F409442
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 328 | 228 | 656 | 251 |
Family's Representative Sequence
| Representative Sequence | 3300050491|nmdc:mga00v17_122112_c1|nmdc:mga00v17_122112_c1_160_912 |
| Length | 250 |
| Sequence | VTAFTEQPRLTLLPAIDIVDGAAVRLVQGEAGSETDYGSPLDAALQWIDQGAEWIHLVDLDAAFGRGSNAGVIRKVLAHAKHVRIELSGGIRDDASLEAALEHGAARVNLGTAALEDPEWTAAVIARYGEQIAVGLDVRGDTLAARGWTEDSGNLWEVLDRLEDASCPRYVVTDVTRDGMMQGPNIDLLRRVSQRTERPVVASGGISSLDDLAALRDLVPLGVEGAIVGKALYSGAFTLGAALDVAGRAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 2 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 39 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 40 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 41 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 42 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 43 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 44 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 47 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 48 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 49 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 50 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 52 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 119 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 122 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 123 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 124 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 125 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 126 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 127 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 128 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 129 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 130 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 131 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 132 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 133 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 134 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 135 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 136 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 137 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 138 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 139 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 140 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 141 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 142 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 143 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 144 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 145 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 146 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 147 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 148 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 149 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 150 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 151 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 152 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 153 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 154 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 155 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 156 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 157 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 158 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 159 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 160 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 161 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 162 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 163 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 172 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 173 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 174 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 175 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 176 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 177 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 178 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 179 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 180 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 181 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 182 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 183 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 184 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 185 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 186 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 187 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 188 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 200 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 201 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 202 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 203 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 204 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 206 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 207 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 208 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 209 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 210 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 211 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 212 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 213 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 214 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 215 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 216 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 217 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 218 | 2857710386 | Brevibacterium sp. R-73093 | Isolate | Unclassified |
| 219 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 220 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 221 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 222 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 223 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 224 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 225 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 226 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 227 | 3001889506 | Janibacter sp. YIM B02568 | Isolate | Unclassified |
| 228 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.99 |
| Metatranscriptomes | 0.3 |
| Isolates | 6.71 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.61 |
| Bulb | 0 |
| Endosphere | 1.22 |
| Nodule | 0 |
| Rhizoplane | 10.67 |
| Rhizosphere | 83.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | nmdc:mga00v17_122112_c1 | 3300050491 | Bacteria | 1659 |
| 2 | JGI25160J50197_1008354 | 3300003354 | Bacteria | 3951 |
| 3 | Ga0070658_10056506 | 3300005327 | Bacteria | 3190 |
| 4 | Ga0070658_10157566 | 3300005327 | Bacteria | 1904 |
| 5 | Ga0068869_100007230 | 3300005334 | Bacteria | 7077 |
| 6 | Ga0068869_100048888 | 3300005334 | Bacteria | 3060 |
| 7 | Ga0070680_100076468 | 3300005336 | Bacteria | 2756 |
| 8 | Ga0070680_100388298 | 3300005336 | Bacteria | 1189 |
| 9 | Ga0070682_100323656 | 3300005337 | Bacteria | 1140 |
| 10 | Ga0070682_100516288 | 3300005337 | Bacteria | 928 |
| 11 | Ga0068868_100044101 | 3300005338 | Bacteria | 3486 |
| 12 | Ga0068868_100148642 | 3300005338 | Bacteria | 1928 |
| 13 | Ga0070660_100271753 | 3300005339 | Bacteria | 1385 |
| 14 | Ga0070691_10242380 | 3300005341 | Bacteria | 963 |
| 15 | Ga0070687_100085421 | 3300005343 | Bacteria | 1732 |
| 16 | Ga0070661_100063581 | 3300005344 | Bacteria | 2711 |
| 17 | Ga0070692_10012398 | 3300005345 | Bacteria | 3945 |
| 18 | Ga0070692_10091343 | 3300005345 | Bacteria | 1655 |
| 19 | Ga0070669_100112196 | 3300005353 | Bacteria | 2070 |
| 20 | Ga0070675_100063284 | 3300005354 | Bacteria | 3058 |
| 21 | Ga0070671_100003386 | 3300005355 | Bacteria | 12436 |
| 22 | Ga0070671_100270551 | 3300005355 | Bacteria | 1444 |
| 23 | Ga0070688_100145406 | 3300005365 | Bacteria | 1615 |
| 24 | Ga0070659_100018870 | 3300005366 | Bacteria | 5210 |
| 25 | Ga0070709_10018247 | 3300005434 | Bacteria | 4037 |
| 26 | Ga0070714_100173776 | 3300005435 | Bacteria | 1957 |
| 27 | Ga0070714_100365921 | 3300005435 | Bacteria | 1357 |
| 28 | Ga0070713_100047355 | 3300005436 | Bacteria | 3533 |
| 29 | Ga0070711_100017937 | 3300005439 | Bacteria | 4512 |
| 30 | Ga0070711_100028693 | 3300005439 | Bacteria | 3664 |
| 31 | Ga0070700_100172993 | 3300005441 | Bacteria | 1497 |
| 32 | Ga0070663_100015401 | 3300005455 | Bacteria | 4935 |
| 33 | Ga0070678_100002907 | 3300005456 | Bacteria | 9487 |
| 34 | Ga0070662_100073919 | 3300005457 | Bacteria | 2520 |
| 35 | Ga0070681_10071121 | 3300005458 | Bacteria | 3444 |
| 36 | Ga0068867_100224300 | 3300005459 | Bacteria | 1516 |
| 37 | Ga0070706_100006076 | 3300005467 | Bacteria | 11412 |
| 38 | Ga0070706_100353873 | 3300005467 | Bacteria | 1369 |
| 39 | Ga0070698_100016157 | 3300005471 | Bacteria | 7881 |
| 40 | Ga0070684_100014190 | 3300005535 | Bacteria | 6445 |
| 41 | Ga0070684_100317625 | 3300005535 | Bacteria | 1431 |
| 42 | Ga0070672_100057900 | 3300005543 | Bacteria | 3044 |
| 43 | Ga0070693_100007302 | 3300005547 | Bacteria | 5397 |
| 44 | Ga0070665_100708579 | 3300005548 | Bacteria | 1020 |
| 45 | Ga0068855_100037676 | 3300005563 | Bacteria | 5748 |
| 46 | Ga0070664_100006628 | 3300005564 | Bacteria | 9336 |
| 47 | Ga0070664_100196446 | 3300005564 | Bacteria | 1798 |
| 48 | Ga0070664_100285349 | 3300005564 | Bacteria | 1489 |
| 49 | Ga0068854_100415208 | 3300005578 | Bacteria | 1117 |
| 50 | Ga0070702_100001182 | 3300005615 | Bacteria | 10518 |
| 51 | Ga0068859_100159755 | 3300005617 | Bacteria | 2333 |
| 52 | Ga0068864_100432012 | 3300005618 | Bacteria | 1256 |
| 53 | Ga0068864_100520097 | 3300005618 | Bacteria | 1147 |
| 54 | Ga0068870_10018076 | 3300005840 | Bacteria | 3398 |
| 55 | Ga0068863_100008042 | 3300005841 | Bacteria | 10298 |
| 56 | Ga0068858_100018248 | 3300005842 | Bacteria | 6570 |
| 57 | Ga0068860_100095938 | 3300005843 | Bacteria | 2827 |
| 58 | Ga0068860_100346203 | 3300005843 | Bacteria | 1462 |
| 59 | Ga0070717_10018827 | 3300006028 | Bacteria | 5401 |
| 60 | Ga0070715_10014221 | 3300006163 | Bacteria | 2942 |
| 61 | Ga0068871_100019439 | 3300006358 | Bacteria | 5186 |
| 62 | Ga0075428_100360048 | 3300006844 | Bacteria | 1561 |
| 63 | Ga0075430_100210266 | 3300006846 | Bacteria | 1614 |
| 64 | Ga0075429_100720168 | 3300006880 | Bacteria | 874 |
| 65 | Ga0097620_100159747 | 3300006931 | Bacteria | 2333 |
| 66 | Ga0075435_100096723 | 3300007076 | Bacteria | 2442 |
| 67 | Ga0105251_10096421 | 3300009011 | Bacteria | 1355 |
| 68 | Ga0105240_10126542 | 3300009093 | Bacteria | 3070 |
| 69 | Ga0105240_10690952 | 3300009093 | Bacteria | 1115 |
| 70 | Ga0111539_10003023 | 3300009094 | Bacteria | 22296 |
| 71 | Ga0111539_10385092 | 3300009094 | Bacteria | 1633 |
| 72 | Ga0105245_10040561 | 3300009098 | Bacteria | 4148 |
| 73 | Ga0105245_10043263 | 3300009098 | Bacteria | 4018 |
| 74 | Ga0105247_10020074 | 3300009101 | Bacteria | 4017 |
| 75 | Ga0114129_10758228 | 3300009147 | Bacteria | 1242 |
| 76 | Ga0105241_10312270 | 3300009174 | Bacteria | 1353 |
| 77 | Ga0105248_10018376 | 3300009177 | Bacteria | 7723 |
| 78 | Ga0105237_10101314 | 3300009545 | Bacteria | 2872 |
| 79 | Ga0105239_10082433 | 3300010375 | Bacteria | 3542 |
| 80 | Ga0105246_10121460 | 3300011119 | Bacteria | 1936 |
| 81 | Ga0105246_10350550 | 3300011119 | Bacteria | 1209 |
| 82 | Ga0157370_10054703 | 3300013104 | Bacteria | 3804 |
| 83 | Ga0157374_10501492 | 3300013296 | Bacteria | 1218 |
| 84 | Ga0163162_10568659 | 3300013306 | Bacteria | 1261 |
| 85 | Ga0157372_10347708 | 3300013307 | Bacteria | 1727 |
| 86 | Ga0157372_10562053 | 3300013307 | Bacteria | 1330 |
| 87 | Ga0157377_10207107 | 3300014745 | Bacteria | 1249 |
| 88 | Ga0157379_10176885 | 3300014968 | Bacteria | 1927 |
| 89 | Ga0157376_10836118 | 3300014969 | Bacteria | 935 |
| 90 | Ga0207426_1008554 | 3300025302 | Bacteria | 4117 |
| 91 | Ga0207426_1014843 | 3300025302 | Bacteria | 2845 |
| 92 | Ga0207713_1047816 | 3300025735 | Bacteria | 1728 |
| 93 | Ga0207692_10023441 | 3300025898 | Bacteria | 2854 |
| 94 | Ga0207680_10206325 | 3300025903 | Bacteria | 1342 |
| 95 | Ga0207685_10002152 | 3300025905 | Bacteria | 4433 |
| 96 | Ga0207699_10004496 | 3300025906 | Bacteria | 6661 |
| 97 | Ga0207699_10037304 | 3300025906 | Bacteria | 2777 |
| 98 | Ga0207645_10132922 | 3300025907 | Bacteria | 1620 |
| 99 | Ga0207643_10000094 | 3300025908 | Bacteria | 60399 |
| 100 | Ga0207705_10217914 | 3300025909 | Bacteria | 1449 |
| 101 | Ga0207684_10142148 | 3300025910 | Bacteria | 2063 |
| 102 | Ga0207707_10274372 | 3300025912 | Bacteria | 1461 |
| 103 | Ga0207695_10676359 | 3300025913 | Bacteria | 913 |
| 104 | Ga0207693_10074688 | 3300025915 | Bacteria | 2655 |
| 105 | Ga0207693_10136345 | 3300025915 | Bacteria | 1929 |
| 106 | Ga0207663_10061948 | 3300025916 | Bacteria | 2376 |
| 107 | Ga0207663_10395909 | 3300025916 | Bacteria | 1055 |
| 108 | Ga0207660_10230255 | 3300025917 | Bacteria | 1457 |
| 109 | Ga0207657_10010275 | 3300025919 | Bacteria | 9344 |
| 110 | Ga0207649_10032211 | 3300025920 | Bacteria | 3123 |
| 111 | Ga0207649_10256299 | 3300025920 | Bacteria | 1262 |
| 112 | Ga0207652_10036925 | 3300025921 | Bacteria | 4133 |
| 113 | Ga0207681_10030821 | 3300025923 | Bacteria | 3499 |
| 114 | Ga0207650_10053288 | 3300025925 | Bacteria | 2998 |
| 115 | Ga0207659_10015654 | 3300025926 | Bacteria | 4921 |
| 116 | Ga0207700_10053285 | 3300025928 | Bacteria | 3030 |
| 117 | Ga0207700_10068783 | 3300025928 | Bacteria | 2715 |
| 118 | Ga0207700_10423446 | 3300025928 | Bacteria | 1170 |
| 119 | Ga0207664_10028954 | 3300025929 | Bacteria | 4215 |
| 120 | Ga0207664_10418559 | 3300025929 | Bacteria | 1193 |
| 121 | Ga0207644_10391790 | 3300025931 | Bacteria | 1134 |
| 122 | Ga0207644_10438073 | 3300025931 | Bacteria | 1072 |
| 123 | Ga0207690_10064938 | 3300025932 | Bacteria | 2494 |
| 124 | Ga0207706_10007287 | 3300025933 | Bacteria | 10227 |
| 125 | Ga0207706_10534753 | 3300025933 | Bacteria | 1010 |
| 126 | Ga0207686_10408347 | 3300025934 | Bacteria | 1036 |
| 127 | Ga0207670_10134841 | 3300025936 | Bacteria | 1814 |
| 128 | Ga0207704_10368384 | 3300025938 | Bacteria | 1124 |
| 129 | Ga0207665_10001973 | 3300025939 | Bacteria | 13823 |
| 130 | Ga0207691_10171434 | 3300025940 | Bacteria | 1900 |
| 131 | Ga0207711_10216467 | 3300025941 | Bacteria | 1751 |
| 132 | Ga0207689_10001041 | 3300025942 | Bacteria | 26632 |
| 133 | Ga0207689_10006876 | 3300025942 | Bacteria | 10003 |
| 134 | Ga0207661_10041465 | 3300025944 | Bacteria | 3624 |
| 135 | Ga0207661_10098725 | 3300025944 | Bacteria | 2447 |
| 136 | Ga0207679_10119075 | 3300025945 | Bacteria | 2099 |
| 137 | Ga0207679_10295889 | 3300025945 | Bacteria | 1393 |
| 138 | Ga0207667_10034211 | 3300025949 | Bacteria | 5459 |
| 139 | Ga0207667_10194763 | 3300025949 | Bacteria | 2079 |
| 140 | Ga0207712_10163938 | 3300025961 | Bacteria | 1730 |
| 141 | Ga0207668_10458756 | 3300025972 | Bacteria | 1089 |
| 142 | Ga0207677_10061418 | 3300026023 | Bacteria | 2602 |
| 143 | Ga0207677_10108913 | 3300026023 | Bacteria | 2058 |
| 144 | Ga0207703_10210130 | 3300026035 | Bacteria | 1734 |
| 145 | Ga0207708_10002714 | 3300026075 | Bacteria | 13005 |
| 146 | Ga0207708_10030083 | 3300026075 | Bacteria | 4118 |
| 147 | Ga0207702_10002824 | 3300026078 | Bacteria | 16246 |
| 148 | Ga0207702_10457050 | 3300026078 | Bacteria | 1240 |
| 149 | Ga0207641_10010889 | 3300026088 | Bacteria | 7451 |
| 150 | Ga0207641_10593221 | 3300026088 | Bacteria | 1084 |
| 151 | Ga0207676_10004885 | 3300026095 | Bacteria | 9492 |
| 152 | Ga0207676_10342038 | 3300026095 | Bacteria | 1381 |
| 153 | Ga0207676_10604338 | 3300026095 | Bacteria | 1054 |
| 154 | Ga0207674_10030672 | 3300026116 | Bacteria | 5652 |
| 155 | Ga0207674_10066421 | 3300026116 | Bacteria | 3633 |
| 156 | Ga0207674_10590440 | 3300026116 | Bacteria | 1073 |
| 157 | Ga0207675_100224851 | 3300026118 | Bacteria | 1809 |
| 158 | Ga0207683_10004355 | 3300026121 | Bacteria | 12232 |
| 159 | Ga0207698_10172092 | 3300026142 | Bacteria | 1908 |
| 160 | Ga0207428_10027895 | 3300027907 | Bacteria | 4697 |
| 161 | Ga0207428_10092499 | 3300027907 | Bacteria | 2347 |
| 162 | Ga0268266_10240056 | 3300028379 | Bacteria | 1672 |
| 163 | Ga0268264_10513508 | 3300028381 | Bacteria | 1170 |
| 164 | Ga0265340_10015392 | 3300031247 | Bacteria | 3975 |
| 165 | Ga0307408_100114609 | 3300031548 | Bacteria | 2077 |
| 166 | Ga0265342_10071786 | 3300031712 | Bacteria | 2016 |
| 167 | Ga0316576_10004792 | 3300031727 | Bacteria | 8173 |
| 168 | Ga0316578_10007148 | 3300031728 | Bacteria | 5573 |
| 169 | Ga0307405_10201409 | 3300031731 | Bacteria | 1446 |
| 170 | Ga0307413_10021242 | 3300031824 | Bacteria | 3471 |
| 171 | Ga0307413_10044388 | 3300031824 | Bacteria | 2627 |
| 172 | Ga0307410_10134105 | 3300031852 | Bacteria | 1823 |
| 173 | Ga0307410_10305687 | 3300031852 | Bacteria | 1256 |
| 174 | Ga0307406_10106489 | 3300031901 | Bacteria | 1921 |
| 175 | Ga0307406_10200015 | 3300031901 | Bacteria | 1470 |
| 176 | Ga0307407_10065863 | 3300031903 | Bacteria | 2135 |
| 177 | Ga0307407_10101293 | 3300031903 | Bacteria | 1788 |
| 178 | Ga0307412_10198052 | 3300031911 | Bacteria | 1523 |
| 179 | Ga0307409_100006897 | 3300031995 | Bacteria | 6734 |
| 180 | Ga0307409_100026791 | 3300031995 | Bacteria | 4073 |
| 181 | Ga0307409_100034990 | 3300031995 | Bacteria | 3676 |
| 182 | Ga0307409_100168806 | 3300031995 | Bacteria | 1923 |
| 183 | Ga0307409_100272845 | 3300031995 | Bacteria | 1558 |
| 184 | Ga0307409_100330863 | 3300031995 | Bacteria | 1429 |
| 185 | Ga0307409_100356924 | 3300031995 | Bacteria | 1381 |
| 186 | Ga0307416_100107729 | 3300032002 | Bacteria | 2446 |
| 187 | Ga0307414_10100577 | 3300032004 | Bacteria | 2175 |
| 188 | Ga0307415_100090730 | 3300032126 | Bacteria | 2211 |
| 189 | Ga0307415_100175085 | 3300032126 | Bacteria | 1677 |
| 190 | Ga0373937_0308713 | 3300036401 | Bacteria | 1496 |
| 191 | Ga0316584_0001763 | 3300036712 | Bacteria | 13306 |
| 192 | Ga0395900_0662116 | 3300037418 | Bacteria | 980 |
| 193 | Ga0436363_1575441 | 3300039450 | Bacteria | 941 |
| 194 | Ga0439436_0001158 | 3300041404 | Bacteria | 7485 |
| 195 | Ga0439439_0009411 | 3300041406 | Bacteria | 2323 |
| 196 | Ga0439466_0087607 | 3300041411 | Bacteria | 978 |
| 197 | Ga0451793_0322922 | 3300041452 | Bacteria | 2276 |
| 198 | Ga0451800_0268066 | 3300041459 | Bacteria | 1382 |
| 199 | Ga0451837_0378338 | 3300041494 | Bacteria | 2490 |
| 200 | Ga0439433_0009447 | 3300041999 | Bacteria | 2124 |
| 201 | Ga0439448_0005040 | 3300042005 | Bacteria | 3752 |
| 202 | Ga0439457_000022 | 3300042014 | Bacteria | 30879 |
| 203 | Ga0439462_0005421 | 3300042015 | Bacteria | 3144 |
| 204 | Ga0439463_008572 | 3300042016 | Bacteria | 2519 |
| 205 | Ga0450914_002868 | 3300042118 | Bacteria | 1274 |
| 206 | Ga0466969_0191549 | 3300044656 | Bacteria | 934 |
| 207 | Ga0466965_0099774 | 3300044683 | Bacteria | 1484 |
| 208 | Ga0466965_0129513 | 3300044683 | Bacteria | 1308 |
| 209 | Ga0466965_0249309 | 3300044683 | Bacteria | 952 |
| 210 | Ga0466966_0032259 | 3300044684 | Bacteria | 3396 |
| 211 | Ga0466961_0045728 | 3300044693 | Bacteria | 2800 |
| 212 | Ga0466961_0054238 | 3300044693 | Bacteria | 2557 |
| 213 | Ga0466961_0126024 | 3300044693 | Bacteria | 1607 |
| 214 | Ga0466963_0014068 | 3300044694 | Bacteria | 4930 |
| 215 | Ga0466963_0118133 | 3300044694 | Bacteria | 1823 |
| 216 | Ga0466963_0299185 | 3300044694 | Bacteria | 1131 |
| 217 | Ga0466971_0040169 | 3300044719 | Bacteria | 2101 |
| 218 | Ga0466970_0020590 | 3300044765 | Bacteria | 3429 |
| 219 | Ga0466970_0103854 | 3300044765 | Bacteria | 1549 |
| 220 | Ga0466970_0166313 | 3300044765 | Bacteria | 1221 |
| 221 | Ga0466960_0008862 | 3300044901 | Bacteria | 4132 |
| 222 | Ga0466960_0022332 | 3300044901 | Bacteria | 2828 |
| 223 | Ga0466960_0030437 | 3300044901 | Bacteria | 2484 |
| 224 | Ga0466960_0127646 | 3300044901 | Bacteria | 1339 |
| 225 | Ga0466959_0084709 | 3300045049 | Bacteria | 2282 |
| 226 | Ga0466959_0204990 | 3300045049 | Bacteria | 1372 |
| 227 | Ga0466959_0279431 | 3300045049 | Bacteria | 1146 |
| 228 | Ga0466958_0038874 | 3300045836 | Bacteria | 2856 |
| 229 | Ga0466958_0089973 | 3300045836 | Bacteria | 1898 |
| 230 | Ga0466958_0098884 | 3300045836 | Bacteria | 1812 |
| 231 | Ga0466958_0165690 | 3300045836 | Bacteria | 1398 |
| 232 | Ga0466967_0040513 | 3300045976 | Bacteria | 4011 |
| 233 | Ga0466967_0085358 | 3300045976 | Bacteria | 2858 |
| 234 | Ga0466967_0218664 | 3300045976 | Bacteria | 1809 |
| 235 | Ga0466967_0233892 | 3300045976 | Bacteria | 1750 |
| 236 | Ga0466967_0806546 | 3300045976 | Bacteria | 932 |
| 237 | Ga0495617_035542 | 3300046452 | Bacteria | 1673 |
| 238 | Ga0495594_0076513 | 3300046499 | Bacteria | 1866 |
| 239 | Ga0495630_0260548 | 3300046517 | Bacteria | 1325 |
| 240 | Ga0495611_0041981 | 3300046648 | Bacteria | 2041 |
| 241 | Ga0495625_0108304 | 3300046660 | Bacteria | 1901 |
| 242 | Ga0495581_0176673 | 3300047315 | Bacteria | 1248 |
| 243 | Ga0495636_0014494 | 3300047318 | Bacteria | 3135 |
| 244 | Ga0495685_007664 | 3300047447 | Bacteria | 3570 |
| 245 | Ga0496100_0085835 | 3300048903 | Bacteria | 2137 |
| 246 | Ga0496100_0313746 | 3300048903 | Bacteria | 1176 |
| 247 | Ga0496101_0041564 | 3300048904 | Bacteria | 3279 |
| 248 | Ga0496102_0012183 | 3300048905 | Bacteria | 7434 |
| 249 | Ga0496102_0050310 | 3300048905 | Bacteria | 3794 |
| 250 | Ga0496102_0105644 | 3300048905 | Bacteria | 2620 |
| 251 | Ga0496102_0641530 | 3300048905 | Bacteria | 985 |
| 252 | Ga0496104_0000511 | 3300048907 | Bacteria | 33274 |
| 253 | Ga0496104_0407297 | 3300048907 | Bacteria | 1272 |
| 254 | Ga0496104_0461120 | 3300048907 | Bacteria | 1182 |
| 255 | Ga0496105_0003246 | 3300048908 | Bacteria | 11988 |
| 256 | Ga0496105_0143789 | 3300048908 | Bacteria | 1962 |
| 257 | Ga0496105_0330956 | 3300048908 | Bacteria | 1219 |
| 258 | Ga0496106_0548262 | 3300048909 | Bacteria | 928 |
| 259 | Ga0496107_0168123 | 3300048910 | Bacteria | 1626 |
| 260 | Ga0496108_0051442 | 3300048911 | Bacteria | 3451 |
| 261 | Ga0496108_0068172 | 3300048911 | Bacteria | 3001 |
| 262 | Ga0496108_0239720 | 3300048911 | Bacteria | 1577 |
| 263 | Ga0496108_0535124 | 3300048911 | Bacteria | 1022 |
| 264 | Ga0496109_0013452 | 3300048912 | Bacteria | 7098 |
| 265 | Ga0496109_0101093 | 3300048912 | Bacteria | 2676 |
| 266 | Ga0496110_0162989 | 3300048913 | Bacteria | 2021 |
| 267 | Ga0496110_0168219 | 3300048913 | Bacteria | 1988 |
| 268 | Ga0496111_0002429 | 3300048914 | Bacteria | 11240 |
| 269 | Ga0496111_0489937 | 3300048914 | Bacteria | 905 |
| 270 | Ga0496111_0609253 | 3300048914 | Bacteria | 799 |
| 271 | Ga0496112_0000637 | 3300048915 | Bacteria | 24324 |
| 272 | Ga0496112_0069559 | 3300048915 | Bacteria | 3477 |
| 273 | Ga0496112_0449939 | 3300048915 | Bacteria | 1226 |
| 274 | Ga0496113_0020485 | 3300048916 | Bacteria | 4650 |
| 275 | Ga0496113_0033703 | 3300048916 | Bacteria | 3731 |
| 276 | Ga0496113_0087536 | 3300048916 | Bacteria | 2395 |
| 277 | Ga0496115_0024076 | 3300048918 | Bacteria | 4730 |
| 278 | Ga0496119_0032543 | 3300048922 | Bacteria | 3473 |
| 279 | Ga0496126_0032512 | 3300048929 | Bacteria | 4914 |
| 280 | Ga0501323_007454 | 3300049539 | Bacteria | 1249 |
| 281 | Ga0501040_0272738 | 3300049576 | Bacteria | 1208 |
| 282 | Ga0501040_0685338 | 3300049576 | Bacteria | 741 |
| 283 | Ga0501041_0188330 | 3300049577 | Bacteria | 1292 |
| 284 | Ga0501042_0074594 | 3300049578 | Bacteria | 2428 |
| 285 | Ga0501042_0396051 | 3300049578 | Bacteria | 1000 |
| 286 | Ga0501046_0374561 | 3300049580 | Bacteria | 1031 |
| 287 | Ga0501067_0013629 | 3300049583 | Bacteria | 4501 |
| 288 | Ga0501067_0189439 | 3300049583 | Bacteria | 1146 |
| 289 | Ga0501068_0018869 | 3300049584 | Bacteria | 3997 |
| 290 | Ga0501069_0107819 | 3300049585 | Bacteria | 1584 |
| 291 | Ga0501070_0041882 | 3300049586 | Bacteria | 3813 |
| 292 | Ga0501072_0317960 | 3300049588 | Bacteria | 1237 |
| 293 | Ga0501035_0027987 | 3300049822 | Bacteria | 5149 |
| 294 | Ga0501045_0180349 | 3300049824 | Bacteria | 1574 |
| 295 | nmdc:mga09592_617172_c1 | 3300050508 | Bacteria | 928 |
| 296 | nmdc:mga0qj67_416571_c1 | 3300050509 | Bacteria | 1083 |
| 297 | nmdc:mga08y16_63974_c1 | 3300050511 | Bacteria | 3842 |
| 298 | nmdc:mga08y16_9086_c1 | 3300050511 | Bacteria | 10434 |
| 299 | nmdc:mga0n895_330047_c1 | 3300050512 | Bacteria | 1546 |
| 300 | nmdc:mga0rr50_152305_c1 | 3300050513 | Bacteria | 1870 |
| 301 | Ga0495655_0037803 | 3300053083 | Bacteria | 1215 |
| 302 | Ga0466962_0030800 | 3300061719 | Bacteria | 2569 |
| 303 | Ga0466962_0146945 | 3300061719 | Bacteria | 1143 |
| 304 | Ga0466962_0172716 | 3300061719 | Bacteria | 1053 |
| 305 | Ga0530510_0108004 | 3300061734 | Bacteria | 2037 |
| 306 | Ga0530510_0108638 | 3300061734 | Bacteria | 2031 |
| 307 | 2515850852 | 2515154155 | Bacteria | 7985436 |
| 308 | 2616899363 | 2616644941 | Bacteria | 8510691 |
| 309 | 2643759243 | 2643221548 | Bacteria | 8053412 |
| 310 | 2643825608 | 2643221561 | Bacteria | 4984412 |
| 311 | 2643897312 | 2643221578 | Bacteria | 9213798 |
| 312 | 2644408457 | 2643221673 | Bacteria | 9196637 |
| 313 | 2644463339 | 2643221682 | Bacteria | 6743283 |
| 314 | 2644531605 | 2643221696 | Bacteria | 5431823 |
| 315 | 2812359658 | 2811994879 | Bacteria | 9313447 |
| 316 | 2819694183 | 2818991463 | Bacteria | 7948711 |
| 317 | 2852638360 | 2852635781 | Bacteria | 8251373 |
| 318 | 2857711737 | 2857710386 | Bacteria | 3186771 |
| 319 | 2867478247 | 2867475112 | Bacteria | 6909112 |
| 320 | 2875393252 | 2875391855 | Bacteria | 7600475 |
| 321 | 2946051437 | 2946045630 | Bacteria | 8527308 |
| 322 | 2946066251 | 2946064051 | Bacteria | 8957905 |
| 323 | 2966603810 | 2966598605 | Bacteria | 7676064 |
| 324 | 2984580594 | 2984576629 | Bacteria | 4248407 |
| 325 | 2990258286 | 2990256926 | Bacteria | 4252839 |
| 326 | 2997458614 | 2997451912 | Bacteria | 8492419 |
| 327 | 3001891675 | 3001889506 | Bacteria | 2975194 |
| 328 | 8054163597 | 8054160619 | Bacteria | 7783213 |
| 329 | nmdc:mga00v17_122112_c1 | |||
| 330 | JGI25160J50197_1008354 | |||
| 331 | Ga0070658_10056506 | |||
| 332 | Ga0070658_10157566 | |||
| 333 | Ga0068869_100007230 | |||
| 334 | Ga0068869_100048888 | |||
| 335 | Ga0070680_100076468 | |||
| 336 | Ga0070680_100388298 | |||
| 337 | Ga0070682_100323656 | |||
| 338 | Ga0070682_100516288 | |||
| 339 | Ga0068868_100044101 | |||
| 340 | Ga0068868_100148642 | |||
| 341 | Ga0070660_100271753 | |||
| 342 | Ga0070691_10242380 | |||
| 343 | Ga0070687_100085421 | |||
| 344 | Ga0070661_100063581 | |||
| 345 | Ga0070692_10012398 | |||
| 346 | Ga0070692_10091343 | |||
| 347 | Ga0070669_100112196 | |||
| 348 | Ga0070675_100063284 | |||
| 349 | Ga0070671_100003386 | |||
| 350 | Ga0070671_100270551 | |||
| 351 | Ga0070688_100145406 | |||
| 352 | Ga0070659_100018870 | |||
| 353 | Ga0070709_10018247 | |||
| 354 | Ga0070714_100173776 | |||
| 355 | Ga0070714_100365921 | |||
| 356 | Ga0070713_100047355 | |||
| 357 | Ga0070711_100017937 | |||
| 358 | Ga0070711_100028693 | |||
| 359 | Ga0070700_100172993 | |||
| 360 | Ga0070663_100015401 | |||
| 361 | Ga0070678_100002907 | |||
| 362 | Ga0070662_100073919 | |||
| 363 | Ga0070681_10071121 | |||
| 364 | Ga0068867_100224300 | |||
| 365 | Ga0070706_100006076 | |||
| 366 | Ga0070706_100353873 | |||
| 367 | Ga0070698_100016157 | |||
| 368 | Ga0070684_100014190 | |||
| 369 | Ga0070684_100317625 | |||
| 370 | Ga0070672_100057900 | |||
| 371 | Ga0070693_100007302 | |||
| 372 | Ga0070665_100708579 | |||
| 373 | Ga0068855_100037676 | |||
| 374 | Ga0070664_100006628 | |||
| 375 | Ga0070664_100196446 | |||
| 376 | Ga0070664_100285349 | |||
| 377 | Ga0068854_100415208 | |||
| 378 | Ga0070702_100001182 | |||
| 379 | Ga0068859_100159755 | |||
| 380 | Ga0068864_100432012 | |||
| 381 | Ga0068864_100520097 | |||
| 382 | Ga0068870_10018076 | |||
| 383 | Ga0068863_100008042 | |||
| 384 | Ga0068858_100018248 | |||
| 385 | Ga0068860_100095938 | |||
| 386 | Ga0068860_100346203 | |||
| 387 | Ga0070717_10018827 | |||
| 388 | Ga0070715_10014221 | |||
| 389 | Ga0068871_100019439 | |||
| 390 | Ga0075428_100360048 | |||
| 391 | Ga0075430_100210266 | |||
| 392 | Ga0075429_100720168 | |||
| 393 | Ga0097620_100159747 | |||
| 394 | Ga0075435_100096723 | |||
| 395 | Ga0105251_10096421 | |||
| 396 | Ga0105240_10126542 | |||
| 397 | Ga0105240_10690952 | |||
| 398 | Ga0111539_10003023 | |||
| 399 | Ga0111539_10385092 | |||
| 400 | Ga0105245_10040561 | |||
| 401 | Ga0105245_10043263 | |||
| 402 | Ga0105247_10020074 | |||
| 403 | Ga0114129_10758228 | |||
| 404 | Ga0105241_10312270 | |||
| 405 | Ga0105248_10018376 | |||
| 406 | Ga0105237_10101314 | |||
| 407 | Ga0105239_10082433 | |||
| 408 | Ga0105246_10121460 | |||
| 409 | Ga0105246_10350550 | |||
| 410 | Ga0157370_10054703 | |||
| 411 | Ga0157374_10501492 | |||
| 412 | Ga0163162_10568659 | |||
| 413 | Ga0157372_10347708 | |||
| 414 | Ga0157372_10562053 | |||
| 415 | Ga0157377_10207107 | |||
| 416 | Ga0157379_10176885 | |||
| 417 | Ga0157376_10836118 | |||
| 418 | Ga0207426_1008554 | |||
| 419 | Ga0207426_1014843 | |||
| 420 | Ga0207713_1047816 | |||
| 421 | Ga0207692_10023441 | |||
| 422 | Ga0207680_10206325 | |||
| 423 | Ga0207685_10002152 | |||
| 424 | Ga0207699_10004496 | |||
| 425 | Ga0207699_10037304 | |||
| 426 | Ga0207645_10132922 | |||
| 427 | Ga0207643_10000094 | |||
| 428 | Ga0207705_10217914 | |||
| 429 | Ga0207684_10142148 | |||
| 430 | Ga0207707_10274372 | |||
| 431 | Ga0207695_10676359 | |||
| 432 | Ga0207693_10074688 | |||
| 433 | Ga0207693_10136345 | |||
| 434 | Ga0207663_10061948 | |||
| 435 | Ga0207663_10395909 | |||
| 436 | Ga0207660_10230255 | |||
| 437 | Ga0207657_10010275 | |||
| 438 | Ga0207649_10032211 | |||
| 439 | Ga0207649_10256299 | |||
| 440 | Ga0207652_10036925 | |||
| 441 | Ga0207681_10030821 | |||
| 442 | Ga0207650_10053288 | |||
| 443 | Ga0207659_10015654 | |||
| 444 | Ga0207700_10053285 | |||
| 445 | Ga0207700_10068783 | |||
| 446 | Ga0207700_10423446 | |||
| 447 | Ga0207664_10028954 | |||
| 448 | Ga0207664_10418559 | |||
| 449 | Ga0207644_10391790 | |||
| 450 | Ga0207644_10438073 | |||
| 451 | Ga0207690_10064938 | |||
| 452 | Ga0207706_10007287 | |||
| 453 | Ga0207706_10534753 | |||
| 454 | Ga0207686_10408347 | |||
| 455 | Ga0207670_10134841 | |||
| 456 | Ga0207704_10368384 | |||
| 457 | Ga0207665_10001973 | |||
| 458 | Ga0207691_10171434 | |||
| 459 | Ga0207711_10216467 | |||
| 460 | Ga0207689_10001041 | |||
| 461 | Ga0207689_10006876 | |||
| 462 | Ga0207661_10041465 | |||
| 463 | Ga0207661_10098725 | |||
| 464 | Ga0207679_10119075 | |||
| 465 | Ga0207679_10295889 | |||
| 466 | Ga0207667_10034211 | |||
| 467 | Ga0207667_10194763 | |||
| 468 | Ga0207712_10163938 | |||
| 469 | Ga0207668_10458756 | |||
| 470 | Ga0207677_10061418 | |||
| 471 | Ga0207677_10108913 | |||
| 472 | Ga0207703_10210130 | |||
| 473 | Ga0207708_10002714 | |||
| 474 | Ga0207708_10030083 | |||
| 475 | Ga0207702_10002824 | |||
| 476 | Ga0207702_10457050 | |||
| 477 | Ga0207641_10010889 | |||
| 478 | Ga0207641_10593221 | |||
| 479 | Ga0207676_10004885 | |||
| 480 | Ga0207676_10342038 | |||
| 481 | Ga0207676_10604338 | |||
| 482 | Ga0207674_10030672 | |||
| 483 | Ga0207674_10066421 | |||
| 484 | Ga0207674_10590440 | |||
| 485 | Ga0207675_100224851 | |||
| 486 | Ga0207683_10004355 | |||
| 487 | Ga0207698_10172092 | |||
| 488 | Ga0207428_10027895 | |||
| 489 | Ga0207428_10092499 | |||
| 490 | Ga0268266_10240056 | |||
| 491 | Ga0268264_10513508 | |||
| 492 | Ga0265340_10015392 | |||
| 493 | Ga0307408_100114609 | |||
| 494 | Ga0265342_10071786 | |||
| 495 | Ga0316576_10004792 | |||
| 496 | Ga0316578_10007148 | |||
| 497 | Ga0307405_10201409 | |||
| 498 | Ga0307413_10021242 | |||
| 499 | Ga0307413_10044388 | |||
| 500 | Ga0307410_10134105 | |||
| 501 | Ga0307410_10305687 | |||
| 502 | Ga0307406_10106489 | |||
| 503 | Ga0307406_10200015 | |||
| 504 | Ga0307407_10065863 | |||
| 505 | Ga0307407_10101293 | |||
| 506 | Ga0307412_10198052 | |||
| 507 | Ga0307409_100006897 | |||
| 508 | Ga0307409_100026791 | |||
| 509 | Ga0307409_100034990 | |||
| 510 | Ga0307409_100168806 | |||
| 511 | Ga0307409_100272845 | |||
| 512 | Ga0307409_100330863 | |||
| 513 | Ga0307409_100356924 | |||
| 514 | Ga0307416_100107729 | |||
| 515 | Ga0307414_10100577 | |||
| 516 | Ga0307415_100090730 | |||
| 517 | Ga0307415_100175085 | |||
| 518 | Ga0373937_0308713 | |||
| 519 | Ga0316584_0001763 | |||
| 520 | Ga0395900_0662116 | |||
| 521 | Ga0436363_1575441 | |||
| 522 | Ga0439436_0001158 | |||
| 523 | Ga0439439_0009411 | |||
| 524 | Ga0439466_0087607 | |||
| 525 | Ga0451793_0322922 | |||
| 526 | Ga0451800_0268066 | |||
| 527 | Ga0451837_0378338 | |||
| 528 | Ga0439433_0009447 | |||
| 529 | Ga0439448_0005040 | |||
| 530 | Ga0439457_000022 | |||
| 531 | Ga0439462_0005421 | |||
| 532 | Ga0439463_008572 | |||
| 533 | Ga0450914_002868 | |||
| 534 | Ga0466969_0191549 | |||
| 535 | Ga0466965_0099774 | |||
| 536 | Ga0466965_0129513 | |||
| 537 | Ga0466965_0249309 | |||
| 538 | Ga0466966_0032259 | |||
| 539 | Ga0466961_0045728 | |||
| 540 | Ga0466961_0054238 | |||
| 541 | Ga0466961_0126024 | |||
| 542 | Ga0466963_0014068 | |||
| 543 | Ga0466963_0118133 | |||
| 544 | Ga0466963_0299185 | |||
| 545 | Ga0466971_0040169 | |||
| 546 | Ga0466970_0020590 | |||
| 547 | Ga0466970_0103854 | |||
| 548 | Ga0466970_0166313 | |||
| 549 | Ga0466960_0008862 | |||
| 550 | Ga0466960_0022332 | |||
| 551 | Ga0466960_0030437 | |||
| 552 | Ga0466960_0127646 | |||
| 553 | Ga0466959_0084709 | |||
| 554 | Ga0466959_0204990 | |||
| 555 | Ga0466959_0279431 | |||
| 556 | Ga0466958_0038874 | |||
| 557 | Ga0466958_0089973 | |||
| 558 | Ga0466958_0098884 | |||
| 559 | Ga0466958_0165690 | |||
| 560 | Ga0466967_0040513 | |||
| 561 | Ga0466967_0085358 | |||
| 562 | Ga0466967_0218664 | |||
| 563 | Ga0466967_0233892 | |||
| 564 | Ga0466967_0806546 | |||
| 565 | Ga0495617_035542 | |||
| 566 | Ga0495594_0076513 | |||
| 567 | Ga0495630_0260548 | |||
| 568 | Ga0495611_0041981 | |||
| 569 | Ga0495625_0108304 | |||
| 570 | Ga0495581_0176673 | |||
| 571 | Ga0495636_0014494 | |||
| 572 | Ga0495685_007664 | |||
| 573 | Ga0496100_0085835 | |||
| 574 | Ga0496100_0313746 | |||
| 575 | Ga0496101_0041564 | |||
| 576 | Ga0496102_0012183 | |||
| 577 | Ga0496102_0050310 | |||
| 578 | Ga0496102_0105644 | |||
| 579 | Ga0496102_0641530 | |||
| 580 | Ga0496104_0000511 | |||
| 581 | Ga0496104_0407297 | |||
| 582 | Ga0496104_0461120 | |||
| 583 | Ga0496105_0003246 | |||
| 584 | Ga0496105_0143789 | |||
| 585 | Ga0496105_0330956 | |||
| 586 | Ga0496106_0548262 | |||
| 587 | Ga0496107_0168123 | |||
| 588 | Ga0496108_0051442 | |||
| 589 | Ga0496108_0068172 | |||
| 590 | Ga0496108_0239720 | |||
| 591 | Ga0496108_0535124 | |||
| 592 | Ga0496109_0013452 | |||
| 593 | Ga0496109_0101093 | |||
| 594 | Ga0496110_0162989 | |||
| 595 | Ga0496110_0168219 | |||
| 596 | Ga0496111_0002429 | |||
| 597 | Ga0496111_0489937 | |||
| 598 | Ga0496111_0609253 | |||
| 599 | Ga0496112_0000637 | |||
| 600 | Ga0496112_0069559 | |||
| 601 | Ga0496112_0449939 | |||
| 602 | Ga0496113_0020485 | |||
| 603 | Ga0496113_0033703 | |||
| 604 | Ga0496113_0087536 | |||
| 605 | Ga0496115_0024076 | |||
| 606 | Ga0496119_0032543 | |||
| 607 | Ga0496126_0032512 | |||
| 608 | Ga0501323_007454 | |||
| 609 | Ga0501040_0272738 | |||
| 610 | Ga0501040_0685338 | |||
| 611 | Ga0501041_0188330 | |||
| 612 | Ga0501042_0074594 | |||
| 613 | Ga0501042_0396051 | |||
| 614 | Ga0501046_0374561 | |||
| 615 | Ga0501067_0013629 | |||
| 616 | Ga0501067_0189439 | |||
| 617 | Ga0501068_0018869 | |||
| 618 | Ga0501069_0107819 | |||
| 619 | Ga0501070_0041882 | |||
| 620 | Ga0501072_0317960 | |||
| 621 | Ga0501035_0027987 | |||
| 622 | Ga0501045_0180349 | |||
| 623 | nmdc:mga09592_617172_c1 | |||
| 624 | nmdc:mga0qj67_416571_c1 | |||
| 625 | nmdc:mga08y16_63974_c1 | |||
| 626 | nmdc:mga08y16_9086_c1 | |||
| 627 | nmdc:mga0n895_330047_c1 | |||
| 628 | nmdc:mga0rr50_152305_c1 | |||
| 629 | Ga0495655_0037803 | |||
| 630 | Ga0466962_0030800 | |||
| 631 | Ga0466962_0146945 | |||
| 632 | Ga0466962_0172716 | |||
| 633 | Ga0530510_0108004 | |||
| 634 | Ga0530510_0108638 | |||
| 635 | 2515850852 | |||
| 636 | 2616899363 | |||
| 637 | 2643759243 | |||
| 638 | 2643825608 | |||
| 639 | 2643897312 | |||
| 640 | 2644408457 | |||
| 641 | 2644463339 | |||
| 642 | 2644531605 | |||
| 643 | 2812359658 | |||
| 644 | 2819694183 | |||
| 645 | 2852638360 | |||
| 646 | 2857711737 | |||
| 647 | 2867478247 | |||
| 648 | 2875393252 | |||
| 649 | 2946051437 | |||
| 650 | 2946066251 | |||
| 651 | 2966603810 | |||
| 652 | 2984580594 | |||
| 653 | 2990258286 | |||
| 654 | 2997458614 | |||
| 655 | 3001891675 | |||
| 656 | 8054163597 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4u28-assembly1.cif.gz_A | crystal structure of apo phosphoribosyl isomerase a from streptomyces sviceus atcc 29083 | 0.9895 | 3 | 240 |
| 4w9t-assembly1.cif.gz_A | crystal structure of hisap from streptomyces sp. mg1 | 0.9883 | 3 | 240 |
| 2vep-assembly1.cif.gz_A | crystal structure of the full length bifunctional enzyme pria | 0.9811 | 1 | 240 |
| 4x2r-assembly1.cif.gz_A | crystal structure of pria from actinomyces urogenitalis | 0.9805 | 3 | 239 |
| 4x9s-assembly1.cif.gz_A | crystal structure of hisap from streptomyces sp. mg1 | 0.9792 | 1 | 239 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4x2rA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9806 | 3 | 239 | 3.20.20.70 |
| 4x2rA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9445 | 3 | 239 | 3.20.20.70 |
| af_Q58927_1_237_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9292 | 4 | 239 | 3.20.20.70 |
| af_P10371_1_245_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9242 | 6 | 238 | 3.20.20.70 |
| af_Q58927_1_237_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.918 | 4 | 239 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1Q3J5-F1-model_v4 | Bifunctional 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase/phosphoribosylanthranilate isomerase PriA (EC 5.3.1.16, EC 5.3.1.24) | 1.002 | 166 | 239 |
GO:0000105
GO:0000162 GO:0003949 GO:0004640 GO:0005737 |
| AF-A0A655IQI9-F1-model_v4 | Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase HISA (EC 5.3.1.16) | 1.001 | 152 | 240 |
GO:0000105
GO:0000162 GO:0003949 GO:0005737 |
| AF-A0A1N0CFR1-F1-model_v4 | deleted | 0.9953 | 165 | 240 |
|
| AF-A0A3C0UAN0-F1-model_v4 | Bifunctional 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase/phosphoribosylanthranilate isomerase PriA (EC 5.3.1.16, EC 5.3.1.24) | 0.9953 | 160 | 240 |
GO:0000105
GO:0000162 GO:0003949 GO:0004640 GO:0005737 |
| AF-A0A3C0ATR8-F1-model_v4 | Bifunctional 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase/phosphoribosylanthranilate isomerase PriA (EC 5.3.1.16, EC 5.3.1.24) | 0.9921 | 4 | 101 |
GO:0000105
GO:0000162 GO:0003949 GO:0004640 GO:0005737 |