0496112_0069559
601 Ga0496112_0449939
602 Ga0496113_0020485
603 Ga0496113_0033703
604 Ga0496113_0087536
605 Ga0496115_0024076
606 Ga0496119_0032543
607 Ga0496126_0032512
608 Ga0501323_007454
609 Ga0501040_0272738
610 Ga0501040_0685338
611 Ga0501041_0188330
612 Ga0501042_0074594
613 Ga0501042_0396051
614 Ga0501046_0374561
615 Ga0501067_0013629
616 Ga0501067_0189439
617 Ga0501068_0018869
618 Ga0501069_0107819
619 Ga0501070_0041882
620 Ga0501072_0317960
621 Ga0501035_0027987
622 Ga0501045_0180349
623 nmdc:mga09592_617172_c1
624 nmdc:mga0qj67_416571_c1
625 nmdc:mga08y16_63974_c1
626 nmdc:mga08y16_9086_c1
627 nmdc:mga0n895_330047_c1
628 nmdc:mga0rr50_152305_c1
629 Ga0495655_0037803
630 Ga0466962_0030800
631 Ga0466962_0146945
632 Ga0466962_0172716
633 Ga0530510_0108004
634 Ga0530510_0108638
635 2515850852
636 2616899363
637 2643759243
638 2643825608
639 2643897312
640 2644408457
641 2644463339
642 2644531605
643 2812359658
644 2819694183
645 2852638360
646 2857711737
647 2867478247
648 2875393252
649 2946051437
650 2946066251
651 2966603810
652 2984580594
653 2990258286
654 2997458614
655 3001891675
656 8054163597

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00977

His_biosynth

Histidine biosynthesis protein

11

238

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u28-assembly1.cif.gz_A crystal structure of apo phosphoribosyl isomerase a from streptomyces sviceus atcc 29083 0.9895 3 240
4w9t-assembly1.cif.gz_A crystal structure of hisap from streptomyces sp. mg1 0.9883 3 240
2vep-assembly1.cif.gz_A crystal structure of the full length bifunctional enzyme pria 0.9811 1 240
4x2r-assembly1.cif.gz_A crystal structure of pria from actinomyces urogenitalis 0.9805 3 239
4x9s-assembly1.cif.gz_A crystal structure of hisap from streptomyces sp. mg1 0.9792 1 239
ID Description Score Start End Superfamily
4x2rA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9806 3 239 3.20.20.70
4x2rA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9445 3 239 3.20.20.70
af_Q58927_1_237_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9292 4 239 3.20.20.70
af_P10371_1_245_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9242 6 238 3.20.20.70
af_Q58927_1_237_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.918 4 239 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A7W1Q3J5-F1-model_v4 Bifunctional 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase/phosphoribosylanthranilate isomerase PriA (EC 5.3.1.16, EC 5.3.1.24) 1.002 166 239 GO:0000105
GO:0000162
GO:0003949
GO:0004640
GO:0005737
AF-A0A655IQI9-F1-model_v4 Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase HISA (EC 5.3.1.16) 1.001 152 240 GO:0000105
GO:0000162
GO:0003949
GO:0005737
AF-A0A1N0CFR1-F1-model_v4 deleted 0.9953 165 240
AF-A0A3C0UAN0-F1-model_v4 Bifunctional 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase/phosphoribosylanthranilate isomerase PriA (EC 5.3.1.16, EC 5.3.1.24) 0.9953 160 240 GO:0000105
GO:0000162
GO:0003949
GO:0004640
GO:0005737
AF-A0A3C0ATR8-F1-model_v4 Bifunctional 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase/phosphoribosylanthranilate isomerase PriA (EC 5.3.1.16, EC 5.3.1.24) 0.9921 4 101 GO:0000105
GO:0000162
GO:0003949
GO:0004640
GO:0005737

Map