F409310

General Info

Members Datasets Scaffolds Average Seq Length
328 142 656 124

Family's Representative Sequence

Representative Sequence 3300034820|Ga0373959_0107871|Ga0373959_0107871_205_639
Length 144
Sequence MDVRACASPTRGHRVRTGRPARVSSVRLCSFDIDGTLEIGDPPGIITIDAVRAARRLGYLVGTCSDRPLAHQRQLWQQRLDLNPDFTVLKHRLAEVKAAFTAVAYYHIGDTDVDEHYAGLAGFRFLRADAASFRAWGPELFGPE

Samples

Sample ID Description Type Environment
1 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
69 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
71 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
72 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
73 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
74 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
75 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
76 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
77 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
78 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
79 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
80 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
81 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
86 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
87 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
88 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
89 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
90 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
91 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
92 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
93 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
94 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
95 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
96 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
97 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
98 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
99 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
100 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
101 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
102 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
103 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
117 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
118 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
119 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
120 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
121 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
122 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
123 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
124 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
125 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
126 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
127 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
128 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
129 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
133 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
134 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
135 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
136 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
137 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
138 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
141 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
142 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.91
Rhizosphere 99.09
Stem 0
Stem Tuber 0
Unclassified 7.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373959_0107871 3300034820 Bacteria 669
2 Ga0065707_10693456 3300005295 Bacteria 643
3 Ga0070676_10769503 3300005328 Bacteria 708
4 Ga0070670_101408761 3300005331 Unclassified 639
5 Ga0070680_100013551 3300005336 Bacteria 6353
6 Ga0070692_10402823 3300005345 Bacteria 864
7 Ga0070668_101254937 3300005347 Bacteria 673
8 Ga0070669_100452368 3300005353 Bacteria 1058
9 Ga0070674_100257235 3300005356 Bacteria 1374
10 Ga0070701_10787329 3300005438 Bacteria 647
11 Ga0070705_100003742 3300005440 Bacteria 7448
12 Ga0070700_101448900 3300005441 Bacteria 582
13 Ga0070694_100453369 3300005444 Bacteria 1013
14 Ga0070694_100776118 3300005444 Bacteria 784
15 Ga0070708_100004213 3300005445 Bacteria 11300
16 Ga0070708_100024949 3300005445 Bacteria 5109
17 Ga0070708_100075005 3300005445 Bacteria 3052
18 Ga0070708_100181976 3300005445 Bacteria 1965
19 Ga0070708_100423376 3300005445 Bacteria 1256
20 Ga0070708_101167178 3300005445 Unclassified 721
21 Ga0068867_101557227 3300005459 Unclassified 617
22 Ga0070706_100153147 3300005467 Bacteria 2152
23 Ga0070706_100454806 3300005467 Bacteria 1191
24 Ga0070706_100514407 3300005467 Bacteria 1113
25 Ga0070707_100017451 3300005468 Bacteria 6748
26 Ga0070707_100022799 3300005468 Bacteria 5920
27 Ga0070707_100031511 3300005468 Bacteria 5051
28 Ga0070707_100051675 3300005468 Bacteria 3940
29 Ga0070707_100099699 3300005468 Bacteria 2814
30 Ga0070707_100492568 3300005468 Bacteria 1187
31 Ga0070698_100052760 3300005471 Bacteria 4135
32 Ga0070698_100054614 3300005471 Bacteria 4054
33 Ga0070698_100071077 3300005471 Bacteria 3491
34 Ga0070698_100074810 3300005471 Bacteria 3392
35 Ga0070699_100079577 3300005518 Bacteria 2855
36 Ga0070699_100116773 3300005518 Bacteria 2345
37 Ga0070699_100128194 3300005518 Unclassified 2235
38 Ga0070699_100148932 3300005518 Bacteria 2069
39 Ga0070699_100900000 3300005518 Bacteria 811
40 Ga0070679_100162904 3300005530 Bacteria 2204
41 Ga0070697_100014263 3300005536 Bacteria 6245
42 Ga0070697_100028886 3300005536 Bacteria 4444
43 Ga0070697_100387341 3300005536 Bacteria 1211
44 Ga0070697_101178182 3300005536 Bacteria 683
45 Ga0070672_100006026 3300005543 Bacteria 8101
46 Ga0070696_101309205 3300005546 Bacteria 615
47 Ga0070696_101795025 3300005546 Bacteria 530
48 Ga0070704_100096652 3300005549 Bacteria 2215
49 Ga0070704_100267478 3300005549 Bacteria 1411
50 Ga0070704_101486213 3300005549 Bacteria 623
51 Ga0068861_100400438 3300005719 Bacteria 1218
52 Ga0068863_100199391 3300005841 Bacteria 1925
53 Ga0068863_102265887 3300005841 Bacteria 553
54 Ga0068860_100271328 3300005843 Bacteria 1656
55 Ga0068860_100871123 3300005843 Bacteria 916
56 Ga0068860_101910994 3300005843 Bacteria 615
57 Ga0068860_102304016 3300005843 Bacteria 559
58 Ga0068862_100179957 3300005844 Bacteria 1897
59 Ga0081455_10019369 3300005937 Bacteria 6440
60 Ga0081540_1116860 3300005983 Bacteria 1115
61 Ga0081539_10000044 3300005985 Bacteria 284021
62 Ga0075428_100000562 3300006844 Bacteria 38031
63 Ga0075428_100008998 3300006844 Bacteria 11077
64 Ga0075428_100017418 3300006844 Bacteria 7941
65 Ga0075428_100067167 3300006844 Bacteria 3926
66 Ga0075428_100576420 3300006844 Bacteria 1202
67 Ga0075428_101884630 3300006844 Unclassified 621
68 Ga0075428_101890627 3300006844 Bacteria 620
69 Ga0075430_100000748 3300006846 Bacteria 24972
70 Ga0075430_100005931 3300006846 Bacteria 10320
71 Ga0075430_100308354 3300006846 Bacteria 1309
72 Ga0075430_100390227 3300006846 Bacteria 1149
73 Ga0075430_100828060 3300006846 Unclassified 763
74 Ga0075431_100000785 3300006847 Bacteria 27685
75 Ga0075431_100004218 3300006847 Bacteria 14078
76 Ga0075431_100004967 3300006847 Bacteria 13088
77 Ga0075431_100046147 3300006847 Bacteria 4492
78 Ga0075431_100159403 3300006847 Bacteria 2321
79 Ga0075431_100492884 3300006847 Bacteria 1217
80 Ga0075431_100768387 3300006847 Bacteria 938
81 Ga0075431_101031587 3300006847 Bacteria 789
82 Ga0075431_101223849 3300006847 Bacteria 713
83 Ga0075433_10003182 3300006852 Bacteria 12652
84 Ga0075433_10019347 3300006852 Bacteria 5672
85 Ga0075433_10019507 3300006852 Bacteria 5652
86 Ga0075433_10068791 3300006852 Plasmid 3109
87 Ga0075434_100018558 3300006871 Bacteria 6721
88 Ga0075434_100181082 3300006871 Bacteria 2127
89 Ga0075434_100400783 3300006871 Bacteria 1393
90 Ga0075434_100566012 3300006871 Unclassified 1156
91 Ga0075434_100812337 3300006871 Bacteria 951
92 Ga0075429_100001416 3300006880 Bacteria 19655
93 Ga0075429_100006268 3300006880 Bacteria 10292
94 Ga0075429_100024234 3300006880 Bacteria 5264
95 Ga0075429_100130134 3300006880 Bacteria 2201
96 Ga0075429_100184726 3300006880 Bacteria 1827
97 Ga0075429_100269570 3300006880 Bacteria 1491
98 Ga0075429_100877800 3300006880 Bacteria 785
99 Ga0075429_101207351 3300006880 Bacteria 660
100 Ga0075429_101274465 3300006880 Unclassified 641
101 Ga0075435_100089237 3300007076 Bacteria 2542
102 Ga0075435_100137222 3300007076 Bacteria 2050
103 Ga0075435_100300021 3300007076 Bacteria 1374
104 Ga0075435_100317338 3300007076 Bacteria 1334
105 Ga0099794_10513574 3300007265 Bacteria 631
106 Ga0111539_10010131 3300009094 Bacteria 11877
107 Ga0111539_10347781 3300009094 Unclassified 1725
108 Ga0111539_10621046 3300009094 Bacteria 1258
109 Ga0114129_10042841 3300009147 Bacteria 6370
110 Ga0114129_10048354 3300009147 Bacteria 5976
111 Ga0114129_10054731 3300009147 Bacteria 5593
112 Ga0114129_10090809 3300009147 Bacteria 4233
113 Ga0114129_10099646 3300009147 Bacteria 4021
114 Ga0114129_10174169 3300009147 Bacteria 2931
115 Ga0114129_10310542 3300009147 Bacteria 2099
116 Ga0114129_10555852 3300009147 Bacteria 1492
117 Ga0114129_11467738 3300009147 Bacteria 839
118 Ga0105243_10406238 3300009148 Bacteria 1266
119 Ga0105243_10896784 3300009148 Unclassified 882
120 Ga0105241_10073324 3300009174 Bacteria 2663
121 Ga0105242_10600753 3300009176 Bacteria 1063
122 Ga0105249_10146542 3300009553 Bacteria 2269
123 Ga0105239_11965864 3300010375 Bacteria 679
124 Ga0157373_10917337 3300013100 Unclassified 650
125 Ga0157378_10292864 3300013297 Bacteria 1573
126 Ga0157378_10500529 3300013297 Bacteria 1214
127 Ga0163162_10036902 3300013306 Bacteria 4875
128 Ga0157375_10191245 3300013308 Bacteria 2201
129 Ga0157380_11172466 3300014326 Bacteria 811
130 Ga0157379_10567877 3300014968 Bacteria 1057
131 Ga0163161_10087308 3300017792 Bacteria 2304
132 Ga0207684_10000746 3300025910 Bacteria 37987
133 Ga0207684_10034988 3300025910 Bacteria 4265
134 Ga0207654_10240230 3300025911 Bacteria 1210
135 Ga0207660_10086803 3300025917 Bacteria 2311
136 Ga0207652_10596657 3300025921 Bacteria 991
137 Ga0207646_10010613 3300025922 Bacteria 8972
138 Ga0207646_10014237 3300025922 Bacteria 7561
139 Ga0207646_10025982 3300025922 Bacteria 5352
140 Ga0207646_10034933 3300025922 Bacteria 4544
141 Ga0207646_10068397 3300025922 Bacteria 3172
142 Ga0207646_10194310 3300025922 Bacteria 1833
143 Ga0207681_10051706 3300025923 Bacteria 2784
144 Ga0207706_10078235 3300025933 Bacteria 2908
145 Ga0207669_10259896 3300025937 Bacteria 1298
146 Ga0207691_10008541 3300025940 Bacteria 9833
147 Ga0207712_10227846 3300025961 Bacteria 1494
148 Ga0207668_10836859 3300025972 Bacteria 816
149 Ga0207658_11323718 3300025986 Unclassified 659
150 Ga0207641_10276450 3300026088 Bacteria 1578
151 Ga0207641_10685476 3300026088 Bacteria 1008
152 Ga0207641_12426629 3300026088 Bacteria 523
153 Ga0207675_100196750 3300026118 Bacteria 1935
154 Ga0207675_102122766 3300026118 Bacteria 578
155 Ga0207428_10001927 3300027907 Bacteria 21011
156 Ga0207428_11096764 3300027907 Unclassified 556
157 Ga0268264_10074629 3300028381 Bacteria 2881
158 Ga0268264_11352557 3300028381 Bacteria 722
159 Ga0307408_100200083 3300031548 Bacteria 1616
160 Ga0307405_10057556 3300031731 Bacteria 2443
161 Ga0307406_11356096 3300031901 Bacteria 622
162 Ga0307409_100259386 3300031995 Bacteria 1594
163 Ga0307409_100481985 3300031995 Unclassified 1204
164 Ga0307411_10237708 3300032005 Bacteria 1424
165 Ga0307411_10282714 3300032005 Bacteria 1321
166 Ga0373948_0086431 3300034817 Bacteria 722
167 Ga0373940_0252251 3300035088 Unclassified 595
168 Ga0373932_0012506 3300035112 Bacteria 2091
169 Ga0373941_0030299 3300035115 Bacteria 1603
170 Ga0373962_0037015 3300035242 Bacteria 1361
171 Ga0373962_0129595 3300035242 Bacteria 811
172 Ga0373931_0001179 3300035691 Bacteria 11158
173 Ga0373931_1006476 3300035691 Unclassified 564
174 Ga0395899_0117561 3300037312 Bacteria 1907
175 Ga0395900_0001078 3300037418 Bacteria 34710
176 Ga0395900_0408428 3300037418 Bacteria 1321
177 Ga0395898_0006969 3300037466 Bacteria 12016
178 Ga0395901_0001907 3300038443 Bacteria 21506
179 Ga0439464_0307938 3300042439 Bacteria 518
180 Ga0439460_0149676 3300042461 Bacteria 778
181 Ga0451577_1375202 3300042876 Bacteria 626
182 Ga0451577_1898253 3300042876 Bacteria 522
183 Ga0451577_1946727 3300042876 Bacteria 514
184 Ga0439440_0178015 3300042993 Unclassified 622
185 Ga0453683_0491897 3300044673 Bacteria 796
186 Ga0453684_2480685 3300044712 Bacteria 512
187 Ga0451576_0478065 3300045051 Bacteria 1308
188 Ga0495603_0217187 3300046455 Bacteria 1103
189 Ga0495603_0727448 3300046455 Bacteria 567
190 Ga0495580_0001661 3300046472 Bacteria 19559
191 Ga0495642_0109205 3300046528 Bacteria 1182
192 Ga0495642_0299150 3300046528 Unclassified 705
193 Ga0495656_0095791 3300046615 Bacteria 1365
194 Ga0495656_0096422 3300046615 Unclassified 1361
195 Ga0495659_0514797 3300046664 Bacteria 525
196 Ga0495669_0294678 3300046684 Bacteria 781
197 Ga0495670_0219695 3300046691 Bacteria 1009
198 Ga0496102_0009461 3300048905 Bacteria 8376
199 Ga0496103_0384797 3300048906 Bacteria 901
200 Ga0496106_0450021 3300048909 Bacteria 1034
201 Ga0501291_085464 3300049514 Unclassified 635
202 Ga0501031_0167802 3300049568 Bacteria 1434
203 Ga0501031_0503146 3300049568 Bacteria 781
204 Ga0501032_0514115 3300049569 Bacteria 765
205 Ga0501032_0782210 3300049569 Bacteria 603
206 Ga0501033_0090414 3300049570 Bacteria 2240
207 Ga0501036_0076147 3300049572 Bacteria 2838
208 Ga0501036_0148044 3300049572 Bacteria 1981
209 Ga0501036_0289211 3300049572 Bacteria 1371
210 Ga0501036_0360458 3300049572 Bacteria 1214
211 Ga0501037_0104894 3300049573 Bacteria 2038
212 Ga0501038_0140390 3300049574 Bacteria 1977
213 Ga0501039_0184805 3300049575 Bacteria 1639
214 Ga0501040_0005228 3300049576 Bacteria 8389
215 Ga0501040_0018860 3300049576 Bacteria 4584
216 Ga0501040_0131943 3300049576 Bacteria 1757
217 Ga0501041_0023175 3300049577 Bacteria 3723
218 Ga0501041_0091837 3300049577 Bacteria 1874
219 Ga0501041_0201621 3300049577 Bacteria 1247
220 Ga0501042_0006612 3300049578 Bacteria 7544
221 Ga0501042_0017572 3300049578 Bacteria 4935
222 Ga0501042_0132824 3300049578 Bacteria 1794
223 Ga0501042_0709398 3300049578 Bacteria 731
224 Ga0501043_0233545 3300049579 Bacteria 1420
225 Ga0501046_0328004 3300049580 Bacteria 1114
226 Ga0501046_0331521 3300049580 Bacteria 1107
227 Ga0501046_0455331 3300049580 Bacteria 920
228 Ga0501048_0307483 3300049582 Bacteria 1128
229 Ga0501068_0009088 3300049584 Bacteria 5547
230 Ga0501068_0038083 3300049584 Bacteria 2880
231 Ga0501068_0391742 3300049584 Bacteria 895
232 Ga0501069_0012424 3300049585 Bacteria 4526
233 Ga0501069_0268603 3300049585 Bacteria 997
234 Ga0501069_0535627 3300049585 Bacteria 700
235 Ga0501069_0732775 3300049585 Bacteria 597
236 Ga0501070_0599571 3300049586 Bacteria 878
237 Ga0501070_0758440 3300049586 Bacteria 764
238 Ga0501071_0045741 3300049587 Bacteria 3142
239 Ga0501071_0070238 3300049587 Bacteria 2551
240 Ga0501071_0083872 3300049587 Bacteria 2335
241 Ga0501071_0343881 3300049587 Bacteria 1135
242 Ga0501072_0012526 3300049588 Bacteria 6484
243 Ga0501072_0037526 3300049588 Bacteria 3800
244 Ga0501072_0138392 3300049588 Bacteria 1941
245 Ga0501072_0218283 3300049588 Bacteria 1520
246 Ga0501074_0045439 3300049590 Bacteria 3178
247 Ga0501074_0372807 3300049590 Bacteria 1012
248 Ga0501074_0701596 3300049590 Bacteria 714
249 Ga0501075_0000955 3300049591 Bacteria 18410
250 Ga0501075_0007117 3300049591 Bacteria 7738
251 Ga0501075_0013759 3300049591 Bacteria 5783
252 Ga0501075_0372237 3300049591 Bacteria 1089
253 Ga0501075_0377687 3300049591 Bacteria 1080
254 Ga0501076_0003931 3300049592 Bacteria 10484
255 Ga0501076_0054580 3300049592 Bacteria 3167
256 Ga0501076_0101938 3300049592 Bacteria 2314
257 Ga0501076_0222779 3300049592 Bacteria 1541
258 Ga0501076_0245666 3300049592 Bacteria 1464
259 Ga0501077_0004204 3300049593 Bacteria 8696
260 Ga0501077_0022612 3300049593 Bacteria 3983
261 Ga0501079_0001824 3300049741 Bacteria 15243
262 Ga0501079_0004258 3300049741 Bacteria 10615
263 Ga0501079_1165075 3300049741 Bacteria 607
264 Ga0501080_0082546 3300049742 Bacteria 2985
265 Ga0501080_0356996 3300049742 Bacteria 1319
266 Ga0501080_0940143 3300049742 Bacteria 752
267 Ga0501081_0009091 3300049743 Bacteria 6464
268 Ga0501081_0015502 3300049743 Bacteria 5030
269 Ga0501081_0055538 3300049743 Bacteria 2736
270 Ga0501081_0182104 3300049743 Bacteria 1520
271 Ga0501083_0077111 3300049744 Bacteria 2212
272 Ga0501035_0097691 3300049822 Bacteria 2579
273 Ga0501045_0069796 3300049824 Bacteria 2584
274 Ga0501045_0088352 3300049824 Bacteria 2289
275 Ga0501045_0964928 3300049824 Bacteria 625
276 nmdc:mga05p37_1512286_c1 3300050507 Bacteria 668
277 nmdc:mga05p37_1800155_c1 3300050507 Unclassified 591
278 nmdc:mga05p37_5003_c1 3300050507 Bacteria 15536
279 nmdc:mga05p37_516916_c1 3300050507 Bacteria 1367
280 nmdc:mga05p37_611082_c1 3300050507 Bacteria 1229
281 nmdc:mga05p37_78551_c1 3300050507 Bacteria 4064
282 nmdc:mga05p37_97483_c1 3300050507 Bacteria 3622
283 nmdc:mga09592_129226_c1 3300050508 Bacteria 2173
284 nmdc:mga09592_165750_c1 3300050508 Bacteria 1910
285 nmdc:mga09592_22385_c1 3300050508 Bacteria 5215
286 nmdc:mga09592_266245_c1 3300050508 Bacteria 1486
287 nmdc:mga09592_458_c1 3300050508 Bacteria 30397
288 nmdc:mga09592_793633_c1 3300050508 Bacteria 801
289 nmdc:mga0qj67_10504_c1 3300050509 Bacteria 6916
290 nmdc:mga0qj67_116081_c1 3300050509 Bacteria 2163
291 nmdc:mga0qj67_3168_c1 3300050509 Bacteria 11850
292 nmdc:mga06r32_1113303_c1 3300050510 Unclassified 738
293 nmdc:mga06r32_191064_c1 3300050510 Bacteria 2035
294 nmdc:mga06r32_267742_c1 3300050510 Bacteria 1696
295 nmdc:mga06r32_3147_c1 3300050510 Bacteria 14789
296 nmdc:mga06r32_36885_c1 3300050510 Bacteria 4623
297 nmdc:mga06r32_4805_c1 3300050510 Bacteria 12157
298 nmdc:mga06r32_6987_c1 3300050510 Bacteria 10158
299 nmdc:mga06r32_937432_c1 3300050510 Bacteria 821
300 nmdc:mga08y16_25223_c1 3300050511 Bacteria 6269
301 nmdc:mga08y16_290645_c1 3300050511 Unclassified 1260
302 nmdc:mga08y16_314708_c1 3300050511 Bacteria 1612
303 nmdc:mga0n895_114986_c1 3300050512 Bacteria 2708
304 nmdc:mga0n895_1152481_c1 3300050512 Bacteria 751
305 nmdc:mga0n895_14003_c1 3300050512 Bacteria 7265
306 nmdc:mga0n895_29314_c1 3300050512 Bacteria 5248
307 nmdc:mga0n895_375415_c1 3300050512 Bacteria 1439
308 nmdc:mga0n895_608624_c1 3300050512 Unclassified 1094
309 nmdc:mga0rr50_159303_c1 3300050513 Bacteria 1831
310 nmdc:mga0rr50_449262_c1 3300050513 Bacteria 1093
311 nmdc:mga0rr50_579062_c1 3300050513 Bacteria 956
312 nmdc:mga0rr50_697247_c1 3300050513 Bacteria 867
313 nmdc:mga08x19_356211_c1 3300050514 Bacteria 1022
314 nmdc:mga0a205_26492_c1 3300050515 Bacteria 5530
315 nmdc:mga0a205_32736_c1 3300050515 Bacteria 4983
316 nmdc:mga0a205_343769_c1 3300050515 Bacteria 1360
317 nmdc:mga0a205_693_c1 3300050515 Bacteria 26987
318 Ga0501084_0016301 3300054114 Bacteria 6170
319 Ga0501084_0021785 3300054114 Bacteria 5344
320 Ga0501084_0257455 3300054114 Bacteria 1473
321 Ga0501082_0001716 3300060353 Bacteria 19332
322 Ga0501082_0046759 3300060353 Bacteria 3729
323 Ga0501082_0434886 3300060353 Bacteria 1146
324 Ga0501082_0749500 3300060353 Bacteria 855
325 Ga0530510_0026588 3300061734 Bacteria 4143
326 Ga0530510_0094723 3300061734 Bacteria 2181
327 Ga0530510_0582631 3300061734 Bacteria 850
328 Ga0530510_1084427 3300061734 Bacteria 613
329 Ga0373959_0107871
330 Ga0065707_10693456
331 Ga0070676_10769503
332 Ga0070670_101408761
333 Ga0070680_100013551
334 Ga0070692_10402823
335 Ga0070668_101254937
336 Ga0070669_100452368
337 Ga0070674_100257235
338 Ga0070701_10787329
339 Ga0070705_100003742
340 Ga0070700_101448900
341 Ga0070694_100453369
342 Ga0070694_100776118
343 Ga0070708_100004213
344 Ga0070708_100024949
345 Ga0070708_100075005
346 Ga0070708_100181976
347 Ga0070708_100423376
348 Ga0070708_101167178
349 Ga0068867_101557227
350 Ga0070706_100153147
351 Ga0070706_100454806
352 Ga0070706_100514407
353 Ga0070707_100017451
354 Ga0070707_100022799
355 Ga0070707_100031511
356 Ga0070707_100051675
357 Ga0070707_100099699
358 Ga0070707_100492568
359 Ga0070698_100052760
360 Ga0070698_100054614
361 Ga0070698_100071077
362 Ga0070698_100074810
363 Ga0070699_100079577
364 Ga0070699_100116773
365 Ga0070699_100128194
366 Ga0070699_100148932
367 Ga0070699_100900000
368 Ga0070679_100162904
369 Ga0070697_100014263
370 Ga0070697_100028886
371 Ga0070697_100387341
372 Ga0070697_101178182
373 Ga0070672_100006026
374 Ga0070696_101309205
375 Ga0070696_101795025
376 Ga0070704_100096652
377 Ga0070704_100267478
378 Ga0070704_101486213
379 Ga0068861_100400438
380 Ga0068863_100199391
381 Ga0068863_102265887
382 Ga0068860_100271328
383 Ga0068860_100871123
384 Ga0068860_101910994
385 Ga0068860_102304016
386 Ga0068862_100179957
387 Ga0081455_10019369
388 Ga0081540_1116860
389 Ga0081539_10000044
390 Ga0075428_100000562
391 Ga0075428_100008998
392 Ga0075428_100017418
393 Ga0075428_100067167
394 Ga0075428_100576420
395 Ga0075428_101884630
396 Ga0075428_101890627
397 Ga0075430_100000748
398 Ga0075430_100005931
399 Ga0075430_100308354
400 Ga0075430_100390227
401 Ga0075430_100828060
402 Ga0075431_100000785
403 Ga0075431_100004218
404 Ga0075431_100004967
405 Ga0075431_100046147
406 Ga0075431_100159403
407 Ga0075431_100492884
408 Ga0075431_100768387
409 Ga0075431_101031587
410 Ga0075431_101223849
411 Ga0075433_10003182
412 Ga0075433_10019347
413 Ga0075433_10019507
414 Ga0075433_10068791
415 Ga0075434_100018558
416 Ga0075434_100181082
417 Ga0075434_100400783
418 Ga0075434_100566012
419 Ga0075434_100812337
420 Ga0075429_100001416
421 Ga0075429_100006268
422 Ga0075429_100024234
423 Ga0075429_100130134
424 Ga0075429_100184726
425 Ga0075429_100269570
426 Ga0075429_100877800
427 Ga0075429_101207351
428 Ga0075429_101274465
429 Ga0075435_100089237
430 Ga0075435_100137222
431 Ga0075435_100300021
432 Ga0075435_100317338
433 Ga0099794_10513574
434 Ga0111539_10010131
435 Ga0111539_10347781
436 Ga0111539_10621046
437 Ga0114129_10042841
438 Ga0114129_10048354
439 Ga0114129_10054731
440 Ga0114129_10090809
441 Ga0114129_10099646
442 Ga0114129_10174169
443 Ga0114129_10310542
444 Ga0114129_10555852
445 Ga0114129_11467738
446 Ga0105243_10406238
447 Ga0105243_10896784
448 Ga0105241_10073324
449 Ga0105242_10600753
450 Ga0105249_10146542
451 Ga0105239_11965864
452 Ga0157373_10917337
453 Ga0157378_10292864
454 Ga0157378_10500529
455 Ga0163162_10036902
456 Ga0157375_10191245
457 Ga0157380_11172466
458 Ga0157379_10567877
459 Ga0163161_10087308
460 Ga0207684_10000746
461 Ga0207684_10034988
462 Ga0207654_10240230
463 Ga0207660_10086803
464 Ga0207652_10596657
465 Ga0207646_10010613
466 Ga0207646_10014237
467 Ga0207646_10025982
468 Ga0207646_10034933
469 Ga0207646_10068397
470 Ga0207646_10194310
471 Ga0207681_10051706
472 Ga0207706_10078235
473 Ga0207669_10259896
474 Ga0207691_10008541
475 Ga0207712_10227846
476 Ga0207668_10836859
477 Ga0207658_11323718
478 Ga0207641_10276450
479 Ga0207641_10685476
480 Ga0207641_12426629
481 Ga0207675_100196750
482 Ga0207675_102122766
483 Ga0207428_10001927
484 Ga0207428_11096764
485 Ga0268264_10074629
486 Ga0268264_11352557
487 Ga0307408_100200083
488 Ga0307405_10057556
489 Ga0307406_11356096
490 Ga0307409_100259386
491 Ga0307409_100481985
492 Ga0307411_10237708
493 Ga0307411_10282714
494 Ga0373948_0086431
495 Ga0373940_0252251
496 Ga0373932_0012506
497 Ga0373941_0030299
498 Ga0373962_0037015
499 Ga0373962_0129595
500 Ga0373931_0001179
501 Ga0373931_1006476
502 Ga0395899_0117561
503 Ga0395900_0001078
504 Ga0395900_0408428
505 Ga0395898_0006969
506 Ga0395901_0001907
507 Ga0439464_0307938
508 Ga0439460_0149676
509 Ga0451577_1375202
510 Ga0451577_1898253
511 Ga0451577_1946727
512 Ga0439440_0178015
513 Ga0453683_0491897
514 Ga0453684_2480685
515 Ga0451576_0478065
516 Ga0495603_0217187
517 Ga0495603_0727448
518 Ga0495580_0001661
519 Ga0495642_0109205
520 Ga0495642_0299150
521 Ga0495656_0095791
522 Ga0495656_0096422
523 Ga0495659_0514797
524 Ga0495669_0294678
525 Ga0495670_0219695
526 Ga0496102_0009461
527 Ga0496103_0384797
528 Ga0496106_0450021
529 Ga0501291_085464
530 Ga0501031_0167802
531 Ga0501031_0503146
532 Ga0501032_0514115
533 Ga0501032_0782210
534 Ga0501033_0090414
535 Ga0501036_0076147
536 Ga0501036_0148044
537 Ga0501036_0289211
538 Ga0501036_0360458
539 Ga0501037_0104894
540 Ga0501038_0140390
541 Ga0501039_0184805
542 Ga0501040_0005228
543 Ga0501040_0018860
544 Ga0501040_0131943
545 Ga0501041_0023175
546 Ga0501041_0091837
547 Ga0501041_0201621
548 Ga0501042_0006612
549 Ga0501042_0017572
550 Ga0501042_0132824
551 Ga0501042_0709398
552 Ga0501043_0233545
553 Ga0501046_0328004
554 Ga0501046_0331521
555 Ga0501046_0455331
556 Ga0501048_0307483
557 Ga0501068_0009088
558 Ga0501068_0038083
559 Ga0501068_0391742
560 Ga0501069_0012424
561 Ga0501069_0268603
562 Ga0501069_0535627
563 Ga0501069_0732775
564 Ga0501070_0599571
565 Ga0501070_0758440
566 Ga0501071_0045741
567 Ga0501071_0070238
568 Ga0501071_0083872
569 Ga0501071_0343881
570 Ga0501072_0012526
571 Ga0501072_0037526
572 Ga0501072_0138392
573 Ga0501072_0218283
574 Ga0501074_0045439
575 Ga0501074_0372807
576 Ga0501074_0701596
577 Ga0501075_0000955
578 Ga0501075_0007117
579 Ga0501075_0013759
580 Ga0501075_0372237
581 Ga0501075_0377687
582 Ga0501076_0003931
583 Ga0501076_0054580
584 Ga0501076_0101938
585 Ga0501076_0222779
586 Ga0501076_0245666
587 Ga0501077_0004204
588 Ga0501077_0022612
589 Ga0501079_0001824
590 Ga0501079_0004258
591 Ga0501079_1165075
592 Ga0501080_0082546
593 Ga0501080_0356996
594 Ga0501080_0940143
595 Ga0501081_0009091
596 Ga0501081_0015502
597 Ga0501081_0055538
598 Ga0501081_0182104
599 Ga0501083_0077111
600 Ga0501035_0097691
601 Ga0501045_0069796
602 Ga0501045_0088352
603 Ga0501045_0964928
604 nmdc:mga05p37_1512286_c1
605 nmdc:mga05p37_1800155_c1
606 nmdc:mga05p37_5003_c1
607 nmdc:mga05p37_516916_c1
608 nmdc:mga05p37_611082_c1
609 nmdc:mga05p37_78551_c1
610 nmdc:mga05p37_97483_c1
611 nmdc:mga09592_129226_c1
612 nmdc:mga09592_165750_c1
613 nmdc:mga09592_22385_c1
614 nmdc:mga09592_266245_c1
615 nmdc:mga09592_458_c1
616 nmdc:mga09592_793633_c1
617 nmdc:mga0qj67_10504_c1
618 nmdc:mga0qj67_116081_c1
619 nmdc:mga0qj67_3168_c1
620 nmdc:mga06r32_1113303_c1
621 nmdc:mga06r32_191064_c1
622 nmdc:mga06r32_267742_c1
623 nmdc:mga06r32_3147_c1
624 nmdc:mga06r32_36885_c1
625 nmdc:mga06r32_4805_c1
626 nmdc:mga06r32_6987_c1
627 nmdc:mga06r32_937432_c1
628 nmdc:mga08y16_25223_c1
629 nmdc:mga08y16_290645_c1
630 nmdc:mga08y16_314708_c1
631 nmdc:mga0n895_114986_c1
632 nmdc:mga0n895_1152481_c1
633 nmdc:mga0n895_14003_c1
634 nmdc:mga0n895_29314_c1
635 nmdc:mga0n895_375415_c1
636 nmdc:mga0n895_608624_c1
637 nmdc:mga0rr50_159303_c1
638 nmdc:mga0rr50_449262_c1
639 nmdc:mga0rr50_579062_c1
640 nmdc:mga0rr50_697247_c1
641 nmdc:mga08x19_356211_c1
642 nmdc:mga0a205_26492_c1
643 nmdc:mga0a205_32736_c1
644 nmdc:mga0a205_343769_c1
645 nmdc:mga0a205_693_c1
646 Ga0501084_0016301
647 Ga0501084_0021785
648 Ga0501084_0257455
649 Ga0501082_0001716
650 Ga0501082_0046759
651 Ga0501082_0434886
652 Ga0501082_0749500
653 Ga0530510_0026588
654 Ga0530510_0094723
655 Ga0530510_0582631
656 Ga0530510_1084427

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e58-assembly1.cif.gz_B crystal structure of putative beta-phosphoglucomutase from streptococcus thermophilus 0.8141 31 112
4ex7-assembly1.cif.gz_A crystal structure of the alnumycin p phosphatase in complex with free phosphate 0.8027 31 107
3e58-assembly1.cif.gz_A crystal structure of putative beta-phosphoglucomutase from streptococcus thermophilus 0.7954 31 112
3smv-assembly1.cif.gz_A x-ray crystal structure of l-azetidine-2-carboxylate hydrolase 0.7676 31 107
1wzc-assembly1.cif.gz_A crystal structure of pyrococcus horikoshii mannosyl-3-phosphoglycerate phosphatase complexed with mg2+ and phosphate 0.7635 9 64
ID Description Score Start End Superfamily
3qu4E01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.7869 8 109 3.40.50.1000
3kzxA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.7856 11 109 3.40.50.1000
3e58A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.7843 11 112 3.40.50.1000
2ybdA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.7832 11 107 3.40.50.1000
1nnlA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.7832 11 107 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A2V7P6H8-F1-model_v4 HAD family hydrolase 0.9968 10 105
AF-A0A3N5HXA0-F1-model_v4 HAD family hydrolase 0.9892 9 80 GO:0016787
AF-A0A6L7YC01-F1-model_v4 HAD family hydrolase 0.9881 7 111 GO:0016787
AF-A0A3L7WW33-F1-model_v4 HAD family hydrolase 0.9868 9 109 GO:0016787
AF-A0A2V6PYQ9-F1-model_v4 HAD family hydrolase 0.9862 6 122

Map